Psyllid ID: psy3174


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-----
MSSTADNEVDELFDVRNSYYLGNYQQCIKEGQRLKATDPKVLLEKDFYVCRSYLAQKKYKVVLEEKLPEELSCIKVLAEYLSIPSKNGSSNFGTHLEINALKIHTYLTMYRNDLALKELKVMQDKDEDHTLTQLCSAWVHIANNVDKLNEAFYTLQDLIDKYGSTPMLVNAQVAVLIAQDKYEEAWDLLQDTAGDSEDTLINNMVTAGRLGKGNEMSVSPPFLFRSDETTATLDACGLQSNSESTPRDSGERKISAELPGESQGL
cccccccccccHHHHHHHHHHccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHcccccccccc
ccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccHHHHHcccHHHHHHHHHHHHHccHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHccccccHcccccEEEEEEcccccccc
MSSTADNEVDELFDVrnsyylgnyQQCIKEgqrlkatdpkvlleKDFYVCRSYLAQKKYKVVLEEKLPEELSCIKVLAEYlsipskngssnfgthlEINALKIHTYLTMYRNDLALKELKVMQDKDEDHTLTQLCSAWVHIANNVDKLNEAFYTLQDLIDKYGSTPMLVNAQVAVLIAQDKYEEAWDLLQdtagdsedTLINNMVTagrlgkgnemsvsppflfrsdettatldacglqsnsestprdsgerkisaelpgesqgl
msstadnevdeLFDVRNSYYLGNYQQCIKegqrlkatdpkvLLEKDFYVCRSYLAQKKYKVVLEEKLPEELSCIKVLAEYLSIPSKNGSSNFGTHLEINALKIHTYLTMYRNDLALKELKVMQDKDEDHTLTQLCSAWVHIANNVDKLNEAFYTLQDLIDKYGSTPMLVNAQVAVLIAQDKYEEAWDLLQDTAGDSEDTLINNMVTagrlgkgneMSVSPPFLFRSDETTATLdacglqsnsestprdsgerkisaelpgesqgl
MSSTADNEVDELFDVRNSYYLGNYQQCIKEGQRLKATDPKVLLEKDFYVCRSYLAQkkykvvleeklpeelSCIKVLAEYLSIPSKNGSSNFGTHLEINALKIHTYLTMYRNDLALKELKVMQDKDEDHTLTQLCSAWVHIANNVDKLNEAFYTLQDLIDKYGSTPMLVNAQVAVLIAQDKYEEAWDLLQDTAGDSEDTLINNMVTAGRLGKGNEMSVSPPFLFRSDETTATLDACGLQSNSESTPRDSGERKISAELPGESQGL
**********ELFDVRNSYYLGNYQQCIKEGQRLKATDPKVLLEKDFYVCRSYLAQKKYKVVLEEKLPEELSCIKVLAEYLSIPSKNGSSNFGTHLEINALKIHTYLTMYRNDLALKELKVMQDKDEDHTLTQLCSAWVHIANNVDKLNEAFYTLQDLIDKYGSTPMLVNAQVAVLIAQDKYEEAWDLLQDTAGDSEDTLINNMVTA**********************************************************
************FDVRNSYYLGNYQQCIKEG***********LEKDFYVCRSYLAQKKY***********LSCIKVLAEYLSIPSKNGSSNFGTHLEINALKIHTYLTMYRNDLALKELKVMQDKDEDHTLTQLCSAWVHIANNVDKLNEAFYTLQDLIDKYGSTPMLVNAQVAVLIAQDKYEEAWDLLQDTAGDSEDTLINNMVTAGRLGKGN*MSVSPPFLFRSDETTATLDACGL********************P******
********VDELFDVRNSYYLGNYQQCIKEGQRLKATDPKVLLEKDFYVCRSYLAQKKYKVVLEEKLPEELSCIKVLAEYLSIPSKNGSSNFGTHLEINALKIHTYLTMYRNDLALKELKVMQDKDEDHTLTQLCSAWVHIANNVDKLNEAFYTLQDLIDKYGSTPMLVNAQVAVLIAQDKYEEAWDLLQDTAGDSEDTLINNMVTAGRLGKGNEMSVSPPFLFRSDETTATLDACG****************************
********VDELFDVRNSYYLGNYQQCIKEGQRLKATDPKVLLEKDFYVCRSYLAQKKYKVVLEEKLPEELSCIKVLAEYLSIPSKNGSSNFGTHLEINALKIHTYLTMYRNDLALKELKVMQDKDEDHTLTQLCSAWVHIANNVDKLNEAFYTLQDLIDKYGSTPMLVNAQVAVLIAQDKYEEAWDLLQDTAGDSEDTLINNMVTAGRLGKGNEMSVSPPFLFRSDETTATLDACGLQSNSESTP*DSGERKISAELP******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSTADNEVDELFDVRNSYYLGNYQQCIKEGQRLKATDPKVLLEKDFYVCRSYLAQKKYKVVLEEKLPEELSCIKVLAEYLSIPSKNGSSNFGTHLEINALKIHTYLTMYRNDLALKELKVMQDKDEDHTLTQLCSAWVHIANNVDKLNEAFYTLQDLIDKYGSTPMLVNAQVAVLIAQDKYEEAWDLLQDTAGDSEDTLINNMVTAGRLGKGNEMSVSPPFLFRSDETTATLDACGLQSNSESTPRDSGERKISAELPGESQGL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query265 2.2.26 [Sep-21-2011]
Q28104308 Coatomer subunit epsilon yes N/A 0.815 0.701 0.381 1e-40
O89079308 Coatomer subunit epsilon yes N/A 0.811 0.698 0.394 1e-40
Q5RFR8308 Coatomer subunit epsilon yes N/A 0.815 0.701 0.377 2e-40
O14579308 Coatomer subunit epsilon no N/A 0.815 0.701 0.377 4e-40
Q60445308 Coatomer subunit epsilon yes N/A 0.815 0.701 0.381 6e-40
Q5ZIK9308 Coatomer subunit epsilon yes N/A 0.784 0.675 0.381 4e-37
Q9SA78292 Coatomer subunit epsilon- yes N/A 0.796 0.722 0.300 2e-25
O64748293 Coatomer subunit epsilon- no N/A 0.788 0.713 0.296 3e-24
P0C541297 Coatomer subunit epsilon- yes N/A 0.796 0.710 0.305 5e-24
A2XY73297 Coatomer subunit epsilon- N/A N/A 0.796 0.710 0.305 1e-23
>sp|Q28104|COPE_BOVIN Coatomer subunit epsilon OS=Bos taurus GN=COPE PE=1 SV=3 Back     alignment and function desciption
 Score =  167 bits (422), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 100/262 (38%), Positives = 145/262 (55%), Gaps = 46/262 (17%)

Query: 2   SSTADNEVDELFDVRNSYYLGNYQQCIKEGQRLKATDPKVLLEKDFYVCRSYLAQKKYKV 61
           +S    EVDELFDV+N++Y+G+YQQCI E QR+K + P+  +E+D ++ R+YLAQ+KY V
Sbjct: 9   ASGGSGEVDELFDVKNAFYIGSYQQCINEAQRVKPSSPERDVERDVFLYRAYLAQRKYGV 68

Query: 62  VLEEKLPE---ELSCIKVLAEYLSIPSKNGS-----------------SNF--------- 92
           VL+E  P    EL  +++ AEYL+  S+  +                 + F         
Sbjct: 69  VLDEIKPSSAPELQAVRMFAEYLASDSRRDAIVAELDREMSRSVDVTNTTFLLMAASIYF 128

Query: 93  --------------GTHLEINALKIHTYLTMYRNDLALKELKVMQDKDEDHTLTQLCSAW 138
                         G  LE  A+ +   L + R DLA KELK MQD+DED TLTQL +AW
Sbjct: 129 YDQNPDAALRTLHQGDSLECMAMTVQILLKLDRLDLARKELKKMQDQDEDATLTQLATAW 188

Query: 139 VHIANNVDKLNEAFYTLQDLIDKYGSTPMLVNAQVAVLIAQDKYEEAWDLLQ---DTAGD 195
           V +A   +KL +A+Y  Q++ DK   T +L+N Q A  +AQ ++E A  +LQ   D    
Sbjct: 189 VSLAAGGEKLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGVLQEALDKDSG 248

Query: 196 SEDTLINNMVTAGRLGKGNEMS 217
             +TLIN +V +  LGK  E++
Sbjct: 249 HPETLINLVVLSQHLGKPPEVT 270




The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors.
Bos taurus (taxid: 9913)
>sp|O89079|COPE_MOUSE Coatomer subunit epsilon OS=Mus musculus GN=Cope PE=2 SV=3 Back     alignment and function description
>sp|Q5RFR8|COPE_PONAB Coatomer subunit epsilon OS=Pongo abelii GN=COPE PE=2 SV=1 Back     alignment and function description
>sp|O14579|COPE_HUMAN Coatomer subunit epsilon OS=Homo sapiens GN=COPE PE=1 SV=3 Back     alignment and function description
>sp|Q60445|COPE_CRIGR Coatomer subunit epsilon OS=Cricetulus griseus GN=COPE PE=2 SV=2 Back     alignment and function description
>sp|Q5ZIK9|COPE_CHICK Coatomer subunit epsilon OS=Gallus gallus GN=COPE PE=2 SV=1 Back     alignment and function description
>sp|Q9SA78|COPE1_ARATH Coatomer subunit epsilon-1 OS=Arabidopsis thaliana GN=At1g30630 PE=2 SV=1 Back     alignment and function description
>sp|O64748|COPE2_ARATH Coatomer subunit epsilon-2 OS=Arabidopsis thaliana GN=At2g34840 PE=2 SV=1 Back     alignment and function description
>sp|P0C541|COPE2_ORYSJ Coatomer subunit epsilon-2 OS=Oryza sativa subsp. japonica GN=Os04g0644700 PE=3 SV=1 Back     alignment and function description
>sp|A2XY73|COPE2_ORYSI Coatomer subunit epsilon-2 OS=Oryza sativa subsp. indica GN=H0413E07.10 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query265
307166543299 Coatomer subunit epsilon [Camponotus flo 0.792 0.702 0.419 3e-46
383847283309 PREDICTED: coatomer subunit epsilon-like 0.818 0.702 0.404 9e-46
328787128309 PREDICTED: coatomer subunit epsilon [Api 0.818 0.702 0.396 8e-45
348505026251 PREDICTED: coatomer subunit epsilon-like 0.750 0.792 0.462 2e-44
307214673299 Coatomer subunit epsilon [Harpegnathos s 0.792 0.702 0.407 3e-44
380015783300 PREDICTED: LOW QUALITY PROTEIN: coatomer 0.818 0.723 0.393 3e-44
348505022302 PREDICTED: coatomer subunit epsilon-like 0.792 0.695 0.406 3e-42
156536866301 PREDICTED: coatomer subunit epsilon-like 0.796 0.700 0.417 6e-42
410950896257 PREDICTED: coatomer subunit epsilon isof 0.773 0.797 0.445 6e-42
260783367298 hypothetical protein BRAFLDRAFT_287380 [ 0.807 0.718 0.4 6e-42
>gi|307166543|gb|EFN60610.1| Coatomer subunit epsilon [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  191 bits (485), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 107/255 (41%), Positives = 148/255 (58%), Gaps = 45/255 (17%)

Query: 8   EVDELFDVRNSYYLGNYQQCIKEGQRLKATDPKVLLEKDFYVCRSYLAQKKYKVVLEEK- 66
           +VDELFDVRN +Y+GNYQQCI E Q++K++ P+V++E+D  + R+Y+AQ+K++VVL+E  
Sbjct: 7   DVDELFDVRNHFYIGNYQQCINEAQKIKSSSPEVVMERDVLLYRAYIAQRKFRVVLDEIN 66

Query: 67  --LPEELSCIKVLAEYLSIPSKN-----------GSSNFGTH------------------ 95
              P EL  +K LA+Y + P +               NF  H                  
Sbjct: 67  NLSPPELQPLKTLADYFANPHRREAIIAELDKEANHPNFDNHNFLIVAATIYYHEKNLEA 126

Query: 96  ----------LEINALKIHTYLTMYRNDLALKELKVMQDKDEDHTLTQLCSAWVHIANNV 145
                     LE  AL +  YL M R DLA KELK+MQ+KD+D TLTQL  AWV+I +  
Sbjct: 127 ALRILHDVDHLECMALTLQIYLKMDRPDLARKELKMMQEKDDDATLTQLAQAWVNITSGG 186

Query: 146 DKLNEAFYTLQDLIDKYGSTPMLVNAQVAVLIAQDKYEEAWDLLQ---DTAGDSEDTLIN 202
           DKL +A+Y  Q++IDK+ ST ML+N Q    I Q KYEEA   LQ   D   ++ DTLIN
Sbjct: 187 DKLQDAYYIFQEMIDKHSSTSMLLNGQATCFIGQAKYEEAETALQESLDKDSNNPDTLIN 246

Query: 203 NMVTAGRLGKGNEMS 217
            +V +  +GK  E++
Sbjct: 247 MIVVSQHMGKPPEVA 261




Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383847283|ref|XP_003699284.1| PREDICTED: coatomer subunit epsilon-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|328787128|ref|XP_393328.2| PREDICTED: coatomer subunit epsilon [Apis mellifera] Back     alignment and taxonomy information
>gi|348505026|ref|XP_003440062.1| PREDICTED: coatomer subunit epsilon-like isoform 3 [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|307214673|gb|EFN89602.1| Coatomer subunit epsilon [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|380015783|ref|XP_003691875.1| PREDICTED: LOW QUALITY PROTEIN: coatomer subunit epsilon-like [Apis florea] Back     alignment and taxonomy information
>gi|348505022|ref|XP_003440060.1| PREDICTED: coatomer subunit epsilon-like isoform 1 [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|156536866|ref|XP_001604632.1| PREDICTED: coatomer subunit epsilon-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|410950896|ref|XP_003982138.1| PREDICTED: coatomer subunit epsilon isoform 3 [Felis catus] Back     alignment and taxonomy information
>gi|260783367|ref|XP_002586747.1| hypothetical protein BRAFLDRAFT_287380 [Branchiostoma floridae] gi|229271871|gb|EEN42758.1| hypothetical protein BRAFLDRAFT_287380 [Branchiostoma floridae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query265
UNIPROTKB|F1RXG7256 LOC100525632 "Uncharacterized 0.320 0.332 0.386 2.3e-22
FB|FBgn0027496306 epsilonCOP "epsilonCOP" [Droso 0.460 0.398 0.384 2.3e-22
ZFIN|ZDB-GENE-041114-59300 cope "coatomer protein complex 0.471 0.416 0.460 2.6e-22
UNIPROTKB|Q5ZIK9308 COPE "Coatomer subunit epsilon 0.471 0.405 0.453 3e-21
UNIPROTKB|F1S7E0308 LOC100525632 "Uncharacterized 0.471 0.405 0.453 3.9e-21
UNIPROTKB|E2RAT6308 COPE "Uncharacterized protein" 0.471 0.405 0.453 4.9e-21
MGI|MGI:1891702308 Cope "coatomer protein complex 0.471 0.405 0.468 1e-20
UNIPROTKB|O14579308 COPE "Coatomer subunit epsilon 0.471 0.405 0.445 1.3e-20
UNIPROTKB|G3V8Q1308 Cope "Coatomer protein complex 0.471 0.405 0.460 1.7e-20
UNIPROTKB|Q28104308 COPE "Coatomer subunit epsilon 0.471 0.405 0.445 2.1e-20
UNIPROTKB|F1RXG7 LOC100525632 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 164 (62.8 bits), Expect = 2.3e-22, Sum P(2) = 2.3e-22
 Identities = 34/88 (38%), Positives = 52/88 (59%)

Query:     2 SSTADNEVDELFDVRNSYYLGNYQQCIKEGQRLKATDPKVLLEKDFYVCRSYLAQXXXXX 61
             +S    EVDELFDV+N++Y+G+YQQCI E QR+K + P+  +E+D ++ R+YL Q     
Sbjct:     9 ASGGSGEVDELFDVKNAFYIGSYQQCINEAQRVKPSSPERDVERDVFLYRAYLEQRKFGV 68

Query:    62 XXXXXXXXXX---SCIKVLAEYLSIPSK 86
                            I++ AEYL+  S+
Sbjct:    69 VLEEIKPSSSPELQAIRMFAEYLASDSR 96


GO:0030126 "COPI vesicle coat" evidence=IEA
GO:0006890 "retrograde vesicle-mediated transport, Golgi to ER" evidence=IEA
GO:0005198 "structural molecule activity" evidence=IEA
FB|FBgn0027496 epsilonCOP "epsilonCOP" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041114-59 cope "coatomer protein complex, subunit epsilon" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZIK9 COPE "Coatomer subunit epsilon" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1S7E0 LOC100525632 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2RAT6 COPE "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1891702 Cope "coatomer protein complex, subunit epsilon" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|O14579 COPE "Coatomer subunit epsilon" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3V8Q1 Cope "Coatomer protein complex, subunit epsilon (Predicted), isoform CRA_c" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q28104 COPE "Coatomer subunit epsilon" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q28104COPE_BOVINNo assigned EC number0.38160.81500.7012yesN/A
P0C541COPE2_ORYSJNo assigned EC number0.30590.79620.7104yesN/A
O89079COPE_MOUSENo assigned EC number0.39460.81130.6980yesN/A
Q9SA78COPE1_ARATHNo assigned EC number0.30030.79620.7226yesN/A
Q5RFR8COPE_PONABNo assigned EC number0.37780.81500.7012yesN/A
Q5ZIK9COPE_CHICKNo assigned EC number0.38180.78490.6753yesN/A
Q60445COPE_CRIGRNo assigned EC number0.38160.81500.7012yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query265
pfam04733288 pfam04733, Coatomer_E, Coatomer epsilon subunit 2e-51
>gnl|CDD|218234 pfam04733, Coatomer_E, Coatomer epsilon subunit Back     alignment and domain information
 Score =  169 bits (429), Expect = 2e-51
 Identities = 93/254 (36%), Positives = 131/254 (51%), Gaps = 47/254 (18%)

Query: 10  DELFDVRNSYYLGNYQQCIKEGQRLKATDPKVLLEKDFYVCRSYLAQKKYKVVLEE---K 66
           DELF+VRN +YLGNYQ+ I E   + +   + L+E+D Y+ RSYLA   Y++V+ E    
Sbjct: 1   DELFNVRNYFYLGNYQKAINESD-VTSLSEEALVERDVYMYRSYLALGSYQIVISEIKES 59

Query: 67  LPEELSCIKVLAEYLSIPS---------------------------------KNGSSN-- 91
               L  +++LAEYL+ PS                                   G  +  
Sbjct: 60  AATPLQAVRLLAEYLNSPSRKESILASLKEWVADSHIGSNSTLRLLAAIIFIHEGDFDDA 119

Query: 92  -----FGTHLEINALKIHTYLTMYRNDLALKELKVMQDKDEDHTLTQLCSAWVHIANNVD 146
                 G +LE  AL +   L M+R DLA ++LK MQ  DED TLTQL +AWV +A   +
Sbjct: 120 LKHLHKGENLEAMALNVQILLKMHRIDLAEQQLKKMQQIDEDATLTQLANAWVKLAVGGE 179

Query: 147 KLNEAFYTLQDLIDKYGSTPMLVNAQVAVLIAQDKYEEAWDLLQ---DTAGDSEDTLINN 203
           K+ +A+Y  Q+  +KY STP+L+N Q    +   +YEEA  LL+   D      +TLIN 
Sbjct: 180 KIQDAYYIFQEFSEKYDSTPLLLNGQAVCCMCLGRYEEAESLLKEALDKDAKDPETLINL 239

Query: 204 MVTAGRLGKGNEMS 217
           +V A  LGK  E+S
Sbjct: 240 VVCALHLGKPAEVS 253


This family represents the epsilon subunit of the coatomer complex, which is involved in the regulation of intracellular protein trafficking between the endoplasmic reticulum and the Golgi complex. Length = 288

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 265
KOG3081|consensus299 100.0
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 100.0
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.47
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.37
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.35
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.34
PRK11788389 tetratricopeptide repeat protein; Provisional 99.34
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.31
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.29
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.29
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.29
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.28
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.27
PRK11788389 tetratricopeptide repeat protein; Provisional 99.18
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.18
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.15
PRK12370553 invasion protein regulator; Provisional 99.14
PRK15359144 type III secretion system chaperone protein SscB; 99.13
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.11
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.09
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.08
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.07
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.04
PRK10370198 formate-dependent nitrite reductase complex subuni 99.02
PRK12370553 invasion protein regulator; Provisional 98.99
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.99
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.99
PRK15359144 type III secretion system chaperone protein SscB; 98.96
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.94
KOG1840|consensus508 98.93
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.92
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.91
KOG4626|consensus 966 98.89
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.88
KOG4626|consensus 966 98.87
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.86
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.82
KOG2002|consensus 1018 98.8
KOG1840|consensus508 98.79
KOG1126|consensus638 98.77
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.76
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.75
KOG1129|consensus478 98.72
PRK14574 822 hmsH outer membrane protein; Provisional 98.71
KOG0547|consensus606 98.71
KOG1126|consensus638 98.7
PRK11189296 lipoprotein NlpI; Provisional 98.7
KOG0624|consensus 504 98.69
KOG1173|consensus611 98.67
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.65
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.64
PRK10370198 formate-dependent nitrite reductase complex subuni 98.62
PRK11189296 lipoprotein NlpI; Provisional 98.6
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.6
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.59
KOG0547|consensus606 98.55
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.54
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.52
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.51
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.5
KOG1155|consensus559 98.49
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.49
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.46
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 98.45
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.43
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.39
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.38
PLN03218 1060 maturation of RBCL 1; Provisional 98.34
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.33
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.33
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.32
KOG2376|consensus 652 98.31
PRK14574 822 hmsH outer membrane protein; Provisional 98.31
PF12688120 TPR_5: Tetratrico peptide repeat 98.31
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.3
PLN03218 1060 maturation of RBCL 1; Provisional 98.3
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.3
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.27
KOG1129|consensus478 98.27
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.26
PRK10803263 tol-pal system protein YbgF; Provisional 98.25
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.24
KOG2002|consensus 1018 98.21
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.2
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 98.2
KOG1125|consensus579 98.17
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.16
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.16
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.14
KOG2076|consensus 895 98.14
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 98.13
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.1
PLN03077 857 Protein ECB2; Provisional 98.09
KOG1174|consensus564 98.04
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.02
PRK15331165 chaperone protein SicA; Provisional 98.01
KOG0624|consensus504 97.99
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.99
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.98
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.97
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.97
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.95
PLN03077 857 Protein ECB2; Provisional 97.95
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.95
PRK15331165 chaperone protein SicA; Provisional 97.91
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.9
KOG4162|consensus799 97.9
KOG0553|consensus304 97.9
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.89
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.87
KOG0550|consensus486 97.87
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.87
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.8
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.79
PRK10803263 tol-pal system protein YbgF; Provisional 97.78
KOG3785|consensus 557 97.78
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.78
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.77
KOG3060|consensus289 97.75
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.75
PF13512142 TPR_18: Tetratricopeptide repeat 97.74
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.74
KOG4162|consensus799 97.72
KOG2796|consensus366 97.71
PF1337173 TPR_9: Tetratricopeptide repeat 97.7
KOG1173|consensus611 97.7
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.66
PRK11906458 transcriptional regulator; Provisional 97.65
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.65
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 97.64
COG4700251 Uncharacterized protein conserved in bacteria cont 97.64
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 97.64
PLN02789320 farnesyltranstransferase 97.59
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.58
KOG0553|consensus304 97.56
PF1337173 TPR_9: Tetratricopeptide repeat 97.53
KOG2003|consensus 840 97.5
KOG2076|consensus 895 97.5
KOG1155|consensus559 97.5
KOG0550|consensus486 97.49
PLN02789 320 farnesyltranstransferase 97.47
KOG1174|consensus564 97.46
KOG1128|consensus 777 97.44
PF1342844 TPR_14: Tetratricopeptide repeat 97.42
KOG0548|consensus539 97.34
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.33
KOG3785|consensus 557 97.32
KOG3060|consensus289 97.27
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 97.26
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.24
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 97.19
PF12688120 TPR_5: Tetratrico peptide repeat 97.12
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.08
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.01
PF1343134 TPR_17: Tetratricopeptide repeat 97.0
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.96
KOG0495|consensus913 96.95
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 96.95
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.95
PF1342844 TPR_14: Tetratricopeptide repeat 96.9
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.84
KOG0548|consensus 539 96.83
KOG0495|consensus913 96.79
PF13512142 TPR_18: Tetratricopeptide repeat 96.77
COG4105254 ComL DNA uptake lipoprotein [General function pred 96.75
KOG1125|consensus 579 96.73
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.71
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 96.65
KOG3081|consensus299 96.62
PRK04841 903 transcriptional regulator MalT; Provisional 96.6
KOG0543|consensus397 96.6
KOG4340|consensus 459 96.59
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.57
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.54
KOG0543|consensus397 96.52
COG4700251 Uncharacterized protein conserved in bacteria cont 96.51
KOG1156|consensus 700 96.47
KOG2053|consensus 932 96.44
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 96.39
PRK04841 903 transcriptional regulator MalT; Provisional 96.37
KOG4555|consensus175 96.35
KOG1128|consensus 777 96.35
PRK11906458 transcriptional regulator; Provisional 96.3
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.28
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.22
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 96.19
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.17
COG2976207 Uncharacterized protein conserved in bacteria [Fun 96.16
KOG2471|consensus 696 96.13
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.12
KOG1156|consensus 700 96.07
KOG2376|consensus 652 96.04
PF06552186 TOM20_plant: Plant specific mitochondrial import r 95.99
KOG2003|consensus840 95.9
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 95.69
KOG1127|consensus 1238 95.65
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.62
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.53
KOG4340|consensus 459 95.5
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.32
KOG2300|consensus629 95.04
COG4976 287 Predicted methyltransferase (contains TPR repeat) 94.96
PF06552186 TOM20_plant: Plant specific mitochondrial import r 94.91
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 94.84
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 94.69
COG2976207 Uncharacterized protein conserved in bacteria [Fun 94.61
COG0457291 NrfG FOG: TPR repeat [General function prediction 94.57
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 94.56
KOG4234|consensus271 94.54
KOG4234|consensus271 94.54
KOG2796|consensus366 94.41
KOG1070|consensus1710 94.34
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 94.29
KOG1127|consensus 1238 94.27
COG4105254 ComL DNA uptake lipoprotein [General function pred 94.11
PF09477116 Type_III_YscG: Bacterial type II secretion system 93.86
KOG1308|consensus377 93.86
PF03704146 BTAD: Bacterial transcriptional activator domain; 93.74
KOG0545|consensus329 93.26
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 92.85
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 92.66
PF1286294 Apc5: Anaphase-promoting complex subunit 5 92.54
KOG2053|consensus 932 92.52
COG0457291 NrfG FOG: TPR repeat [General function prediction 92.2
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 92.16
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 92.1
KOG3364|consensus149 92.02
KOG4648|consensus 536 91.98
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 91.79
COG3898 531 Uncharacterized membrane-bound protein [Function u 91.48
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 90.96
KOG1130|consensus 639 90.94
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 90.74
KOG1915|consensus677 90.68
KOG4555|consensus175 90.67
PF03704146 BTAD: Bacterial transcriptional activator domain; 90.65
KOG2471|consensus 696 90.24
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 89.65
KOG2610|consensus 491 89.55
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 89.54
PF1343134 TPR_17: Tetratricopeptide repeat 89.41
KOG3617|consensus 1416 89.32
KOG1586|consensus 288 89.02
KOG1915|consensus 677 88.5
KOG1586|consensus288 88.45
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 88.27
PF13281374 DUF4071: Domain of unknown function (DUF4071) 88.18
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 87.9
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 87.61
KOG2610|consensus 491 87.41
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 87.16
PF09986214 DUF2225: Uncharacterized protein conserved in bact 86.72
KOG4642|consensus 284 86.12
PF1285434 PPR_1: PPR repeat 85.89
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 85.79
KOG0376|consensus 476 85.75
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 85.66
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 85.6
PF1285434 PPR_1: PPR repeat 85.41
KOG2047|consensus 835 85.23
PF1304150 PPR_2: PPR repeat family 84.93
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 84.71
KOG4648|consensus 536 84.13
COG3118304 Thioredoxin domain-containing protein [Posttransla 83.82
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 83.53
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 82.42
KOG1550|consensus 552 82.18
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 82.01
KOG1585|consensus308 81.85
PRK10941269 hypothetical protein; Provisional 81.19
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 81.15
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 80.78
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 80.07
>KOG3081|consensus Back     alignment and domain information
Probab=100.00  E-value=1.7e-61  Score=423.12  Aligned_cols=241  Identities=41%  Similarity=0.648  Sum_probs=223.7

Q ss_pred             CCCCccCCcchhHHHHHhhhhccHHHHHHHHhhcccCChhhhhhHHHHHHHHHHcccChhHHhhhc---CChHHHHHHHH
Q psy3174           1 MSSTADNEVDELFDVRNSYYLGNYQQCIKEGQRLKATDPKVLLEKDFYVCRSYLAQKKYKVVLEEK---LPEELSCIKVL   77 (265)
Q Consensus         1 ~~~~~~~~~delf~vr~~fy~G~Y~~~i~~~~~~~~~~~~~~~e~~~~~~Raylalg~~~~~l~ei---~~~~l~~~~~~   77 (265)
                      |++-+-+..|+||+|||+||+|||++||+++++...++  ...++++|+||+|||+|++..++++|   +.|++++++.+
T Consensus         1 m~~~~~g~~d~LF~iRn~fY~Gnyq~~ine~~~~~~~~--~~~e~d~y~~raylAlg~~~~~~~eI~~~~~~~lqAvr~~   78 (299)
T KOG3081|consen    1 MSSMEAGPEDELFNIRNYFYLGNYQQCINEAEKFSSSK--TDVELDVYMYRAYLALGQYQIVISEIKEGKATPLQAVRLL   78 (299)
T ss_pred             CCccccCcchhHHHHHHHHHhhHHHHHHHHHHhhcccc--chhHHHHHHHHHHHHcccccccccccccccCChHHHHHHH
Confidence            56655566699999999999999999999987766554  56789999999999999999999999   78889999999


Q ss_pred             HHHhcCCCcCcc-------------------------------cc---------cCCCHHHHHHHHHHHHHcCChHHHHH
Q psy3174          78 AEYLSIPSKNGS-------------------------------SN---------FGTHLEINALKIHTYLTMYRNDLALK  117 (265)
Q Consensus        78 A~~l~~~~~~e~-------------------------------~~---------~~~~lE~~al~v~~~l~~~r~d~Aek  117 (265)
                      |.|+..+++++.                               ++         ..+++|+.++.|+|+++|+|+|.|++
T Consensus        79 a~~~~~e~~~~~~~~~l~E~~a~~~~~sn~i~~l~aa~i~~~~~~~deAl~~~~~~~~lE~~Al~VqI~lk~~r~d~A~~  158 (299)
T KOG3081|consen   79 AEYLELESNKKSILASLYELVADSTDGSNLIDLLLAAIIYMHDGDFDEALKALHLGENLEAAALNVQILLKMHRFDLAEK  158 (299)
T ss_pred             HHHhhCcchhHHHHHHHHHHHHhhccchhHHHHHHhhHHhhcCCChHHHHHHHhccchHHHHHHHHHHHHHHHHHHHHHH
Confidence            999998887543                               11         18999999999999999999999999


Q ss_pred             HHHHHHccCCCcHHHHHHHHHHHHHhccccHHHHHHHHHHHHhhcCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHhcC--
Q psy3174         118 ELKVMQDKDEDHTLTQLCSAWVHIANNVDKLNEAFYTLQDLIDKYGSTPMLVNAQVAVLIAQDKYEEAWDLLQDTAGD--  195 (265)
Q Consensus       118 ~l~~~~~~~~d~~l~~la~a~v~l~~g~~~~~eA~~~~~el~~~~p~t~~lLn~~A~~~~~~g~~eEAe~~l~~al~~--  195 (265)
                      .+++|++|++|+|++|||++||++++|++++++|||+|+|+.+++|.|+.++||+|+|+|++|||+||+.+++++|++  
T Consensus       159 ~lk~mq~ided~tLtQLA~awv~la~ggek~qdAfyifeE~s~k~~~T~~llnG~Av~~l~~~~~eeAe~lL~eaL~kd~  238 (299)
T KOG3081|consen  159 ELKKMQQIDEDATLTQLAQAWVKLATGGEKIQDAFYIFEELSEKTPPTPLLLNGQAVCHLQLGRYEEAESLLEEALDKDA  238 (299)
T ss_pred             HHHHHHccchHHHHHHHHHHHHHHhccchhhhhHHHHHHHHhcccCCChHHHccHHHHHHHhcCHHHHHHHHHHHHhccC
Confidence            999999999999999999999999999999999999999999999999999999999999999999999999999998  


Q ss_pred             -CHHHHHHHHHHHHHcCCCCccC-----------CCChhhhcHHHHHHHHHHHHhhcccc
Q psy3174         196 -SEDTLINNMVTAGRLGKGNEMS-----------VSPPFLFRSDETTATLDACGLQSNSE  243 (265)
Q Consensus       196 -~pdtl~nl~~~~~~~Gk~~ea~-----------p~hp~~~~~~~~~~~FD~~~~~~~~~  243 (265)
                       +|+||+|++|++.++||++++.           |.|||+++++++++.|||++.+|.++
T Consensus       239 ~dpetL~Nliv~a~~~Gkd~~~~~r~l~QLk~~~p~h~~vk~~~ekeaeFDrl~~qy~~s  298 (299)
T KOG3081|consen  239 KDPETLANLIVLALHLGKDAEVTERNLSQLKLSHPEHPFVKHLNEKEAEFDRLVLQYDTS  298 (299)
T ss_pred             CCHHHHHHHHHHHHHhCCChHHHHHHHHHHHhcCCcchHHHHHHHHHHHHHHHHHHhccC
Confidence             9999999999999999996643           99999999999999999999999875



>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG4626|consensus Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG4626|consensus Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG1129|consensus Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2376|consensus Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG1129|consensus Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1174|consensus Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG4162|consensus Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG3785|consensus Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG3060|consensus Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG4162|consensus Back     alignment and domain information
>KOG2796|consensus Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1174|consensus Back     alignment and domain information
>KOG1128|consensus Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG3785|consensus Back     alignment and domain information
>KOG3060|consensus Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0495|consensus Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>KOG0495|consensus Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG3081|consensus Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>KOG4340|consensus Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG1156|consensus Back     alignment and domain information
>KOG2053|consensus Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG4555|consensus Back     alignment and domain information
>KOG1128|consensus Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2471|consensus Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG1156|consensus Back     alignment and domain information
>KOG2376|consensus Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1127|consensus Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG4340|consensus Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG2300|consensus Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG4234|consensus Back     alignment and domain information
>KOG4234|consensus Back     alignment and domain information
>KOG2796|consensus Back     alignment and domain information
>KOG1070|consensus Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG1127|consensus Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF09477 Type_III_YscG: Bacterial type II secretion system chaperone protein (type_III_yscG); InterPro: IPR013348 YscG is a molecular chaperone for YscE, where both are part of the type III secretion system that in Yersinia is designated Ysc (Yersinia secretion) Back     alignment and domain information
>KOG1308|consensus Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG0545|consensus Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG2053|consensus Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG3364|consensus Back     alignment and domain information
>KOG4648|consensus Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG1130|consensus Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG1915|consensus Back     alignment and domain information
>KOG4555|consensus Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG2471|consensus Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG2610|consensus Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG1586|consensus Back     alignment and domain information
>KOG1915|consensus Back     alignment and domain information
>KOG1586|consensus Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG2610|consensus Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG4642|consensus Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG0376|consensus Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG2047|consensus Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>KOG4648|consensus Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG1550|consensus Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG1585|consensus Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query265
3mkr_A291 Crystal Structure Of Yeast AlphaEPSILON-Cop Subcomp 2e-33
>pdb|3MKR|A Chain A, Crystal Structure Of Yeast AlphaEPSILON-Cop Subcomplex Of The Copi Vesicular Coat Length = 291 Back     alignment and structure

Iteration: 1

Score = 139 bits (350), Expect = 2e-33, Method: Compositional matrix adjust. Identities = 88/254 (34%), Positives = 130/254 (51%), Gaps = 46/254 (18%) Query: 10 DELFDVRNSYYLGNYQQCIKEGQRLKATDPKVLLEKDFYVCRSYLAQXX---XXXXXXXX 66 DELFDV+N++Y+G+YQQCI E QR+K + P+ +E+D ++ R+YLAQ Sbjct: 1 DELFDVKNAFYIGSYQQCINEAQRVKPSSPERDVERDVFLYRAYLAQRKYGVVLDEIKPS 60 Query: 67 XXXXXSCIKVLAEYLSIPSKNGS-----------------SNF----------------- 92 +++ AEYL+ S+ + + F Sbjct: 61 SAPELQAVRMFAEYLASHSRRDAIVAELDREMSRSVDVTNTTFLLMAASIYFYDQNPDAA 120 Query: 93 ------GTHLEINALKIHTYLTMYRNDLALKELKVMQDKDEDHTLTQLCSAWVHIANNVD 146 G LE A+ + L + R DLA KELK MQD+DED TLTQL +AWV +A + Sbjct: 121 LRTLHQGDSLECMAMTVQILLKLDRLDLARKELKKMQDQDEDATLTQLATAWVSLAAGGE 180 Query: 147 KLNEAFYTLQDLIDKYGSTPMLVNAQVAVLIAQDKYEEAWDLLQ---DTAGDSEDTLINN 203 KL +A+Y Q++ DK T +L+N Q A +AQ ++E A +LQ D +TLIN Sbjct: 181 KLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGVLQEALDKDSGHPETLINL 240 Query: 204 MVTAGRLGKGNEMS 217 +V + LGK E++ Sbjct: 241 VVLSQHLGKPPEVT 254

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query265
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 1e-40
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 5e-37
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
 Score =  141 bits (355), Expect = 1e-40
 Identities = 95/252 (37%), Positives = 138/252 (54%), Gaps = 46/252 (18%)

Query: 10  DELFDVRNSYYLGNYQQCIKEGQRLKATDPKVLLEKDFYVCRSYLAQKKYKVVLEEKLPE 69
           DELFDV+N++Y+G+YQQCI E QR+K + P+  +E+D ++ R+YLAQ+KY VVL+E  P 
Sbjct: 1   DELFDVKNAFYIGSYQQCINEAQRVKPSSPERDVERDVFLYRAYLAQRKYGVVLDEIKPS 60

Query: 70  ---ELSCIKVLAEYLSIPSKNGSS------------------------------------ 90
              EL  +++ AEYL+  S+  +                                     
Sbjct: 61  SAPELQAVRMFAEYLASHSRRDAIVAELDREMSRSVDVTNTTFLLMAASIYFYDQNPDAA 120

Query: 91  ----NFGTHLEINALKIHTYLTMYRNDLALKELKVMQDKDEDHTLTQLCSAWVHIANNVD 146
               + G  LE  A+ +   L + R DLA KELK MQD+DED TLTQL +AWV +A   +
Sbjct: 121 LRTLHQGDSLECMAMTVQILLKLDRLDLARKELKKMQDQDEDATLTQLATAWVSLAAGGE 180

Query: 147 KLNEAFYTLQDLIDKYGSTPMLVNAQVAVLIAQDKYEEAWDLLQDTAG---DSEDTLINN 203
           KL +A+Y  Q++ DK   T +L+N Q A  +AQ ++E A  +LQ+         +TLIN 
Sbjct: 181 KLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGVLQEALDKDSGHPETLINL 240

Query: 204 MVTAGRLGKGNE 215
           +V +  LGK  E
Sbjct: 241 VVLSQHLGKPPE 252


>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Length = 310 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query265
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 100.0
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 100.0
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.6
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.59
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.59
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.58
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.57
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.55
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.55
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.54
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.53
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.53
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.5
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.5
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.5
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.49
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.49
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.48
3u4t_A272 TPR repeat-containing protein; structural genomics 99.48
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.48
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.47
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.46
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.45
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.45
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.45
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.44
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.44
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.43
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.43
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.41
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.4
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.4
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.4
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.39
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.39
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.37
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.37
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.37
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.36
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.36
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.36
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.36
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.34
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.34
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.34
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.32
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.32
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.32
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.31
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.31
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.3
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.3
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.28
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.27
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.27
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.26
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 99.25
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.25
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.24
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.24
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.24
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.23
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.23
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.22
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.22
3u4t_A272 TPR repeat-containing protein; structural genomics 99.22
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.22
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.22
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.21
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.21
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.2
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.2
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.18
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.17
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.16
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.16
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.16
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.15
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.13
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.13
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.13
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.12
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.11
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.11
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.1
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.09
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.09
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.08
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.07
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.07
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.07
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.06
3k9i_A117 BH0479 protein; putative protein binding protein, 99.06
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.06
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.05
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.05
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.05
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.04
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.04
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.04
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.04
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 99.04
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.03
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.03
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.03
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.03
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.01
4g1t_A 472 Interferon-induced protein with tetratricopeptide 98.99
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.97
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.96
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.96
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.95
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.95
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.94
4g1t_A 472 Interferon-induced protein with tetratricopeptide 98.94
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.93
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.92
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.92
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.89
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.89
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.87
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.84
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.84
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.82
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.82
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.82
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.82
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.81
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.81
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.8
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.8
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.78
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.77
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.76
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.76
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.75
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.75
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.74
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.73
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.72
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.71
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.71
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.7
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 98.68
3k9i_A117 BH0479 protein; putative protein binding protein, 98.67
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.66
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 98.65
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.64
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.64
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.64
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.63
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.62
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.62
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.62
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.62
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.62
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.61
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.61
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.59
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.58
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.56
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.56
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.55
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.52
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.51
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.51
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.5
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.5
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.5
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.48
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.47
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.47
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.46
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.46
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.46
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.45
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.45
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 98.39
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 98.39
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.39
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.38
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.37
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.28
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.22
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.22
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.21
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.2
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.18
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.11
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.07
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.05
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.98
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.91
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.87
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 97.82
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.79
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.76
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.73
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.68
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.65
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 97.62
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.59
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.53
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.52
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 97.48
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 97.37
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 97.33
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.3
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 97.29
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 97.22
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.07
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.07
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.98
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 96.94
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 96.85
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.68
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.67
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.62
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 96.23
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 96.17
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.15
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 96.0
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 95.97
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 95.66
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 94.73
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 94.53
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 93.4
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 92.88
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 92.61
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 91.93
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 91.14
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 91.06
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 90.56
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 89.53
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 88.6
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 88.47
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 87.94
2p58_C116 Putative type III secretion protein YSCG; type III 85.1
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 84.2
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 83.37
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 81.65
2uwj_G115 Type III export protein PSCG; virulence, chaperone 81.55
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 81.45
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 80.99
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 80.23
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
Probab=100.00  E-value=5.4e-47  Score=345.27  Aligned_cols=229  Identities=17%  Similarity=0.250  Sum_probs=195.1

Q ss_pred             cCCcchhHHHHHhhhhccHHHHHHHHhhcccCChhhhhhHHHHHHHHHHcccChhHHhhhcCChHHHHHHHHHHHhcCCC
Q psy3174           6 DNEVDELFDVRNSYYLGNYQQCIKEGQRLKATDPKVLLEKDFYVCRSYLAQKKYKVVLEEKLPEELSCIKVLAEYLSIPS   85 (265)
Q Consensus         6 ~~~~delf~vr~~fy~G~Y~~~i~~~~~~~~~~~~~~~e~~~~~~Raylalg~~~~~l~ei~~~~l~~~~~~A~~l~~~~   85 (265)
                      ..|+|+||+|||+||+|+|++||++++++++.++   .++++|+||||||+|++..+.+  ++|.+++|+++|+|+..+.
T Consensus        11 ~~~~~~lf~ikn~fy~G~yq~~i~e~~~~~~~~~---~~~~~~~~Rs~iAlg~~~~~~~--~~~~~~a~~~la~~~~~~a   85 (310)
T 3mv2_B           11 SQDPMDYFNIKQNYYTGNFVQCLQEIEKFSKVTD---NTLLFYKAKTLLALGQYQSQDP--TSKLGKVLDLYVQFLDTKN   85 (310)
T ss_dssp             ----CCTHHHHHHHTTTCHHHHTHHHHTSSCCCC---HHHHHHHHHHHHHTTCCCCCCS--SSTTHHHHHHHHHHHTTTC
T ss_pred             CCCcHHHHHHHHHHHhhHHHHHHHHHHhcCccch---HHHHHHHHHHHHHcCCCccCCC--CCHHHHHHHHHHHHhcccH
Confidence            4689999999999999999999999877665444   4689999999999999986554  6777889999999997542


Q ss_pred             cCc---------c---------------cc--------------c--CCCHHHHHHHHHHHHHcCChHHHHHHHHHHHcc
Q psy3174          86 KNG---------S---------------SN--------------F--GTHLEINALKIHTYLTMYRNDLALKELKVMQDK  125 (265)
Q Consensus        86 ~~e---------~---------------~~--------------~--~~~lE~~al~v~~~l~~~r~d~Aek~l~~~~~~  125 (265)
                      ...         .               ++              .  ++++|++++.|++++++||+|+|++++++|+++
T Consensus        86 ~~~l~~l~~~~~~~~~~~~~la~i~~~~g~~eeAL~~l~~~i~~~~~~~~lea~~l~vqi~L~~~r~d~A~k~l~~~~~~  165 (310)
T 3mv2_B           86 IEELENLLKDKQNSPYELYLLATAQAILGDLDKSLETCVEGIDNDEAEGTTELLLLAIEVALLNNNVSTASTIFDNYTNA  165 (310)
T ss_dssp             CHHHHHTTTTSCCCHHHHHHHHHHHHHHTCHHHHHHHHHHHHTSSCSTTHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHhcCCCCcHHHHHHHHHHHHcCCHHHHHHHHHHHhccCCCcCcHHHHHHHHHHHHHCCCHHHHHHHHHHHHhc
Confidence            110         0               11              1  289999999999999999999999999999999


Q ss_pred             CC------CcHHHHHHHHHHHHHhccccHHHHHHHHHHHHhhcCC---CHHHHHHHHHHHHHcCCHHHHHHHHHHHhc--
Q psy3174         126 DE------DHTLTQLCSAWVHIANNVDKLNEAFYTLQDLIDKYGS---TPMLVNAQVAVLIAQDKYEEAWDLLQDTAG--  194 (265)
Q Consensus       126 ~~------d~~l~~la~a~v~l~~g~~~~~eA~~~~~el~~~~p~---t~~lLn~~A~~~~~~g~~eEAe~~l~~al~--  194 (265)
                      +|      |+++++|+++|+++.+|++++++|+++|+|+.+++|+   +..++|    |++++|+|+||+..++.+++  
T Consensus       166 ~~d~~~~~d~~l~~Laea~v~l~~g~~~~q~A~~~f~El~~~~p~~~~~~lLln----~~~~~g~~~eAe~~L~~l~~~~  241 (310)
T 3mv2_B          166 IEDTVSGDNEMILNLAESYIKFATNKETATSNFYYYEELSQTFPTWKTQLGLLN----LHLQQRNIAEAQGIVELLLSDY  241 (310)
T ss_dssp             SCHHHHHHHHHHHHHHHHHHHHHHTCSTTTHHHHHHHHHHTTSCSHHHHHHHHH----HHHHHTCHHHHHHHHHHHHSHH
T ss_pred             CccccccchHHHHHHHHHHHHHHhCCccHHHHHHHHHHHHHhCCCcccHHHHHH----HHHHcCCHHHHHHHHHHHHHhc
Confidence            98      7999999999999999999999999999999999996   445666    89999999999999987665  


Q ss_pred             ----------C-CHHHHHHHHHHHHHcCCCCccC--------CCChhhhcHHHHHHHHHHHHhhcccc
Q psy3174         195 ----------D-SEDTLINNMVTAGRLGKGNEMS--------VSPPFLFRSDETTATLDACGLQSNSE  243 (265)
Q Consensus       195 ----------~-~pdtl~nl~~~~~~~Gk~~ea~--------p~hp~~~~~~~~~~~FD~~~~~~~~~  243 (265)
                                . ||++++|+|+++.++|+..+.+        |+||+++++.++++.||+++.+|+++
T Consensus       242 p~~~~k~~~~p~~~~~LaN~i~l~~~lgk~a~~l~~qL~~~~P~hp~i~d~~~k~~~Fd~~~~ky~~~  309 (310)
T 3mv2_B          242 YSVEQKENAVLYKPTFLANQITLALMQGLDTEDLTNQLVKLDHEHAFIKHHQEIDAKFDELVRKYDTS  309 (310)
T ss_dssp             HHTTTCHHHHSSHHHHHHHHHHHHHHTTCTTHHHHHHHHHTTCCCHHHHHHHHHHHHHHHHHHTCC--
T ss_pred             ccccccccCCCCCHHHHHHHHHHHHHhChHHHHHHHHHHHhCCCChHHHHHHHHHHHHHHHHHHhcCC
Confidence                      2 8999999999999999955443        99999999999999999999999865



>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query265
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.61
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.57
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.48
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.35
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.28
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.17
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.14
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.12
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.12
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.1
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.08
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.98
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.9
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.9
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.87
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.84
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.79
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.78
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.74
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.72
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.72
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.69
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.69
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.67
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.64
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.6
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.59
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.56
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.48
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.46
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.44
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.38
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.37
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 98.36
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.34
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.32
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.25
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.24
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.15
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.12
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.01
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.98
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 97.97
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.96
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.96
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 97.89
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.79
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.73
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.55
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.54
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.02
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 96.98
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 96.94
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.71
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.93
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 92.96
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.61  E-value=2e-14  Score=124.70  Aligned_cols=123  Identities=15%  Similarity=0.007  Sum_probs=76.8

Q ss_pred             CCCHHHHHHHHHHHHHcCChHHHHHHHHHHHccCCCcHHHHHHHHHHHHHhccccHHHHHHHHHHHHhhcCCCHHHHHHH
Q psy3174          93 GTHLEINALKIHTYLTMYRNDLALKELKVMQDKDEDHTLTQLCSAWVHIANNVDKLNEAFYTLQDLIDKYGSTPMLVNAQ  172 (265)
Q Consensus        93 ~~~lE~~al~v~~~l~~~r~d~Aek~l~~~~~~~~d~~l~~la~a~v~l~~g~~~~~eA~~~~~el~~~~p~t~~lLn~~  172 (265)
                      +...+....++.++...|++++|.+.|+++++++|+++.+....+.+....  +++.+|...|+.+....|.++..+..+
T Consensus       234 ~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~--~~~~~A~~~~~~~~~~~~~~~~~~~~l  311 (388)
T d1w3ba_         234 PNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEK--GSVAEAEDCYNTALRLCPTHADSLNNL  311 (388)
T ss_dssp             TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSCHHHHHHHHHHHHHH--SCHHHHHHHHHHHHHHCTTCHHHHHHH
T ss_pred             hhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHc--CCHHHHHHHHHhhhccCCccchhhhHH
Confidence            445555555666666666666666666666666666654433333333323  556666666666666666666666666


Q ss_pred             HHHHHHcCCHHHHHHHHHHHhcC---CHHHHHHHHHHHHHcCCCCccC
Q psy3174         173 VAVLIAQDKYEEAWDLLQDTAGD---SEDTLINNMVTAGRLGKGNEMS  217 (265)
Q Consensus       173 A~~~~~~g~~eEAe~~l~~al~~---~pdtl~nl~~~~~~~Gk~~ea~  217 (265)
                      +.++..+|++++|...++++++.   +++++.+++.++..+|+..++.
T Consensus       312 ~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~  359 (388)
T d1w3ba_         312 ANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEAL  359 (388)
T ss_dssp             HHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHH
T ss_pred             HHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHH
Confidence            77777777777777777777666   4446667777777777666543



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure