Psyllid ID: psy3396

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
EQLAELEAAFAKSHYPDIYCREELAILFQVWFQNRRAKYRKQEKQLQKALTPSVIPTCNGAMMRNIYPTTSRGYQPYPHPNTINRQHFVILVPGMSTEDEWYNKSLSALRMNSSHHSNLATPMLQYQT
cHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHcHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcc
EQLAELEAAFAkshypdiycrEELAILFQVWFQNRRAKYRKQEKQLQkaltpsviptcngammrniypttsrgyqpyphpntinrqHFVIlvpgmstedEWYNKSLSALRmnsshhsnlatpmlqyqt
EQLAELEAAfakshypdiyCREELAILFQVWFQNRRAKYRKQEkqlqkaltpsviptcngAMMRNIYPTTSRGYQPYPHPNTINRQHFVILVPGMSTEDEWYNKSLSALRMNsshhsnlatpmlqyqt
EQLAELEAAFAKSHYPDIYCREELAILFQVWFQNRRAKYRKQEKQLQKALTPSVIPTCNGAMMRNIYPTTSRGYQPYPHPNTINRQHFVILVPGMSTEDEWYNKSLSALRMNSSHHSNLATPMLQYQT
*******AAFAKSHYPDIYCREELAILFQVWFQNRRAKYRK****LQKALTPSVIPTCNGAMMRNIYPTTSRGYQPYPHPNTINRQHFVILVPGMSTEDEWYN*************************
*QLAELEAAFAKSHYPDIYCREELAILFQVWFQNRRAK******************************************************************************************
EQLAELEAAFAKSHYPDIYCREELAILFQVWFQNRRAK***********LTPSVIPTCNGAMMRNIYPTTSRGYQPYPHPNTINRQHFVILVPGMSTEDEWYNKSLSALRMNSSHHSNLATPMLQYQT
EQLAELEAAFAKSHYPDIYCREELAILFQVWFQNRRAKYRKQEKQL******SVIPTCNGAMMRNIYPTTSRGYQPYPHPNTINRQHFVILVPGMSTEDEWYNKSLSALRMNSSHHSNLATPMLQYQT
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
EQLAELEAAFAKSHYPDIYCREELAILFQVWFQNRRAKYRKQEKQLQKALTPSVIPTCNGAMMRNIYPTTSRGYQPYPHPNTINRQHFVILVPGMSTEDEWYNKSLSALRMNSSHHSNLATPMLQYQT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query128 2.2.26 [Sep-21-2011]
O97039268 Retinal homeobox protein N/A N/A 0.585 0.279 0.455 3e-12
Q9W2Q1 873 Retinal homeobox protein no N/A 0.335 0.049 0.66 3e-12
Q9I9A2327 Retinal homeobox protein N/A N/A 0.335 0.131 0.66 5e-12
Q9I9D5334 Retinal homeobox protein N/A N/A 0.382 0.146 0.607 6e-12
O42357327 Retinal homeobox protein no N/A 0.335 0.131 0.66 7e-12
O42356330 Retinal homeobox protein no N/A 0.335 0.130 0.66 7e-12
O42567325 Retinal homeobox protein N/A N/A 0.335 0.132 0.66 8e-12
O42201322 Retinal homeobox protein N/A N/A 0.335 0.133 0.66 9e-12
Q9PVX0317 Retinal homeobox protein yes N/A 0.335 0.135 0.66 9e-12
Q9JLT7342 Retinal homeobox protein yes N/A 0.335 0.125 0.66 9e-12
>sp|O97039|RX_DUGJA Retinal homeobox protein Rax (Fragment) OS=Dugesia japonica GN=RAX PE=2 SV=1 Back     alignment and function desciption
 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/90 (45%), Positives = 50/90 (55%), Gaps = 15/90 (16%)

Query: 2   QLAELEAAFAKSHYPDIYCREELA-------ILFQVWFQNRRAKYRKQEKQLQKALT--- 51
           QL ELE AF KSHYPD+Y REELA       +  QVWFQNRRAK+R+QEK      T   
Sbjct: 98  QLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAANHTHNL 157

Query: 52  PSVIPTCNGAMMRNIYPTTSRGYQPYPHPN 81
             V P    ++  +++P       PYP  N
Sbjct: 158 QEVFPNVGKSLTSSLFPAN-----PYPFLN 182

Dugesia japonica (taxid: 6161)
>sp|Q9W2Q1|RX_DROME Retinal homeobox protein Rx OS=Drosophila melanogaster GN=Rx PE=2 SV=2 Back     alignment and function description
>sp|Q9I9A2|RX2_ORYLA Retinal homeobox protein Rx2 OS=Oryzias latipes GN=rx2 PE=2 SV=1 Back     alignment and function description
>sp|Q9I9D5|RX1_ASTFA Retinal homeobox protein Rx1 OS=Astyanax fasciatus GN=rx1 PE=2 SV=1 Back     alignment and function description
>sp|O42357|RX2_DANRE Retinal homeobox protein Rx2 OS=Danio rerio GN=rx2 PE=2 SV=1 Back     alignment and function description
>sp|O42356|RX1_DANRE Retinal homeobox protein Rx1 OS=Danio rerio GN=rx1 PE=2 SV=2 Back     alignment and function description
>sp|O42567|RXB_XENLA Retinal homeobox protein Rx-B OS=Xenopus laevis GN=rax-b PE=2 SV=2 Back     alignment and function description
>sp|O42201|RXA_XENLA Retinal homeobox protein Rx-A OS=Xenopus laevis GN=rax-a PE=2 SV=2 Back     alignment and function description
>sp|Q9PVX0|RX2_CHICK Retinal homeobox protein Rx2 OS=Gallus gallus GN=RX2 PE=2 SV=1 Back     alignment and function description
>sp|Q9JLT7|RX_RAT Retinal homeobox protein Rx OS=Rattus norvegicus GN=Rax PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query128
270005291 235 hypothetical protein TcasGA2_TC007335 [T 1.0 0.544 0.660 1e-50
189236543 405 PREDICTED: similar to homeobox protein [ 1.0 0.316 0.625 7e-50
242010483 480 Ptx1 homeodomain protein, putative [Pedi 0.992 0.264 0.646 8e-48
383850991 431 PREDICTED: uncharacterized protein LOC10 0.984 0.292 0.628 4e-47
340723881 460 PREDICTED: hypothetical protein LOC10064 0.984 0.273 0.628 6e-47
332022279 281 Homeobox protein prophet of Pit-1 [Acrom 0.984 0.448 0.628 6e-47
328792935 377 PREDICTED: hypothetical protein LOC72653 0.984 0.334 0.628 6e-47
195398755 664 GJ15837 [Drosophila virilis] gi|19415041 0.992 0.191 0.638 6e-47
157114702 236 homeobox protein [Aedes aegypti] gi|1088 0.992 0.538 0.644 7e-47
307169524 313 Homeobox protein prophet of Pit-1 [Campo 0.984 0.402 0.628 7e-47
>gi|270005291|gb|EFA01739.1| hypothetical protein TcasGA2_TC007335 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  204 bits (518), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 112/162 (69%), Gaps = 34/162 (20%)

Query: 1   EQLAELEAAFAKSHYPDIYCREELA-------ILFQVWFQNRRAKYRKQEKQLQKALTPS 53
           EQLAELEAAFAKSHYPDIYCREELA          QVWFQNRRAKYRKQEKQLQKAL PS
Sbjct: 74  EQLAELEAAFAKSHYPDIYCREELARSTKLNEARIQVWFQNRRAKYRKQEKQLQKALAPS 133

Query: 54  VIPTCNGAMMRNIYPTTSRGYQPYPHPNTINR-------------QHF-------VILVP 93
           V+P CNGAMMRNIYP  +RGYQPYPHP  INR             Q F       +  V 
Sbjct: 134 VLPGCNGAMMRNIYPGAARGYQPYPHPTAINRYPQMTTSSYPGMAQSFSMSHGTNMTTVA 193

Query: 94  G-------MSTEDEWYNKSLSALRMNSSHHSNLATPMLQYQT 128
           G       MS EDEWYNKSLSALRMN++HH NLA PMLQYQT
Sbjct: 194 GMRQDAMSMSAEDEWYNKSLSALRMNTTHHPNLAAPMLQYQT 235

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|189236543|ref|XP_975529.2| PREDICTED: similar to homeobox protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242010483|ref|XP_002425997.1| Ptx1 homeodomain protein, putative [Pediculus humanus corporis] gi|212509988|gb|EEB13259.1| Ptx1 homeodomain protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|383850991|ref|XP_003701047.1| PREDICTED: uncharacterized protein LOC100880559 [Megachile rotundata] Back     alignment and taxonomy information
>gi|340723881|ref|XP_003400315.1| PREDICTED: hypothetical protein LOC100649943 [Bombus terrestris] Back     alignment and taxonomy information
>gi|332022279|gb|EGI62592.1| Homeobox protein prophet of Pit-1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|328792935|ref|XP_003251804.1| PREDICTED: hypothetical protein LOC726538 [Apis mellifera] Back     alignment and taxonomy information
>gi|195398755|ref|XP_002057986.1| GJ15837 [Drosophila virilis] gi|194150410|gb|EDW66094.1| GJ15837 [Drosophila virilis] Back     alignment and taxonomy information
>gi|157114702|ref|XP_001652379.1| homeobox protein [Aedes aegypti] gi|108883532|gb|EAT47757.1| AAEL001148-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|307169524|gb|EFN62166.1| Homeobox protein prophet of Pit-1 [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query128
FB|FBgn0052532736 CG32532 [Drosophila melanogast 0.656 0.114 0.784 2.2e-46
WB|WBGene00006778264 unc-42 [Caenorhabditis elegans 0.625 0.303 0.531 1.8e-16
UNIPROTKB|Q9PVY0228 RX1 "Retinal homeobox protein 0.335 0.188 0.66 4.5e-15
UNIPROTKB|F1NH36262 Gga.55791 "Uncharacterized pro 0.335 0.164 0.66 9.6e-15
ZFIN|ZDB-GENE-990415-237327 rx2 "retinal homeobox gene 2" 0.335 0.131 0.66 2.4e-14
UNIPROTKB|Q5XKR4325 OTP "Homeobox protein orthoped 0.437 0.172 0.515 8.9e-14
UNIPROTKB|F2Z5H5325 OTP "Uncharacterized protein" 0.437 0.172 0.515 8.9e-14
MGI|MGI:99835325 Otp "orthopedia homolog (Droso 0.437 0.172 0.515 8.9e-14
UNIPROTKB|G3V7E0325 Otp "Protein Otp" [Rattus norv 0.437 0.172 0.515 8.9e-14
ZFIN|ZDB-GENE-990415-238292 rx3 "retinal homeobox gene 3" 0.335 0.147 0.66 3.4e-13
FB|FBgn0052532 CG32532 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 351 (128.6 bits), Expect = 2.2e-46, Sum P(2) = 2.2e-46
 Identities = 73/93 (78%), Positives = 76/93 (81%)

Query:     1 EQLAELEAAFAKSHYPDIYCREELA-------ILFQVWFQNRRAKYRKQEKQLQKALTPS 53
             EQLAELEAAFAKSHYPDIYCREELA          QVWFQNRRAKYRKQEKQLQKAL PS
Sbjct:   520 EQLAELEAAFAKSHYPDIYCREELARTTKLNEARIQVWFQNRRAKYRKQEKQLQKALAPS 579

Query:    54 VIPTCNGAMMRNIYP-TTSRGYQPYPHPNTINR 85
             VIP+CNG MMRNI   + SRGYQPYPH NT+NR
Sbjct:   580 VIPSCNG-MMRNIQGYSVSRGYQPYPHHNTMNR 611
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0005634 "nucleus" evidence=ISS
GO:0003677 "DNA binding" evidence=ISS
GO:0043565 "sequence-specific DNA binding" evidence=IEA
WB|WBGene00006778 unc-42 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q9PVY0 RX1 "Retinal homeobox protein Rx1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NH36 Gga.55791 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-237 rx2 "retinal homeobox gene 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5XKR4 OTP "Homeobox protein orthopedia" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5H5 OTP "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:99835 Otp "orthopedia homolog (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|G3V7E0 Otp "Protein Otp" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-238 rx3 "retinal homeobox gene 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query128
pfam0004657 pfam00046, Homeobox, Homeobox domain 2e-13
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 2e-11
smart0038957 smart00389, HOX, Homeodomain 8e-11
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 3e-06
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information 
 Score = 59.8 bits (146), Expect = 2e-13
 Identities = 24/48 (50%), Positives = 29/48 (60%), Gaps = 7/48 (14%)

Query: 1  EQLAELEAAFAKSHYPDIYCREELAILF-------QVWFQNRRAKYRK 41
          EQL ELE  F K+ YP    REELA          +VWFQNRRAK+++
Sbjct: 10 EQLEELEKEFEKNRYPSAEEREELAKKLGLTERQVKVWFQNRRAKWKR 57

Length = 57
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 128
KOG0850|consensus245 99.8
KOG0484|consensus125 99.78
KOG0489|consensus261 99.76
KOG0488|consensus309 99.71
KOG0842|consensus307 99.71
KOG0491|consensus194 99.69
KOG0487|consensus308 99.67
KOG0844|consensus408 99.66
KOG0492|consensus246 99.65
KOG2251|consensus228 99.62
KOG0848|consensus317 99.61
KOG0843|consensus197 99.59
KOG0486|consensus351 99.57
KOG0494|consensus332 99.57
KOG0485|consensus268 99.57
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.47
KOG0493|consensus342 99.46
KOG0483|consensus198 99.38
COG5576156 Homeodomain-containing transcription factor [Trans 99.37
KOG0847|consensus288 99.31
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.31
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.31
KOG4577|consensus383 99.26
KOG0490|consensus235 99.22
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.07
KOG0849|consensus354 99.03
KOG3802|consensus398 98.85
KOG0775|consensus304 98.64
KOG1168|consensus385 98.23
KOG0774|consensus334 97.84
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 97.76
KOG0490|consensus235 97.58
KOG1146|consensus 1406 96.14
KOG2252|consensus558 95.73
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 95.39
KOG3623|consensus 1007 93.71
PF0382621 OAR: OAR domain; InterPro: IPR003654 This 14 amino 92.37
>KOG0850|consensus Back     alignment and domain information 
Probab=99.80  E-value=1.7e-19  Score=133.97  Aligned_cols=50  Identities=38%  Similarity=0.632  Sum_probs=46.1

Q ss_pred             hHHHHHHHHHhcCCCCHHHHHHHHH-------HHHHhhhchHHHHHHHHHhhhhhcC
Q psy3396           2 QLAELEAAFAKSHYPDIYCREELAI-------LFQVWFQNRRAKYRKQEKQLQKALT   51 (128)
Q Consensus         2 Ql~~Le~~F~~~~y~~~~~r~~La~-------qVkiWFQNRRak~kr~~~~~~~~~~   51 (128)
                      ||..|.++|++++|+..++|+|||+       ||||||||||.|.||..+++....+
T Consensus       133 QLqaL~rRFQkTQYLALPERAeLAAsLGLTQTQVKIWFQNrRSK~KKl~k~g~~~~e  189 (245)
T KOG0850|consen  133 QLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKKLKKQGSGPVE  189 (245)
T ss_pred             HHHHHHHHHhhcchhcCcHHHHHHHHhCCchhHhhhhhhhhHHHHHHHHhcCCCccc
Confidence            8999999999999999999999999       9999999999999999996655543

>KOG0484|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PF03826 OAR: OAR domain; InterPro: IPR003654 This 14 amino acid motif has been identified within the C-terminal region of several Paired-like homeodomain (HD) containing proteins [, ] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query128
3a02_A60 Crystal Structure Of Aristaless Homeodomain Length 3e-12
3a01_B67 Crystal Structure Of Aristaless And Clawless Homeod 4e-12
3lnq_A58 Structure Of Aristaless Homeodomain In Complex With 1e-11
2m0c_A75 Solution Nmr Structure Of Homeobox Domain Of Human 4e-11
3cmy_A61 Structure Of A Homeodomain In Complex With Dna Leng 1e-10
1fjl_A81 Homeodomain From The Drosophila Paired Protein Boun 1e-09
2l7m_P68 Solution Structure Of The Pitx2 Homeodomain R24h Mu 2e-09
2cue_A80 Solution Structure Of The Homeobox Domain Of The Hu 6e-09
2l7f_P68 Solution Structure Of The Pitx2 Homeodomain Length 2e-08
2dms_A80 Solution Structure Of The Homeobox Domain Of Homeob 6e-08
2dmu_A70 Solution Structure Of The Homeobox Domain Of Homeob 1e-05
>pdb|3A02|A Chain A, Crystal Structure Of Aristaless Homeodomain Length = 60 Back     alignment and structure 
Iteration: 1

 Score = 66.6 bits (161), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 7/50 (14%)
Query: 2  QLAELEAAFAKSHYPDIYCREELAI-------LFQVWFQNRRAKYRKQEK 44
          QL ELE AF+++HYPD++ REELA+         QVWFQNRRAK+RKQEK
Sbjct: 10 QLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQEK 59
>pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 Back     alignment and structure
>pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 Back     alignment and structure
>pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 Back     alignment and structure
>pdb|3CMY|A Chain A, Structure Of A Homeodomain In Complex With Dna Length = 61 Back     alignment and structure
>pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 Back     alignment and structure
>pdb|2L7M|P Chain P, Solution Structure Of The Pitx2 Homeodomain R24h Mutant Length = 68 Back     alignment and structure
>pdb|2CUE|A Chain A, Solution Structure Of The Homeobox Domain Of The Human Paired Box Protein Pax-6 Length = 80 Back     alignment and structure
>pdb|2L7F|P Chain P, Solution Structure Of The Pitx2 Homeodomain Length = 68 Back     alignment and structure
>pdb|2DMS|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Otx2 Length = 80 Back     alignment and structure
>pdb|2DMU|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Goosecoid Length = 70 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query128
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 6e-24
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 1e-23
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 2e-23
3a02_A60 Homeobox protein aristaless; homeodomain, developm 3e-23
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 4e-23
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 5e-23
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 1e-22
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 8e-22
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 4e-21
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 9e-21
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 4e-19
1uhs_A72 HOP, homeodomain only protein; structural genomics 1e-18
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 3e-18
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 3e-17
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 5e-17
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 5e-14
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 5e-13
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 2e-12
2xsd_C164 POU domain, class 3, transcription factor 1; trans 2e-11
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 2e-11
3d1n_I151 POU domain, class 6, transcription factor 1; prote 1e-10
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 1e-10
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 7e-10
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 1e-09
1e3o_C160 Octamer-binding transcription factor 1; transcript 2e-09
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 3e-09
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 1e-08
1lfb_A99 Liver transcription factor (LFB1); transcription r 2e-08
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 3e-08
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 6e-08
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 6e-08
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 8e-08
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 1e-07
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 1e-07
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 1e-07
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 2e-07
3a01_A93 Homeodomain-containing protein; homeodomain, prote 2e-07
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 3e-07
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 3e-07
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 4e-07
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 8e-07
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 1e-06
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 6e-06
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 7e-06
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 3e-05
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 3e-05
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 1e-04
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 2e-04
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 2e-04
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 3e-04
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 4e-04
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 4e-04
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 5e-04
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 6e-04
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 6e-04
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 8e-04
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
 Score = 87.1 bits (216), Expect = 6e-24
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 7/60 (11%)

Query: 1  EQLAELEAAFAKSHYPDIYCREELAILF-------QVWFQNRRAKYRKQEKQLQKALTPS 53
          EQ+  LE  F ++HYPD++ RE LA          QVWF NRRAK+R++EK   +     
Sbjct: 17 EQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRRQSG 76
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query128
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.74
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.74
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.73
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.72
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.71
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.71
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.71
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.7
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.7
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.7
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.7
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.7
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.69
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.69
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.69
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.69
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.69
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.68
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.68
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.68
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.68
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.68
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.68
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.68
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.68
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.67
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.67
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.67
2e19_A64 Transcription factor 8; homeobox domain, structura 99.67
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.67
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.67
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.67
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.66
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.66
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.66
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.66
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.66
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.66
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.65
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.65
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.65
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.65
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.65
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.64
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.64
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.63
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.63
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.63
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.63
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.62
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.62
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.61
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.61
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.6
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.59
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.58
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.58
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.58
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.57
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.56
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.56
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.54
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.53
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.53
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.53
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.52
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.51
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.48
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.47
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.46
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.43
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.43
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.35
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 99.18
3d1n_I151 POU domain, class 6, transcription factor 1; prote 96.36
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 96.25
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 95.77
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 95.25
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 93.31
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
Probab=99.74  E-value=2.3e-18  Score=105.37  Aligned_cols=43  Identities=30%  Similarity=0.492  Sum_probs=40.8

Q ss_pred             ChHHHHHHHHHhcCCCCHHHHHHHHH-------HHHHhhhchHHHHHHHH
Q psy3396           1 EQLAELEAAFAKSHYPDIYCREELAI-------LFQVWFQNRRAKYRKQE   43 (128)
Q Consensus         1 ~Ql~~Le~~F~~~~y~~~~~r~~La~-------qVkiWFQNRRak~kr~~   43 (128)
                      +||.+||..|..++||+..+|++||.       +|+|||||||+|+|+..
T Consensus        14 ~Ql~~LE~~F~~~~YPs~~er~eLA~~tgLt~~qVkvWFqNRR~k~Kkg~   63 (66)
T 3nau_A           14 EQIAHLKASFLQSQFPDDAEVYRLIEVTGLARSEIKKWFSDHRYRCQRGI   63 (66)
T ss_dssp             HHHHHHHHHHHGGGSCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhcCCCCCHHHHHHHHHHhCcCHHHhhHhcccchhhhhccC
Confidence            59999999999999999999999999       99999999999999754
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 128
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 5e-14
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 7e-14
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 4e-13
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 2e-12
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 6e-12
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 8e-12
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 8e-12
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 2e-11
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 3e-11
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 9e-11
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 1e-10
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 1e-10
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 2e-10
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 2e-10
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 3e-10
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 7e-10
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 1e-09
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 1e-09
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 2e-09
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 3e-09
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 6e-09
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 1e-08
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 3e-08
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 3e-08
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 5e-08
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 1e-07
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 3e-07
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 4e-07
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 8e-07
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 2e-06
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 3e-06
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 5e-06
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Paired box protein pax6
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 60.2 bits (146), Expect = 5e-14
 Identities = 25/55 (45%), Positives = 34/55 (61%), Gaps = 7/55 (12%)

Query: 1  EQLAELEAAFAKSHYPDIYCREELAILF-------QVWFQNRRAKYRKQEKQLQK 48
          EQ+  LE  F ++HYPD++ RE LA          QVWF NRRAK+R++EK   +
Sbjct: 11 EQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQ 65
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query128
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.78
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.76
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.75
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.75
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.75
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.75
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.74
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.72
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.72
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.72
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.71
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.7
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.7
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.69
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.67
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.66
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.66
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.66
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.64
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.64
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.63
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.62
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.61
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.6
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.59
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.56
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.54
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.53
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.45
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.43
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.42
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.25
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Antennapedia Homeodomain
species: Drosophila melanogaster [TaxId: 7227]

Probab=99.78  E-value=9.1e-20  Score=107.24  Aligned_cols=42  Identities=40%  Similarity=0.601  Sum_probs=40.2

Q ss_pred             ChHHHHHHHHHhcCCCCHHHHHHHHH-------HHHHhhhchHHHHHHH
Q psy3396           1 EQLAELEAAFAKSHYPDIYCREELAI-------LFQVWFQNRRAKYRKQ   42 (128)
Q Consensus         1 ~Ql~~Le~~F~~~~y~~~~~r~~La~-------qVkiWFQNRRak~kr~   42 (128)
                      +|+.+||..|+.++||+..+|++||.       +|+|||||||+|+||+
T Consensus         7 ~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~~V~iWFQNrRak~kk~   55 (56)
T d9anta_           7 YQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKE   55 (56)
T ss_dssp             HHHHHHHHHHTTCSSCCHHHHHHHHHHHTCCHHHHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHhCCCCCHHHHHHHHHHhCCChhHeeeccccchhhhhhc
Confidence            59999999999999999999999999       9999999999999984
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure