Psyllid ID: psy3476


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------142
MSPALYEEWKLLLRTYLDFKQKEKFSTLMKIRETQNSLPVAQYKQEIIDTVLKERVVIIAGDTGCGKSTQIPQYLVQAGFQRIACTQPRRIACISLSKRVAYETLSQYSNLVGYQIRFEKHRREKTKIVFITEGLLLRQDSGLITDIPGPDASLSSRERALRHGEIKLLQAIKRKKAEEAPKRRKMLKADNAYEIEEEEEEEEGERLESMDANEVEFRLKHDPKQVQVATDNFLSSYDILILDEVHERHLYGDFLLGVISPPLHCGGEIVAADYFLSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTVEVAADNFLSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTAEVKIILMSATINIELFHTYFNRIAKIIKVPGRLYPIQLEYHPIVELDRTKSEKLDPGPYIRILSIIDKKYPRTERGDVLIFMSGISEISSIVRAAQEYNEKSQGWIVLPLHSTLSLEEQDRVFHYAPEGLRKCIVSTNIAETSITIDGIRFVVDSGKVKEMSYDVTAKMSTLQEFWISKASAEQRKGRAGRTGPGVCYRLYSEEQYSLLAEYSTPEIRRVSIDSLLLSLVCMGLGDVRKFPFLEAPPAENIESSVRSLTQHGAIDSKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTVLSLAAVLSVQSPFTNRAFRDPDCETARKELESNHGDPLTVLNAYKEWLGVKKDRVRSKKWCKRRGIEEQRFYEVTKLRSQFKQVLGDSGLITDIPGPDASLSSRERALRHGEIKLLQAIKRKKAEEAPKRRKMLKADNAYEIEEEEEEEEGERLESRTGPGVCYRLYSEEQYSLLAEYSTPEIRRVSIDSLLLSLVCMGLGDVRKFPFLEAPPAENIESSVRSLTQHGAIDSKERVTTLGRFLSDLPVDIPLGKMLVFGSMFHQIDTMLLLDLALNFGAIDSKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTMLLLDLALNFGAIDSKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTMLLLDLALNFGAIDSKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTMLLLDLALNFVHHSEEEEEEEAGERLESMDANEVEFRLKHDPKQVQVAADNFLSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTAEVKIILMSATINIELFHTYFNRIAKDLLSGSTARSHKDVTILKVILASGLYPQVAIGDEFNTSETVKEALFHCKDKGFVSLHPFSVFTSQPDVLRISEDDIVDPPPGLKLPGRNVISSKHQLLVYMSLLETSKPFLVNCLRMPALQTLLLFSSAIHTNSDFTRLVFDSWIEVFVPLQEAKSTADVNQLEHSLTRDLVQFMSSATHLAYSIRRLLAADLKTMYRRTGAESGVPGSNPFVAEFPMVVEETLGGVRVTPYLVYDW
ccHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHcccccHHHHHHHHHHHHHccEEEEEcccccccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccccccEEEEEcccccccccEEEccccccccccccccccccccccccHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHcccccccHHHHHHHHHHcccccccccccEEEccccccccEEcccccccccHHHHHHHHHcccHHHHHHHHHccccccccccccccccccccEEEEEccccccccEEEEEccccccccccccHHHccccccccccEEEEEccccccHHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHcccccEEEEcccccccEEEEcccccccccccccccccHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHHHHHccccccEEEEccccccHHHHccccccccccccEEEEEEcccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccEEEEcccHHHHHHccccccccHHcccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHccccccHHHHHHHHccccccHHHHHHHHHHHcccccccccccccHHHHHHHcccccccccccHHHHHHHHHHHHHHHccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHHccccccHHHHccccccccHHHHcHHHHHHcccccccccccEEEcccHHHHHHHccccccHHHHccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHccccccHHHHHHHHccccccHHHHHHHHHHHcccccccccccccHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccEEEccccccccccccccHHHHHcccccccccHHHHHHHHHccccccccccccccccEEEEEEccccEEEEcccHHHHHHHHccccccccHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHccccHHHHHHHHHccccccccccccccccccHHHHHHHHHccccccccccccccccHHHHHHHHHHHccccccccccccccccHHHcccccccccccccccccccccccccccEEEcccccccccccccccccccHHHHHHHHccccccccccccEEEEccEEEEEEccccHHccccHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccEEEccccEEcc
ccHHHcHHHHHHHHHHccccccccccccccHHHHHccccHHHHHHHHHHHHHcccEEEEEEccccccccHHHHHHHHcccccEccccHHHHHHHHHHHHHHHHHccccccEEEEEEEEccccccccEEEEcccHHHHHHHHcccccHHHccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHcccccEEEcccccEEEEEEccccccHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHcccEEEEEEEEcccccccccccHEEEcccHHHHHHHHHHHccccHHHcEEEEEccHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHcccccEEEcccccccEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHcccccccccEEEEEEEEEEEEEEcEEEEEEEccccHEEEccccccccccEEEEcHHHHHHHHHHcccccccccccEEEEEcHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccEEccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHcccccHHHHHHHHHcccccccHHHHHHHHHHccccEEEccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHHHHHHcccccccEEEEEccEEEEEcccccccHHHHHHHccccccccccccEEEEEEHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccEEccccccccHHHHHHHHHHHHHHccccccccccHHcHHHcccccccHHHHHHEEcccccccHHHHHHHHHHcccccEEcccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHccHHHHHHHHHHHHHHHHHHHcccccccccEHHEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEcccccccccccccEEEEcccHHHHHHHccccHHHcEEEEEccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHccccEEEccccccccccccEEEEEcccccccccccccHHHHHccccHHHHHHHcccccEEEEcccHHHHHEEEEEccccccccccEEEEEccHHHHHHHHHHHHHHccccccccEEEcccccccHHcccccEEEEEEcHHHEEEEEccEEEEEcccccEEccccccccccEEEEccccHHHHHHHcccccccccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccccEEccc
MSPALYEEWKLLLRTYLDFKQKEKFSTLMKIRETqnslpvaqYKQEIIDTVLKERVVIIagdtgcgkstqiPQYLVQAGFqriactqprrIACISLSKRVAYETLSQYSNLVGYQIRFEKHRREKTKIVFITEGlllrqdsglitdipgpdaslsSRERALRHGEIKLLQAIKRKKAEEAPKRRKMLkadnayeieeeeeeeegerlesmdanevefrlkhdpkqvqvatdnflssydilildevherhlygdfllgvispplhcggeivaaDYFLSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTVEVAADNFLSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTAEVKIILMSATINIELFHTYFNRIAKIIkvpgrlypiqleyhpiveldrtksekldpgpyirILSIidkkyprtergdvLIFMSGISEISSIVRAAQEYneksqgwivlplhstlsleeqdrvfhyapeglrkcivstniaetsitidgIRFVVDSGKVKEMSYDVTAKMSTLQEFWISKASAEQrkgragrtgpgvcyrlYSEEQYSLLaeystpeirrVSIDSLLLSLVCMglgdvrkfpfleappaenieSSVRSLTQHGAIDSKERVTSLgrflsdlpvdiplgkmlvfGSMFHQIDTVLSLAAVLsvqspftnrafrdpdcETARKElesnhgdplTVLNAYKEWLGVKKDRVRSKKWCKRRGIEEQRFYEVTKLRSQFKQvlgdsglitdipgpdaslsSRERALRHGEIKLLQAIKRKKAEEAPKRRKMLkadnayeieeeeeeeegerlesrtgpgvcyrlySEEQYSLLaeystpeirrVSIDSLLLSLVCMglgdvrkfpfleappaenieSSVRSLTqhgaidskERVTTLGrflsdlpvdiplgkmlvfGSMFHQIDTMLLLDLALnfgaidskERVTSLGrflsdlpvdiplgkmlvfGSMFHQIDTMLLLDLALnfgaidskERVTSLGrflsdlpvdiplgkmlvfGSMFHQIDTMLLLDLALnfgaidskERVTSLGrflsdlpvdiplgkmlvfGSMFHQIDTMLLLDLALnfvhhseeeeeEEAGERLESMDANEvefrlkhdpkqVQVAADNFLSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTAEVKIILMSATINIELFHTYFNRIAKDLlsgstarshkdVTILKVILAsglypqvaigdefntsETVKEALFhckdkgfvslhpfsvftsqpdvlriseddivdpppglklpgrnvissKHQLLVYMSLLetskpflvnclrmpaLQTLLLFSSaihtnsdftRLVFDSWIEVFVPlqeakstadvNQLEHSLTRDLVQFMSSATHLAYSIRRLLAADLKTMYRrtgaesgvpgsnpfvaefPMVVEetlggvrvtpylvydw
MSPALYEEWKLLLRTYLDFKQKEKFSTLMKIretqnslpvaqyKQEIIDTVLKERVVIIAGdtgcgkstqIPQYLVQAGFQRIACTQPRRIACISLSKRVAYETLSQYSNLVGYQIRFEKHRREKTKIVFITeglllrqdsglitdiPGPDASLSSRERALRHGEIKLLQAikrkkaeeapkrrkmlkadnayeieeeeeeeegerlesMDANEVEFrlkhdpkqvqVATDNFLSSYDILILDEVHERHLYGDFLLGVISPPLHCGGEIVAADYFLSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTVEVAADNFLSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTAEVKIILMSATINIELFHTYFNRIAKIIKVPGRLYPIQLEYHPiveldrtksekldpgpyirilsiidkkyprTERGDVLIFMSGISEISSIVRAAQEYNEKSQGWIVLPLHSTLSLEEQDRVFHYAPEGLRKCIVstniaetsitidgirfvvDSGKVKEMSYDVTAKMSTLQEFWISKASaeqrkgragrtgpgvcYRLYSEEQYSLLAEYSTPEIRRVSIDSLLLSLVCMGLGDVRKFPFLEAPPAENIESSVRSLTQHGAIDSKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTVLSLAAVLSVQspftnrafrdPDCETARKelesnhgdpltvlnaykewlgvkkdrvrskkwckrrgieeqrfyevTKLRSQFKqvlgdsglitdipgpdasLSSRERALRHGEIKLLQAikrkkaeeapkrrkmlkadnayeieeeeeeeegerlesrtgpgVCYRLYSEEQYSLLAEYSTPEIRRVSIDSLLLSLVCMGLGDVRKFPFLEAPPAENIESSVRSLTQHGAIDSKERVTTLGRFLSDLPVDIPLGKMLVFGSMFHQIDTMLLLDLALNFGAIDSKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTMLLLDLALNFGAIDSKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTMLLLDLALNFGAIDSKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTMLLLDLALNFVHHSEEEEEEEAGERLESMDANEVEFRLKHDPKQVQVAADNFLSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTAEVKIILMSATINIELFHTYFNRIAKDLLSGSTARSHKDVTILKVILASGLYPQVAIGDEFNTSETVKEALFHCKDKGFVSLHPFSVFTSQPDVLRISEDDIVDPPPGLKLPGRNVISSKHQLLVYMSLLETSKPFLVNCLRMPALQTLLLFSSAIHTNSDFTRLVFDSWIEVFVPLQEAKSTADVNQLEHSLTRDLVQFMSSATHLAYSIRRLLAADLKTMYRRTGaesgvpgsnpfVAEFPMVVeetlggvrvtpylvydw
MSPALYEEWKLLLRTYLDFKQKEKFSTLMKIRETQNSLPVAQYKQEIIDTVLKERVVIIAGDTGCGKSTQIPQYLVQAGFQRIACTQPRRIACISLSKRVAYETLSQYSNLVGYQIRFEKHRREKTKIVFITEGLLLRQDSGLITDIPGPDASLSSRERALRHGEIKLLQAIkrkkaeeapkrrkMLKADNAYeieeeeeeeegerleSMDANEVEFRLKHDPKQVQVATDNFLSSYDILILDEVHERHLYGDFLLGVISPPLHCGGEIVAADYFLSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTVEVAADNFLSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTAEVKIILMSATINIELFHTYFNRIAKIIKVPGRLYPIQLEYHPIVELDRTKSEKLDPGPYIRILSIIDKKYPRTERGDVLIFMSGISEISSIVRAAQEYNEKSQGWIVLPLHSTLSLEEQDRVFHYAPEGLRKCIVSTNIAETSITIDGIRFVVDSGKVKEMSYDVTAKMSTLQEFWISKASAEQRKGRAGRTGPGVCYRLYSEEQYSLLAEYSTPEIRRVSIDSLLLSLVCMGLGDVRKFPFLEAPPAENIESSVRSLTQHGAIDSKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTVLSLAAVLSVQSPFTNRAFRDPDCETARKELESNHGDPLTVLNAYKEWLGVKKDRVRSKKWCKRRGIEEQRFYEVTKLRSQFKQVLGDSGLITDIPGPDASLSSRERALRHGEIKLLQAIkrkkaeeapkrrkMLKADNAYeieeeeeeeegerleSRTGPGVCYRLYSEEQYSLLAEYSTPEIRRVSIDSLLLSLVCMGLGDVRKFPFLEAPPAENIESSVRSLTQHGAIDSKERVTTLGRFLSDLPVDIPLGKMLVFGSMFHQIDTMLLLDLALNFGAIDSKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTMLLLDLALNFGAIDSKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTMLLLDLALNFGAIDSKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTMLLLDLALNFVHHSeeeeeeeAGERLESMDANEVEFRLKHDPKQVQVAADNFLSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTAEVKIILMSATINIELFHTYFNRIAKDLLSGSTARSHKDVTILKVILASGLYPQVAIGDEFNTSETVKEALFHCKDKGFVSLHPFSVFTSQPDVLRISEDDIVDPPPGLKLPGRNVISSKHQLLVYMSLLETSKPFLVNCLRMPALQTLLLFSSAIHTNSDFTRLVFDSWIEVFVPLQEAKSTADVNQLEHSLTRDLVQFMSSATHLAYSIRRLLAADLKTMYRRTGAESGVPGSNPFVAEFPMVVEETLGGVRVTPYLVYDW
****LYEEWKLLLRTYLDFKQKEKFSTLMKIRETQNSLPVAQYKQEIIDTVLKERVVIIAGDTGCGKSTQIPQYLVQAGFQRIACTQPRRIACISLSKRVAYETLSQYSNLVGYQIRFEKHRREKTKIVFITEGLLLRQDSGLITDI******************************************************************************VQVATDNFLSSYDILILDEVHERHLYGDFLLGVISPPLHCGGEIVAADYFLSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTVEVAADNFLSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTAEVKIILMSATINIELFHTYFNRIAKIIKVPGRLYPIQLEYHPIVELDRTKSEKLDPGPYIRILSIIDKKYPRTERGDVLIFMSGISEISSIVRAAQEYNEKSQGWIVLPLHSTLSLEEQDRVFHYAPEGLRKCIVSTNIAETSITIDGIRFVVDSGKVKEMSYDVTAKMSTLQEFWISK************TGPGVCYRLYSEEQYSLLAEYSTPEIRRVSIDSLLLSLVCMGLGDVRKFPFLEA***********************RVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTVLSLAAVLSVQSPFTNRAF*****************DPLTVLNAYKEWLGVKKDRVRSKKWCKRRGIEEQRFYEVTKLRSQFKQVLGDSGLITD*******************************************************************GVCYRLYSEEQYSLLAEYSTPEIRRVSIDSLLLSLVCMGLGDVRKFPFLEA*********************KERVTTLGRFLSDLPVDIPLGKMLVFGSMFHQIDTMLLLDLALNFGAIDSKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTMLLLDLALNFGAIDSKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTMLLLDLALNFGAIDSKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTMLLLDLALNFVH********************************VQVAADNFLSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTAEVKIILMSATINIELFHTYFNRIAKDLLSGSTARSHKDVTILKVILASGLYPQVAIGDEFNTSETVKEALFHCKDKGFVSLHPFSVFTSQPDVLRISEDDIVD***GLKLPGRNVISSKHQLLVYMSLLETSKPFLVNCLRMPALQTLLLFSSAIHTNSDFTRLVFDSWIEVFVPLQEAKSTADVNQLEHSLTRDLVQFMSSATHLAYSIRRLLAADLKTMYRRTGAESGVPGSNPFVAEFPMVVEETLGGVRVTPYLVYD*
******E*WKLL***********************NSLPVAQYKQEIIDTVLKERVVIIAGDTGCGKSTQIPQYLVQAGFQRIACTQPRRIACISLSKRVAYETLSQYSNLVGYQIRFEKHRREKTKIVFITEGLLLRQDS*********************HGEIKL******************************************DANEVEFRLKHDP***********SSYDILILDEVHERHLYGDFLLGVISPPLHCGGEIVAADYFLSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTVEVAADNFLSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTAEVKIILMSATINIELFHTYFNRIAKIIKVPGRLYPIQLEYHPIVEL***KSEKLDPGPYIRILSIIDKKYPRTERGDVLIFMSGISEISSIVRAAQEYNEKSQGWIVLPLHSTLSLEEQDRVFHYAPEGLRKCIVSTNIAETSITIDGIRFVVDSGKVKEMSYDVTAKMSTLQEFWISKASAEQRKGRAGRTGPGVCYRLYSEEQYSLLAEYSTPEIRRVSIDSLLLSLVCMGLGDVRKFPFLEAPPAENIESSVRSLTQHGAIDSKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTVLSLAAVLSVQSPFTNRA************LESNHGDPLTVLNAYKEWLG**********WCKRRGIEEQRFYEVTKLRSQFKQVLGDSGL**********LSSRERALRHGEIKL*********************************************GVCYRLYSEEQYSLLAEYSTPEIRRVSIDSLLLSLVCMGLGDVRKFPFLEAPPAENIESSVRSLTQHGAIDSKERVTTLGRFLSDLPVDIPLGKMLVFGSMFHQIDTMLLLDLALNFGAID********************LGKMLVFGSMFHQIDTMLLLDLALNFGAIDSKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTMLLLDLALN***********************IPLGKMLVFGSMFHQIDTMLLLDLA******S***EEEEAGERLESMDANEVEFRLKHDPKQVQVAADNFLSSYDVLVLDEIHERHLHGDFLLGVIK************LMSATINIELFHTYFNRIAKDLLSGSTARSHKDVTILKVILASGLYPQVAIGDEFNTSETVKEALFHCKDKGFVSLHPFSVFTSQPDVLRISED******************SKHQLLVYMSLLETSKPFLVNCLRMPALQTLLLFSSAIHTNSDFTRLVFDSWIEVFVPL*************HSLTRDLVQFMSSATHLAYSIRRLLAADLKTMYRRTG*************EFPMVVEETLGGVRVTPYLVYDW
MSPALYEEWKLLLRTYLDFKQKEKFSTLMKIRETQNSLPVAQYKQEIIDTVLKERVVIIAGDTGCGKSTQIPQYLVQAGFQRIACTQPRRIACISLSKRVAYETLSQYSNLVGYQIRFEKHRREKTKIVFITEGLLLRQDSGLITDIPGPDASLSSRERALRHGEIKLLQAIKR***********MLKADNAYE***************MDANEVEFRLKHDPKQVQVATDNFLSSYDILILDEVHERHLYGDFLLGVISPPLHCGGEIVAADYFLSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTVEVAADNFLSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTAEVKIILMSATINIELFHTYFNRIAKIIKVPGRLYPIQLEYHPIVELDRTKSEKLDPGPYIRILSIIDKKYPRTERGDVLIFMSGISEISSIVRAAQEYNEKSQGWIVLPLHSTLSLEEQDRVFHYAPEGLRKCIVSTNIAETSITIDGIRFVVDSGKVKEMSYDVTAKMSTLQEFWISKAS***********GPGVCYRLYSEEQYSLLAEYSTPEIRRVSIDSLLLSLVCMGLGDVRKFPFLEAPPAEN**********HGAIDSKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTVLSLAAVLSVQSPFTNRAFRDPDCETARKELESNHGDPLTVLNAYKEWLGVKKDRVRSKKWCKRRGIEEQRFYEVTKLRSQFKQVLGDSGLITDIPGPDASLSSRERALRHGEIKLLQAIKR***********MLKADNAYE*****************GPGVCYRLYSEEQYSLLAEYSTPEIRRVSIDSLLLSLVCMGLGDVRKFPFLEAPPAEN*********QHGAIDSKERVTTLGRFLSDLPVDIPLGKMLVFGSMFHQIDTMLLLDLALNFGAIDSKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTMLLLDLALNFGAIDSKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTMLLLDLALNFGAIDSKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTMLLLDLALNFVH***************SMDANEVEFRLKHDPKQVQVAADNFLSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTAEVKIILMSATINIELFHTYFNRIAKDLLSGSTARSHKDVTILKVILASGLYPQVAIGDEFNTSETVKEALFHCKDKGFVSLHPFSVFTSQPDVLRISEDDIVDPPPGLKLPGRNVISSKHQLLVYMSLLETSKPFLVNCLRMPALQTLLLFSSAIHTNSDFTRLVFDSWIEVFVPLQEAKSTADVNQLEHSLTRDLVQFMSSATHLAYSIRRLLAADLKTMYRRTGAESGVPGSNPFVAEFPMVVEETLGGVRVTPYLVYDW
*SPALYEEWKLLLRTYLD*KQKEKFSTLMKIRETQNSLPVAQYKQEIIDTVLKERVVIIAGDTGCGKSTQIPQYLVQAGFQRIACTQPRRIACISLSKRVAYETLSQYSNLVGYQIRFEKHRREKTKIVFITEGLLLRQDSGLITDIPGPDASLSSRERALRHGEIKLLQAIKRKKAEEAPKRRKMLKADNAYEIEEEEEEEEGERLESMDANEVEFRLKHDPKQVQVATDNFLSSYDILILDEVHERHLYGDFLLGVISPPLHCGGEIVAADYFLSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTVEVAADNFLSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTAEVKIILMSATINIELFHTYFNRIAKIIKVPGRLYPIQLEYHPIVELDRTKSEKLDPGPYIRILSIIDKKYPRTERGDVLIFMSGISEISSIVRAAQEYNEKSQGWIVLPLHSTLSLEEQDRVFHYAPEGLRKCIVSTNIAETSITIDGIRFVVDSGKVKEMSYDVTAKMSTLQEFWISKASAE*********GPGVCYRLYSEEQYSLLAEYSTPEIRRVSIDSLLLSLVCMGLGDVRKFPFLEAPPAENIESSVRSLTQHGAIDSKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTVLSLAAVLSVQSPFTNRAFRDPDCETARKELESNHGDPLTVLNAYKEWLGVKKDRVRSKKWCKRRGIEEQRFYEVTKLRSQFKQVLGDSGLITDIPGPDASLSSRERALRHGEIKLLQAIKRKKAEEAPKRRKMLKADNAYEIE***************GPGVCYRLYSEEQYSLLAEYSTPEIRRVSIDSLLLSLVCMGLGDVRKFPFLEAPPAENIESSVRSLTQHGAIDSKERVTTLGRFLSDLPVDIPLGKMLVFGSMFHQIDTMLLLDLALNFGAIDSKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTMLLLDLALNFGAIDSKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTMLLLDLALNFGAIDSKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTMLLLDLALNFVHHSEEEEEEEAGERLESMDANEVEFRLKHDPKQVQVAADNFLSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTAEVKIILMSATINIELFHTYFNRIAKDLLSGSTARSHKDVTILKVILASGLYPQVAIGDEFNTSETVKEALFHCKDKGFVSLHPFSVFTSQPDVLRISEDDIVDPPPGLKLPGRNVISSKHQLLVYMSLLETSKPFLVNCLRMPALQTLLLFSSAIHTNSDFTRLVFDSWIEVFVPLQEAKSTADVNQLEHSLTRDLVQFMS*********RRLLAADLKTMYRRTGAESGVPGSNPFVAEFPMVVEETLGGVRVTPYLVYDW
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSPALYEEWKLLLRTYLDFKQKEKFSTLMKIRETQNSLPVAQYKQEIIDTVLKERVVIIAGDTGCGKSTQIPQYLVQAGFQRIACTQPRRIACISLSKRVAYETLSQYSNLVGYQIRFEKHRREKTKIVFITEGLLLRQDSGLITDIPGPDASLSSRERALRHGEIKLLQAIKRKKAEEAPKRRKMLKADNAYEIEEEEEEEEGERLESMDANEVEFRLKHDPKQVQVATDNFLSSYDILILDEVHERHLYGDFLLGVISPPLHCGGEIVAADYFLSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTVEVAADNFLSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTAEVKIILMSATINIELFHTYFNRIAKIIKVPGRLYPIQLEYHPIVELDRTKSEKLDPGPYIRILSIIDKKYPRTERGDVLIFMSGISEISSIVRAAQEYNEKSQGWIVLPLHSTLSLEEQDRVFHYAPEGLRKCIVSTNIAETSITIDGIRFVVDSGKVKEMSYDVTAKMSTLQEFWISKASAEQRKGRAGRTGPGVCYRLYSEEQYSLLAEYSTPEIRRVSIDSLLLSLVCMGLGDVRKFPFLEAPPAENIESSVRSLTQHGAIDSKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTVLSLAAVLSVQSPFTNRAFRDPDCETARKELESNHGDPLTVLNAYKEWLGVKKDRVRSKKWCKRRGIEEQRFYEVTKLRSQFKQVLGDSGLITDIPGPDASLSSRERALRHGEIKLLQAIKRKKAEEAPKRRKMLKADNAYEIEEEEEEEEGERLESRTGPGVCYRLYSEEQYSLLAEYSTPEIRRVSIDSLLLSLVCMGLGDVRKFPFLEAPPAENIESSVRSLTQHGAIDSKERVTTLGRFLSDLPVDIPLGKMLVFGSMFHQIDTMLLLDLALNFGAIDSKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTMLLLDLALNFGAIDSKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTMLLLDLALNFGAIDSKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTMLLLDLALNFVHHSEEEEEEEAGERLESMDANEVEFRLKHDPKQVQVAADNFLSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTAEVKIILMSATINIELFHTYFNRIAKDLLSGSTARSHKDVTILKVILASGLYPQVAIGDEFNTSETVKEALFHCKDKGFVSLHPFSVFTSQPDVLRISEDDIVDPPPGLKLPGRNVISSKHQLLVYMSLLETSKPFLVNCLRMPALQTLLLFSSAIHTNSDFTRLVFDSWIEVFVPLQEAKSTADVNQLEHSLTRDLVQFMSSATHLAYSIRRLLAADLKTMYRRTGAESGVPGSNPFVAEFPMVVEETLGGVRVTPYLVYDW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1417 2.2.26 [Sep-21-2011]
Q141471143 Probable ATP-dependent RN yes N/A 0.343 0.426 0.543 1e-157
Q9DBV31145 Probable ATP-dependent RN yes N/A 0.381 0.472 0.509 1e-155
Q80VY9698 Putative ATP-dependent RN no N/A 0.288 0.585 0.343 1e-69
P433291300 ATP-dependent RNA helicas N/A N/A 0.297 0.324 0.361 4e-68
P344981131 Probable pre-mRNA-splicin no N/A 0.293 0.367 0.347 1e-67
P450181304 ATP-dependent RNA helicas yes N/A 0.326 0.354 0.340 1e-67
Q9H6R0707 Putative ATP-dependent RN no N/A 0.287 0.575 0.341 2e-67
A2A4P01244 ATP-dependent RNA helicas no N/A 0.289 0.329 0.363 6e-66
Q145621220 ATP-dependent RNA helicas no N/A 0.289 0.336 0.363 7e-66
Q54F051160 ATP-dependent RNA helicas yes N/A 0.290 0.354 0.354 7e-66
>sp|Q14147|DHX34_HUMAN Probable ATP-dependent RNA helicase DHX34 OS=Homo sapiens GN=DHX34 PE=1 SV=2 Back     alignment and function desciption
 Score =  556 bits (1434), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 271/499 (54%), Positives = 357/499 (71%), Gaps = 12/499 (2%)

Query: 317 LSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTAEVKIILMSATINIELFHTYFNRIAKI 376
           L  Y+VL++DE+HERHLH DFLLGV++ LL +  ++K+ILMSATINI LF +YF+  A +
Sbjct: 270 LPQYEVLIVDEVHERHLHNDFLLGVLQRLLPTRPDLKVILMSATINISLFSSYFSN-APV 328

Query: 377 IKVPGRLYPIQLEYHPI-VELDRTKSEKLDPGPYIRILSIIDKKYPRTERGDVLIFMSGI 435
           ++VPGRL+PI + Y P   E   +KSEKLDP P++R+L  ID KYP  ERGD+L+F+SG+
Sbjct: 329 VQVPGRLFPITVVYQPQEAEPTTSKSEKLDPRPFLRVLESIDHKYPPEERGDLLVFLSGM 388

Query: 436 SEISSIVRAAQEYNEKSQGWIVLPLHSTLSLEEQDRVFHYAPEGLRKCIVSTNIAETSIT 495
           +EIS+++ AAQ Y   +Q W+VLPLHS LS+ +QD+VF  AP G+RKCI+STNIAETS+T
Sbjct: 389 AEISAVLEAAQTYASHTQRWVVLPLHSALSVADQDKVFDVAPPGVRKCILSTNIAETSVT 448

Query: 496 IDGIRFVVDSGKVKEMSYDVTAKMSTLQEFWISKASAEQRKGRAGRTGPGVCYRLYSEEQ 555
           IDGIRFVVDSGKVKEMSYD  AK+  LQEFWIS+ASAEQRKGRAGRTGPGVC+RLY+E  
Sbjct: 449 IDGIRFVVDSGKVKEMSYDPQAKLQRLQEFWISQASAEQRKGRAGRTGPGVCFRLYAESD 508

Query: 556 YSLLAEYSTPEIRRVSIDSLLLSLVCMGLGDVRKFPFLEAPPAENIESSVRSLTQHGAID 615
           Y   A Y  PEIRRV++DSL+L +  M +GD R FPF+E PP  ++E+++  L   GA+D
Sbjct: 509 YDAFAPYPVPEIRRVALDSLVLQMKSMSVGDPRTFPFIEPPPPASLETAILYLRDQGALD 568

Query: 616 SKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTVLSLAAVLSVQSPFTNRAFRDPDC 675
           S E +T +G  L+ LPVD+ +GKML+ GSMF  ++ VL++AA LSVQSPFT  A   P+C
Sbjct: 569 SSEALTPIGSLLAQLPVDVVIGKMLILGSMFSLVEPVLTIAAALSVQSPFTRSAQSSPEC 628

Query: 676 ETARKELESNHGDPLTVLNAYKEWLGVKKDRVR-SKKWCKRRGIEEQRFYEVTKLRSQFK 734
             AR+ LES+ GDP T+ N +  W+ VK +R R S+KWC+RRGIEE R YE+  LR QFK
Sbjct: 629 AAARRPLESDQGDPFTLFNVFNAWVQVKSERSRNSRKWCRRRGIEEHRLYEMANLRRQFK 688

Query: 735 QVLGDSGLITDIPGPDASLSSRERALRHGEIKLLQAIKRKKAEEAPKRRKMLKADNAYEI 794
           ++L D GL+           S  R  +  E + L  +KR+  E A +RRK+L+       
Sbjct: 689 ELLEDHGLLAGAQAAQVG-DSYSRLQQRRERRALHQLKRQHEEGAGRRRKVLRL------ 741

Query: 795 EEEEEEEEGERLESRTGPG 813
             +EE++ G   E R GP 
Sbjct: 742 --QEEQDGGSSDEDRAGPA 758




Probable ATP-binding RNA helicase.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q9DBV3|DHX34_MOUSE Probable ATP-dependent RNA helicase DHX34 OS=Mus musculus GN=Dhx34 PE=2 SV=2 Back     alignment and function description
>sp|Q80VY9|DHX33_MOUSE Putative ATP-dependent RNA helicase DHX33 OS=Mus musculus GN=Dhx33 PE=1 SV=1 Back     alignment and function description
>sp|P43329|HRPA_ECOLI ATP-dependent RNA helicase HrpA OS=Escherichia coli (strain K12) GN=hrpA PE=3 SV=3 Back     alignment and function description
>sp|P34498|MOG1_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-1 OS=Caenorhabditis elegans GN=mog-1 PE=1 SV=2 Back     alignment and function description
>sp|P45018|HRPA_HAEIN ATP-dependent RNA helicase HrpA homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hrpA PE=3 SV=2 Back     alignment and function description
>sp|Q9H6R0|DHX33_HUMAN Putative ATP-dependent RNA helicase DHX33 OS=Homo sapiens GN=DHX33 PE=1 SV=2 Back     alignment and function description
>sp|A2A4P0|DHX8_MOUSE ATP-dependent RNA helicase DHX8 OS=Mus musculus GN=Dhx8 PE=2 SV=1 Back     alignment and function description
>sp|Q14562|DHX8_HUMAN ATP-dependent RNA helicase DHX8 OS=Homo sapiens GN=DHX8 PE=1 SV=1 Back     alignment and function description
>sp|Q54F05|DHX8_DICDI ATP-dependent RNA helicase dhx8 OS=Dictyostelium discoideum GN=dhx8 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1417
3838526391137 PREDICTED: probable ATP-dependent RNA he 0.350 0.437 0.604 0.0
3072105331163 Probable ATP-dependent RNA helicase DHX3 0.348 0.424 0.603 0.0
3287023281120 PREDICTED: probable ATP-dependent RNA he 0.347 0.439 0.618 0.0
3407147891141 PREDICTED: LOW QUALITY PROTEIN: probable 0.341 0.424 0.616 0.0
3504150391159 PREDICTED: probable ATP-dependent RNA he 0.341 0.417 0.614 0.0
3228020231220 hypothetical protein SINV_16346 [Solenop 0.348 0.404 0.595 0.0
3454881081252 PREDICTED: probable ATP-dependent RNA he 0.337 0.381 0.638 0.0
3800166941117 PREDICTED: LOW QUALITY PROTEIN: probable 0.341 0.433 0.620 0.0
3287937041138 PREDICTED: probable ATP-dependent RNA he 0.341 0.425 0.622 0.0
1571175931246 ATP-dependent RNA helicase [Aedes aegypt 0.345 0.392 0.577 1e-176
>gi|383852639|ref|XP_003701834.1| PREDICTED: probable ATP-dependent RNA helicase DHX34-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/508 (60%), Positives = 418/508 (82%), Gaps = 11/508 (2%)

Query: 310 EVAADNFLSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTAEVKIILMSATINIELFHTY 369
           +++ ++ L  YDV+VLDE+HERHLHGDFLLG++KC+++   ++K++LMSATINIELF  Y
Sbjct: 262 QLSGESNLLPYDVIVLDEVHERHLHGDFLLGIMKCIINQKHDLKLVLMSATINIELFSNY 321

Query: 370 FNR-IAKIIKVPGRLYPIQLEYHPI-VELDRTKSEKLDPGPYIRILSIIDKKYPRTERGD 427
           F +   KII+VPGRLYPIQL Y PI +E  R K+++ +P PYI+I+ +ID+KYP  E+GD
Sbjct: 322 FAKEDVKIIQVPGRLYPIQLTYRPITIEDFRYKNDRFNPSPYIQIMQMIDQKYPADEKGD 381

Query: 428 VLIFMSGISEISSIVRAAQEYNEKSQGWIVLPLHSTLSLEEQDRVFHYAPEGLRKCIVST 487
           +LIF+SG+SEI+++V AA+EY++K   W+VLPLHSTL++ EQD+VF YAPEG RKCIVST
Sbjct: 382 LLIFLSGMSEITAVVDAAKEYSQKKNNWVVLPLHSTLAISEQDKVFDYAPEGARKCIVST 441

Query: 488 NIAETSITIDGIRFVVDSGKVKEMSYDVTAKMSTLQEFWISKASAEQRKGRAGRTGPGVC 547
           NIAETSITIDGIRFV DSGKVKEMSYD + KM  L+EFWISKASAEQRKGRAGRTGPGVC
Sbjct: 442 NIAETSITIDGIRFVCDSGKVKEMSYDPSCKMQRLKEFWISKASAEQRKGRAGRTGPGVC 501

Query: 548 YRLYSEEQYSLLAEYSTPEIRRVSIDSLLLSLVCMGLGDVRKFPFLEAPPAENIESSVRS 607
           YRLYSEE+Y  L +YSTPE++RV +DSLLL ++ MGL D RKFPF+E PP+E+IE+S+ S
Sbjct: 502 YRLYSEEEYMALEKYSTPELQRVPLDSLLLQMIAMGLPDARKFPFIEPPPSESIENSILS 561

Query: 608 LTQHGAIDSKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTVLSLAAVLSVQSPFTN 667
           L +HGA+   E++T +G+ L+ LPVDI +GKML+ GS+FHQ++ VLSLAA LS+Q+PFTN
Sbjct: 562 LKEHGALTDNEKITCIGKTLARLPVDITIGKMLIMGSVFHQVEPVLSLAAALSIQTPFTN 621

Query: 668 RAFRDPDCETARKELESNHGDPLTVLNAYKEWLGVKKDRVR--------SKKWCKRRGIE 719
           RA+RD +CET+RK+LES+HGDP+T+LNA++EWL VK+   +        S+KWCKRRG+E
Sbjct: 622 RAYRDSECETSRKKLESDHGDPITLLNAFREWLEVKQQNSQESRGTGTSSRKWCKRRGLE 681

Query: 720 EQRFYEVTKLRSQFKQVLGDSGLITDIPGPDASLSSRERALRHGEIKLLQAIKRKKAEEA 779
           EQRFYE+ KLR+QFK++L D  L+ ++P P++S+SS ERA+RHGE+KLL+++KR   +  
Sbjct: 682 EQRFYEMIKLRAQFKELLQDCNLLKNLPEPNSSMSSAERAIRHGELKLLKSLKRTYKQSE 741

Query: 780 PKRRKMLKADNAYEIEEEEEEEEGERLE 807
           P++RK LK + +++I+ E+ + + + ++
Sbjct: 742 PRKRKQLKLE-SFDIQLEDNDNDDKEID 768




Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307210533|gb|EFN87023.1| Probable ATP-dependent RNA helicase DHX34 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|328702328|ref|XP_001950822.2| PREDICTED: probable ATP-dependent RNA helicase DHX34-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|340714789|ref|XP_003395906.1| PREDICTED: LOW QUALITY PROTEIN: probable ATP-dependent RNA helicase DHX34-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350415039|ref|XP_003490513.1| PREDICTED: probable ATP-dependent RNA helicase DHX34-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|322802023|gb|EFZ22560.1| hypothetical protein SINV_16346 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|345488108|ref|XP_001604407.2| PREDICTED: probable ATP-dependent RNA helicase DHX34-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|380016694|ref|XP_003692310.1| PREDICTED: LOW QUALITY PROTEIN: probable ATP-dependent RNA helicase DHX34-like [Apis florea] Back     alignment and taxonomy information
>gi|328793704|ref|XP_397034.4| PREDICTED: probable ATP-dependent RNA helicase DHX34-like [Apis mellifera] Back     alignment and taxonomy information
>gi|157117593|ref|XP_001658842.1| ATP-dependent RNA helicase [Aedes aegypti] gi|108875986|gb|EAT40211.1| AAEL008035-PA [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1417
UNIPROTKB|E2RTK21177 DHX34 "Uncharacterized protein 0.309 0.372 0.572 2e-238
MGI|MGI:19189731145 Dhx34 "DEAH (Asp-Glu-Ala-His) 0.318 0.393 0.560 1.5e-236
UNIPROTKB|Q141471143 DHX34 "Probable ATP-dependent 0.305 0.378 0.577 3.1e-236
UNIPROTKB|E2RTK41140 DHX34 "Uncharacterized protein 0.309 0.385 0.572 1.3e-235
ZFIN|ZDB-GENE-061207-301150 dhx34 "DEAH (Asp-Glu-Ala-His) 0.316 0.389 0.578 5.7e-235
UNIPROTKB|F1RLY91146 DHX34 "Uncharacterized protein 0.311 0.384 0.562 4.5e-233
FB|FBgn00525331139 CG32533 [Drosophila melanogast 0.333 0.414 0.544 9.7e-233
UNIPROTKB|E1BJ901146 DHX34 "Uncharacterized protein 0.311 0.384 0.567 1.1e-227
WB|WBGene000213651018 smgl-2 [Caenorhabditis elegans 0.323 0.449 0.457 7.8e-152
UNIPROTKB|J3KR71576 DHX34 "Probable ATP-dependent 0.145 0.357 0.626 8.2e-129
UNIPROTKB|E2RTK2 DHX34 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 1354 (481.7 bits), Expect = 2.0e-238, Sum P(6) = 2.0e-238
 Identities = 253/442 (57%), Positives = 330/442 (74%)

Query:   310 EVAADNFLSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTAEVKIILMSATINIELFHTY 369
             ++  +  L  Y VL++DE+HERHLH DFLLGV++ LL    ++K+ILMSATINI LF +Y
Sbjct:   267 QIQREPSLPQYQVLIVDEVHERHLHNDFLLGVLRRLLPKRPDLKVILMSATINISLFSSY 326

Query:   370 FNRIAKIIKVPGRLYPIQLEYHPI-VELDRTKSEKLDPGPYIRILSIIDKKYPRTERGDV 428
             F   A +++VPGRL+PI + Y P   E   +KSEKLDPGP++R+L  ID KYP  ERGD+
Sbjct:   327 FGT-APVVQVPGRLFPITVVYQPQEAEPVASKSEKLDPGPFLRVLEAIDNKYPPEERGDL 385

Query:   429 LIFMSGISEISSIVRAAQEYNEKSQGWIVLPLHSTLSLEEQDRVFHYAPEGLRKCIVSTN 488
             L+F+SG++EISS++ AAQ Y  ++Q W+VLPLHS LS+ +QD+VF  AP G+RKCI+STN
Sbjct:   386 LVFLSGMAEISSVLEAAQTYASRTQRWVVLPLHSALSVADQDKVFDVAPPGVRKCILSTN 445

Query:   489 IAETSITIDGIRFVVDSGKVKEMSYDVTAKMSTLQEFWISKASAEQRKGRAGRTGPGVCY 548
             IAETS+TIDGIRFVVDSGKVKEM YD  AK+  LQEFWIS+ASAEQRKGRAGRTGPGVC+
Sbjct:   446 IAETSVTIDGIRFVVDSGKVKEMGYDPQAKLHRLQEFWISQASAEQRKGRAGRTGPGVCF 505

Query:   549 RLYSEEQYSLLAEYSTPEIRRVSIDSLLLSLVCMGLGDVRKFPFLEAPPAENIESSVRSL 608
             RLY+E  Y   A Y  PEIRRV++D+L+L +  M +GD R FPF+E PP  ++E+++  L
Sbjct:   506 RLYAESDYDAFAPYPVPEIRRVALDALVLQMKSMSVGDPRTFPFIEPPPPASLETAILYL 565

Query:   609 TQHGAIDSKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTVLSLAAVLSVQSPFTNR 668
                GA+DS E +T +G  L+ LPVD+ +GKML+ GSMFH  + VL++AA LSVQSPFT  
Sbjct:   566 QDQGALDSSEALTPIGSLLAQLPVDVVIGKMLILGSMFHLAEPVLTIAAALSVQSPFTRS 625

Query:   669 AFRDPDCETARKELESNHGDPLTVLNAYKEWLGVKKDRVR-SKKWCKRRGIEEQRFYEVT 727
             A  +P+C  AR+ LES+ GDP T+ N +  W+ VK +R R S+KWC+ RGIEE R YE+ 
Sbjct:   626 AQSNPECAAARRPLESDQGDPFTLFNVFNAWVQVKSERSRNSRKWCRHRGIEEHRLYEMA 685

Query:   728 KLRSQFKQVLGDSGLITDIPGP 749
              LR QFK++L D GL+     P
Sbjct:   686 NLRRQFKELLEDHGLLARAQAP 707


GO:0005524 "ATP binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
MGI|MGI:1918973 Dhx34 "DEAH (Asp-Glu-Ala-His) box polypeptide 34" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q14147 DHX34 "Probable ATP-dependent RNA helicase DHX34" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RTK4 DHX34 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061207-30 dhx34 "DEAH (Asp-Glu-Ala-His) box polypeptide 34" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1RLY9 DHX34 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
FB|FBgn0052533 CG32533 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E1BJ90 DHX34 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
WB|WBGene00021365 smgl-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|J3KR71 DHX34 "Probable ATP-dependent RNA helicase DHX34" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9DBV3DHX34_MOUSE3, ., 6, ., 4, ., 1, 30.50980.38170.4724yesN/A
Q14147DHX34_HUMAN3, ., 6, ., 4, ., 1, 30.54300.34360.4260yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1417
COG1643845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 1e-114
TIGR019671283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 2e-79
PRK111311294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 4e-77
TIGR01970819 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H 1e-59
PRK11664812 PRK11664, PRK11664, ATP-dependent RNA helicase Hrp 3e-59
COG1643845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 6e-31
COG1643845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 1e-27
pfam0440891 pfam04408, HA2, Helicase associated domain (HA2) 4e-21
TIGR01967 1283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 1e-20
PRK11131 1294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 1e-19
PRK111311294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 3e-19
TIGR019671283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 4e-18
smart0084782 smart00847, HA2, Helicase associated domain (HA2) 9e-17
PRK11664812 PRK11664, PRK11664, ATP-dependent RNA helicase Hrp 3e-15
PHA02653675 PHA02653, PHA02653, RNA helicase NPH-II; Provision 4e-15
smart0049082 smart00490, HELICc, helicase superfamily c-termina 7e-15
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 6e-13
TIGR01970819 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H 2e-12
TIGR01967 1283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 6e-12
COG1643 845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 9e-12
PRK11131 1294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 1e-10
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 2e-10
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 7e-10
pfam0440891 pfam04408, HA2, Helicase associated domain (HA2) 3e-09
TIGR01970819 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H 4e-09
smart0084782 smart00847, HA2, Helicase associated domain (HA2) 6e-09
pfam0440891 pfam04408, HA2, Helicase associated domain (HA2) 7e-09
pfam0440891 pfam04408, HA2, Helicase associated domain (HA2) 9e-09
pfam0440891 pfam04408, HA2, Helicase associated domain (HA2) 9e-09
smart0084782 smart00847, HA2, Helicase associated domain (HA2) 4e-08
smart0084782 smart00847, HA2, Helicase associated domain (HA2) 4e-08
pfam07717109 pfam07717, OB_NTP_bind, Oligonucleotide/oligosacch 4e-08
smart0084782 smart00847, HA2, Helicase associated domain (HA2) 8e-08
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 1e-07
PRK11664812 PRK11664, PRK11664, ATP-dependent RNA helicase Hrp 5e-07
COG1643845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 7e-06
COG1643845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 5e-05
COG1643845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 8e-05
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 8e-04
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 8e-04
TIGR019671283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 0.001
PRK111311294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 0.001
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 0.002
TIGR01970 819 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H 0.003
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 0.004
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
 Score =  378 bits (974), Expect = e-114
 Identities = 158/437 (36%), Positives = 237/437 (54%), Gaps = 25/437 (5%)

Query: 310 EVAADNFLSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTAE-VKIILMSATINIELFHT 368
           E+  D  LS Y V+++DE HER L+ D LLG++K LL    + +K+I+MSAT++ E F  
Sbjct: 153 EIQNDPLLSGYSVVIIDEAHERSLNTDILLGLLKDLLARRRDDLKLIIMSATLDAERFSA 212

Query: 369 YFNRIAKIIKVPGRLYPIQLEYHPIVELDRTKSEKLDPGPYIRILSIIDKKYPRTERGDV 428
           YF   A +I++ GR YP+++ Y P  E D      L       I++ +D        G +
Sbjct: 213 YFGN-APVIEIEGRTYPVEIRYLPEAEAD----YILLDA----IVAAVDIHLR-EGSGSI 262

Query: 429 LIFMSGISEISSIVRAAQEYNEKSQGWIVLPLHSTLSLEEQDRVFHYAPEGLRKCIVSTN 488
           L+F+ G  EI       ++  E      +LPL+  LS EEQ RVF  AP G RK +++TN
Sbjct: 263 LVFLPGQREIERTAEWLEK-AELGDDLEILPLYGALSAEEQVRVFEPAPGGKRKVVLATN 321

Query: 489 IAETSITIDGIRFVVDSGKVKEMSYDVTAKMSTLQEFWISKASAEQRKGRAGRTGPGVCY 548
           IAETS+TI GIR+V+DSG  KE  YD    ++ L+   ISKASA+QR GRAGRTGPG+CY
Sbjct: 322 IAETSLTIPGIRYVIDSGLAKEKRYDPRTGLTRLETEPISKASADQRAGRAGRTGPGICY 381

Query: 549 RLYSEEQYSLLAEYSTPEIRRVSIDSLLLSLVCMGLG-DVRKFPFLEAPPAENIESSVRS 607
           RLYSEE +    E++ PEI R  +  L+L L  +G+G D+  FPFL+ PP   I++++  
Sbjct: 382 RLYSEEDFLAFPEFTLPEILRTDLSGLVLQLKSLGIGQDIAPFPFLDPPPEAAIQAALTL 441

Query: 608 LTQHGAIDSKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTVLSLAAVLSVQ---SP 664
           L + GA+D   ++T LG+ +S LP+D  L +ML+       +    ++A++LS Q   S 
Sbjct: 442 LQELGALDDSGKLTPLGKQMSLLPLDPRLARMLLTAPEGGCLGEAATIASMLSEQDRESD 501

Query: 665 FTN-RAFRDPDCET------ARKELESNHGDPLTVLNAYKEWLGVKKDRVRS--KKWCKR 715
           F+     R             R+      GD L +L A+ + +  K+ +        C+ 
Sbjct: 502 FSRDVKLRKQRTAQDLLKRLKRRNAADPRGDHLLLLEAFPDRIARKRAKGEYLRANGCRA 561

Query: 716 RGIEEQRFYEVTKLRSQ 732
                +       + + 
Sbjct: 562 MLFPTKALSRAPWIIAA 578


Length = 845

>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB Back     alignment and domain information
>gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|218070 pfam04408, HA2, Helicase associated domain (HA2) Back     alignment and domain information
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|214852 smart00847, HA2, Helicase associated domain (HA2) Add an annotation Back     alignment and domain information
>gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>gnl|CDD|177443 PHA02653, PHA02653, RNA helicase NPH-II; Provisional Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB Back     alignment and domain information
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|218070 pfam04408, HA2, Helicase associated domain (HA2) Back     alignment and domain information
>gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB Back     alignment and domain information
>gnl|CDD|214852 smart00847, HA2, Helicase associated domain (HA2) Add an annotation Back     alignment and domain information
>gnl|CDD|218070 pfam04408, HA2, Helicase associated domain (HA2) Back     alignment and domain information
>gnl|CDD|218070 pfam04408, HA2, Helicase associated domain (HA2) Back     alignment and domain information
>gnl|CDD|218070 pfam04408, HA2, Helicase associated domain (HA2) Back     alignment and domain information
>gnl|CDD|214852 smart00847, HA2, Helicase associated domain (HA2) Add an annotation Back     alignment and domain information
>gnl|CDD|214852 smart00847, HA2, Helicase associated domain (HA2) Add an annotation Back     alignment and domain information
>gnl|CDD|219532 pfam07717, OB_NTP_bind, Oligonucleotide/oligosaccharide-binding (OB)-fold Back     alignment and domain information
>gnl|CDD|214852 smart00847, HA2, Helicase associated domain (HA2) Add an annotation Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1417
KOG0922|consensus674 100.0
KOG0923|consensus902 100.0
KOG0924|consensus1042 100.0
KOG0920|consensus924 100.0
KOG0925|consensus699 100.0
COG1643845 HrpA HrpA-like helicases [DNA replication, recombi 100.0
PRK111311294 ATP-dependent RNA helicase HrpA; Provisional 100.0
KOG0926|consensus1172 100.0
TIGR019671283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 100.0
TIGR01970819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
PRK11664812 ATP-dependent RNA helicase HrpB; Provisional 100.0
KOG0921|consensus1282 100.0
PHA02653675 RNA helicase NPH-II; Provisional 100.0
KOG0922|consensus674 100.0
KOG0924|consensus1042 100.0
KOG0925|consensus699 100.0
KOG0923|consensus902 100.0
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 100.0
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 100.0
PRK01172674 ski2-like helicase; Provisional 100.0
PRK02362737 ski2-like helicase; Provisional 100.0
PRK00254720 ski2-like helicase; Provisional 100.0
COG1643845 HrpA HrpA-like helicases [DNA replication, recombi 100.0
KOG0330|consensus476 100.0
KOG0926|consensus1172 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
KOG0331|consensus519 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
PTZ00110545 helicase; Provisional 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 100.0
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 100.0
COG1204766 Superfamily II helicase [General function predicti 100.0
PTZ00424401 helicase 45; Provisional 99.98
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 99.98
KOG0345|consensus567 99.98
KOG0342|consensus543 99.97
COG1202830 Superfamily II helicase, archaea-specific [General 99.97
KOG0920|consensus924 99.97
KOG0333|consensus673 99.97
KOG0343|consensus758 99.97
KOG0340|consensus442 99.97
TIGR03817742 DECH_helic helicase/secretion neighborhood putativ 99.97
KOG0338|consensus691 99.97
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.97
KOG0328|consensus400 99.96
PLN031371195 ATP-dependent DNA helicase; Q4-like; Provisional 99.96
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 99.96
KOG0952|consensus1230 99.96
KOG0332|consensus477 99.96
PRK13767876 ATP-dependent helicase; Provisional 99.96
KOG0335|consensus482 99.96
KOG0336|consensus629 99.96
KOG0326|consensus459 99.95
KOG0348|consensus708 99.95
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.95
KOG0347|consensus731 99.95
KOG0339|consensus731 99.95
TIGR01970819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.95
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 99.95
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.94
COG1201814 Lhr Lhr-like helicases [General function predictio 99.94
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.94
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.94
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.94
TIGR02621844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.94
KOG0951|consensus1674 99.93
PRK106891147 transcription-repair coupling factor; Provisional 99.93
PRK11664812 ATP-dependent RNA helicase HrpB; Provisional 99.93
KOG0350|consensus620 99.93
KOG0341|consensus610 99.92
KOG0334|consensus997 99.92
KOG4284|consensus980 99.92
KOG0346|consensus569 99.91
KOG0921|consensus1282 99.91
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.91
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, 99.91
KOG0327|consensus397 99.91
PHA02558501 uvsW UvsW helicase; Provisional 99.9
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.9
KOG0354|consensus746 99.89
KOG0948|consensus1041 99.89
KOG0344|consensus593 99.89
PRK13766773 Hef nuclease; Provisional 99.88
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 99.88
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.88
COG1205851 Distinct helicase family with a unique C-terminal 99.87
COG45811041 Superfamily II RNA helicase [DNA replication, reco 99.87
KOG0947|consensus1248 99.87
PRK09200790 preprotein translocase subunit SecA; Reviewed 99.87
PRK094011176 reverse gyrase; Reviewed 99.87
PRK14701 1638 reverse gyrase; Provisional 99.86
KOG0337|consensus529 99.86
PRK09694878 helicase Cas3; Provisional 99.85
PRK05580679 primosome assembly protein PriA; Validated 99.85
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 99.84
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.84
KOG0950|consensus1008 99.83
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.82
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.82
KOG0352|consensus641 99.82
TIGR010541171 rgy reverse gyrase. Generally, these gyrases are e 99.81
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.81
KOG0351|consensus941 99.77
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.77
PRK12906796 secA preprotein translocase subunit SecA; Reviewed 99.74
PRK13104896 secA preprotein translocase subunit SecA; Reviewed 99.73
PRK114481123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.72
COG11971139 Mfd Transcription-repair coupling factor (superfam 99.71
PRK12904830 preprotein translocase subunit SecA; Reviewed 99.69
PRK13107908 preprotein translocase subunit SecA; Reviewed 99.66
PRK04914956 ATP-dependent helicase HepA; Validated 99.64
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.63
KOG0329|consensus387 99.6
PF04408102 HA2: Helicase associated domain (HA2); InterPro: I 99.57
KOG0353|consensus695 99.56
PHA02653675 RNA helicase NPH-II; Provisional 99.54
PRK12899970 secA preprotein translocase subunit SecA; Reviewed 99.54
KOG0349|consensus725 99.51
PF04408102 HA2: Helicase associated domain (HA2); InterPro: I 99.51
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.5
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.47
smart0084792 HA2 Helicase associated domain (HA2) Add an annota 99.46
KOG0949|consensus1330 99.42
smart0084792 HA2 Helicase associated domain (HA2) Add an annota 99.39
COG4096875 HsdR Type I site-specific restriction-modification 99.38
PRK12326764 preprotein translocase subunit SecA; Reviewed 99.36
PRK129001025 secA preprotein translocase subunit SecA; Reviewed 99.33
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.32
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.32
KOG0953|consensus700 99.31
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.31
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.26
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.25
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.23
PRK13103913 secA preprotein translocase subunit SecA; Reviewed 99.21
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 99.2
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.2
PRK12903925 secA preprotein translocase subunit SecA; Reviewed 99.2
KOG4150|consensus1034 99.18
PRK05298652 excinuclease ABC subunit B; Provisional 99.15
COG11101187 Reverse gyrase [DNA replication, recombination, an 99.13
PLN031421033 Probable chromatin-remodeling complex ATPase chain 99.1
CHL00122870 secA preprotein translocase subunit SecA; Validate 99.09
smart00487201 DEXDc DEAD-like helicases superfamily. 99.08
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.07
PF07717114 OB_NTP_bind: Oligonucleotide/oligosaccharide-bindi 99.02
PRK12902939 secA preprotein translocase subunit SecA; Reviewed 99.0
smart0049082 HELICc helicase superfamily c-terminal domain. 98.98
KOG0951|consensus1674 98.91
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 98.9
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 98.74
PF04851184 ResIII: Type III restriction enzyme, res subunit; 98.71
KOG1123|consensus776 98.66
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 98.61
PRK14873665 primosome assembly protein PriA; Provisional 98.55
PF02399824 Herpes_ori_bp: Origin of replication binding prote 98.4
COG0653822 SecA Preprotein translocase subunit SecA (ATPase, 98.31
PRK129011112 secA preprotein translocase subunit SecA; Reviewed 98.24
KOG0385|consensus971 98.18
KOG0387|consensus923 98.15
KOG0384|consensus1373 97.85
COG48891518 Predicted helicase [General function prediction on 97.82
KOG0390|consensus776 97.76
KOG0392|consensus1549 97.73
PF1324576 AAA_19: Part of AAA domain 97.35
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 97.28
KOG1000|consensus689 97.24
PRK01172674 ski2-like helicase; Provisional 97.11
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 97.1
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 96.76
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 96.74
PRK10875615 recD exonuclease V subunit alpha; Provisional 96.57
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 96.55
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 96.4
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 96.39
KOG1803|consensus649 96.38
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.34
KOG0952|consensus1230 96.25
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 96.22
PRK06526254 transposase; Provisional 96.15
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.11
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 96.07
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 95.87
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 95.87
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 95.59
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 95.51
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 95.38
PRK10536262 hypothetical protein; Provisional 95.34
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 95.33
TIGR00376637 DNA helicase, putative. The gene product may repre 95.31
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 95.31
COG0610962 Type I site-specific restriction-modification syst 95.28
PRK14974336 cell division protein FtsY; Provisional 95.27
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 95.23
PRK08181269 transposase; Validated 95.17
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 95.15
KOG0391|consensus1958 94.64
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 94.55
PRK07003830 DNA polymerase III subunits gamma and tau; Validat 94.52
KOG1802|consensus935 94.46
smart00488289 DEXDc2 DEAD-like helicases superfamily. 94.37
smart00489289 DEXDc3 DEAD-like helicases superfamily. 94.37
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 94.34
PRK06835329 DNA replication protein DnaC; Validated 94.24
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 94.21
PRK14949944 DNA polymerase III subunits gamma and tau; Provisi 94.13
PRK13889988 conjugal transfer relaxase TraA; Provisional 94.06
PRK15483986 type III restriction-modification system StyLTI en 94.0
PRK02362737 ski2-like helicase; Provisional 93.82
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 93.72
KOG2340|consensus698 93.68
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 93.6
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 93.6
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 93.6
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 93.55
PRK07764824 DNA polymerase III subunits gamma and tau; Validat 93.54
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 93.37
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 93.27
PRK07952244 DNA replication protein DnaC; Validated 93.12
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 93.03
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 92.98
PRK06893229 DNA replication initiation factor; Validated 92.97
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 92.9
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 92.87
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 92.81
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 92.79
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 92.73
KOG0389|consensus941 92.71
PRK08903227 DnaA regulatory inactivator Hda; Validated 92.66
PRK08116268 hypothetical protein; Validated 92.54
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 92.47
PRK00149450 dnaA chromosomal replication initiation protein; R 92.47
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 92.33
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 92.32
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 92.27
PRK08727233 hypothetical protein; Validated 92.22
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 92.14
PRK05642234 DNA replication initiation factor; Validated 92.02
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 92.02
PRK138261102 Dtr system oriT relaxase; Provisional 91.99
PRK14088440 dnaA chromosomal replication initiation protein; P 91.83
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 91.78
PRK08939306 primosomal protein DnaI; Reviewed 91.78
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 91.7
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 91.62
PRK13833323 conjugal transfer protein TrbB; Provisional 91.61
PF1355562 AAA_29: P-loop containing region of AAA domain 91.61
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 91.59
PRK09112351 DNA polymerase III subunit delta'; Validated 91.37
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 91.24
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 91.22
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 91.2
PRK13894319 conjugal transfer ATPase TrbB; Provisional 91.15
TIGR00362405 DnaA chromosomal replication initiator protein Dna 91.11
smart00382148 AAA ATPases associated with a variety of cellular 91.1
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 91.09
PRK06921266 hypothetical protein; Provisional 91.06
PRK12377248 putative replication protein; Provisional 90.97
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 90.89
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 90.74
PRK07471365 DNA polymerase III subunit delta'; Validated 90.62
PRK13851344 type IV secretion system protein VirB11; Provision 90.61
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 90.59
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 90.53
PRK14087450 dnaA chromosomal replication initiation protein; P 90.34
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 90.19
PRK14729300 miaA tRNA delta(2)-isopentenylpyrophosphate transf 90.19
PRK14086617 dnaA chromosomal replication initiation protein; P 90.07
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 90.05
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 89.99
KOG0388|consensus1185 89.99
TIGR00596814 rad1 DNA repair protein (rad1). This family is bas 89.91
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 89.76
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 89.61
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 89.52
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 89.47
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 89.38
PHA03333752 putative ATPase subunit of terminase; Provisional 88.9
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 88.81
COG1484254 DnaC DNA replication protein [DNA replication, rec 88.54
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 88.5
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 88.45
KOG0989|consensus346 88.26
PRK12422445 chromosomal replication initiation protein; Provis 88.18
PRK11054684 helD DNA helicase IV; Provisional 88.16
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 88.14
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 88.1
COG1444758 Predicted P-loop ATPase fused to an acetyltransfer 88.02
PRK00254720 ski2-like helicase; Provisional 87.95
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 87.9
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 87.88
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 87.86
PRK05973237 replicative DNA helicase; Provisional 87.84
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 87.84
PRK07133725 DNA polymerase III subunits gamma and tau; Validat 87.77
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 87.75
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 87.61
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 87.55
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 87.54
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 87.49
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 87.48
PRK10919672 ATP-dependent DNA helicase Rep; Provisional 87.29
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 87.26
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 87.16
PRK10416318 signal recognition particle-docking protein FtsY; 87.0
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 86.84
PRK10436462 hypothetical protein; Provisional 86.76
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 86.68
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 86.67
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 86.65
TIGR00174287 miaA tRNA isopentenyltransferase (miaA). Catalyzes 86.61
TIGR00064272 ftsY signal recognition particle-docking protein F 86.61
PHA02544316 44 clamp loader, small subunit; Provisional 86.55
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 86.54
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 86.5
COG1126240 GlnQ ABC-type polar amino acid transport system, A 86.26
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transf 86.18
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 86.1
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 86.01
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 85.78
KOG1131|consensus755 85.74
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 85.5
PF13173128 AAA_14: AAA domain 85.47
COG1136226 SalX ABC-type antimicrobial peptide transport syst 85.43
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 85.25
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 85.14
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 84.99
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 84.97
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 84.69
PRK14873665 primosome assembly protein PriA; Provisional 84.64
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 84.49
PRK05707328 DNA polymerase III subunit delta'; Validated 84.06
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 83.99
PRK05580679 primosome assembly protein PriA; Validated 83.98
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 83.84
TIGR00595505 priA primosomal protein N'. All proteins in this f 83.79
PRK08233182 hypothetical protein; Provisional 83.79
KOG2228|consensus408 83.76
PF12846304 AAA_10: AAA-like domain 83.72
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 83.72
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 83.61
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 83.53
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 83.49
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 83.32
TIGR02533486 type_II_gspE general secretory pathway protein E. 83.29
PHA02244383 ATPase-like protein 83.28
COG11101187 Reverse gyrase [DNA replication, recombination, an 83.27
PRK04296190 thymidine kinase; Provisional 83.2
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 83.11
PRK00300205 gmk guanylate kinase; Provisional 82.95
COG5008375 PilU Tfp pilus assembly protein, ATPase PilU [Cell 82.82
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 82.81
COG0470325 HolB ATPase involved in DNA replication [DNA repli 82.66
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 82.6
PRK13764602 ATPase; Provisional 82.39
cd01124187 KaiC KaiC is a circadian clock protein primarily f 82.35
COG0593408 DnaA ATPase involved in DNA replication initiation 82.31
PLN02840421 tRNA dimethylallyltransferase 82.28
PRK10867433 signal recognition particle protein; Provisional 82.24
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 82.16
PRK11773721 uvrD DNA-dependent helicase II; Provisional 82.11
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 82.02
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 82.01
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 81.94
PF05729166 NACHT: NACHT domain 81.88
COG3973747 Superfamily I DNA and RNA helicases [General funct 81.78
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 81.74
PF00005137 ABC_tran: ABC transporter This structure is on hol 81.65
TIGR01074664 rep ATP-dependent DNA helicase Rep. Designed to id 81.63
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 81.58
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 81.48
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 81.43
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 81.23
KOG1970|consensus634 81.21
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 81.06
PRK14530215 adenylate kinase; Provisional 80.91
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 80.8
TIGR01075715 uvrD DNA helicase II. Designed to identify uvrD me 80.36
COG4525259 TauB ABC-type taurine transport system, ATPase com 80.36
PRK04301317 radA DNA repair and recombination protein RadA; Va 80.31
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 80.23
PLN02796347 D-glycerate 3-kinase 80.18
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 80.18
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 80.08
PF00004132 AAA: ATPase family associated with various cellula 80.07
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 80.05
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 80.02
COG1117253 PstB ABC-type phosphate transport system, ATPase c 80.01
>KOG0922|consensus Back     alignment and domain information
Probab=100.00  E-value=5.4e-115  Score=1031.20  Aligned_cols=565  Identities=42%  Similarity=0.679  Sum_probs=529.4

Q ss_pred             hhhhhhhchHHHHHHhcCCCcHHHHHHHHHHHhcCCeEEEEcCCCcchhHHHHHHHHHcCCC---cEEEecchHHHHHHH
Q psy3476          20 KQKEKFSTLMKIRETQNSLPVAQYKQEIIDTVLKERVVIIAGDTGCGKSTQIPQYLVQAGFQ---RIACTQPRRIACISL   96 (1417)
Q Consensus        20 ~~~~~~~~~~~~~~~r~~lp~~~~q~~il~~i~~~~~~iI~a~TGsGKTt~ipq~ile~~~~---~i~~tqPrr~aa~~~   96 (1417)
                      .+.........++++|+.|||++++++|++++.+++++||.|+||||||||+|||++|.|+.   +|.||||||+||+++
T Consensus        32 ~~~~~~~~~~~i~~qR~~LPI~~~r~~il~~ve~nqvlIviGeTGsGKSTQipQyL~eaG~~~~g~I~~TQPRRVAavsl  111 (674)
T KOG0922|consen   32 AQSYGKSTNLSIQEQRESLPIYKYRDQILYAVEDNQVLIVIGETGSGKSTQIPQYLAEAGFASSGKIACTQPRRVAAVSL  111 (674)
T ss_pred             ccccccccccCHHHhhccCCHHHHHHHHHHHHHHCCEEEEEcCCCCCccccHhHHHHhcccccCCcEEeecCchHHHHHH
Confidence            34444556788999999999999999999999999999999999999999999999999985   499999999999999


Q ss_pred             HHHHHHHHccccCCeEEEEEeecccccCCccEEEEccchhHHhhcCCCCCCCCCCCcchhhHHhhhhhhHHHHHHHHhhh
Q psy3476          97 SKRVAYETLSQYSNLVGYQIRFEKHRREKTKIVFITEGLLLRQDSGLITDIPGPDASLSSRERALRHGEIKLLQAIKRKK  176 (1417)
Q Consensus        97 a~rva~e~~~~~g~~vGy~ir~e~~~~~~t~I~~~T~g~llr~l~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  176 (1417)
                      |+|||.|+++.+|+.|||.|||++.+++.|+|+|+|+|+|||++..|                                 
T Consensus       112 A~RVAeE~~~~lG~~VGY~IRFed~ts~~TrikymTDG~LLRE~l~D---------------------------------  158 (674)
T KOG0922|consen  112 AKRVAEEMGCQLGEEVGYTIRFEDSTSKDTRIKYMTDGMLLREILKD---------------------------------  158 (674)
T ss_pred             HHHHHHHhCCCcCceeeeEEEecccCCCceeEEEecchHHHHHHhcC---------------------------------
Confidence            99999999999999999999999999999999999999999988665                                 


Q ss_pred             hhhhhHHhhhhccccchhhhhHHHHhhhhhhhccchhhhhhhhcCCcccccccccccccccchhhhhhhhhcccccccee
Q psy3476         177 AEEAPKRRKMLKADNAYEIEEEEEEEEGERLESMDANEVEFRLKHDPKQVQVATDNFLSSYDILILDEVHERHLYGDFLL  256 (1417)
Q Consensus       177 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~de~h~r~~~~d~l~  256 (1417)
                                                                                                      
T Consensus       159 --------------------------------------------------------------------------------  158 (674)
T KOG0922|consen  159 --------------------------------------------------------------------------------  158 (674)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             eccCCCCcCCCccccccccccccchhhhhhhhhcccccccchhhhhhccccccccccccCCCCccEEEEecCcccccCcc
Q psy3476         257 GVISPPLHCGGEIVAADYFLSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTVEVAADNFLSSYDVLVLDEIHERHLHGD  336 (1417)
Q Consensus       257 ~~~s~~~~~~~~~~~~~~~l~~~~~~~~~~~~~r~~~~d~~lgt~~~L~~~~~~~~~d~~L~~~~~VIlDEaHER~l~~d  336 (1417)
                                                                                +.|++|++|||||||||++++|
T Consensus       159 ----------------------------------------------------------p~LskYsvIIlDEAHERsl~TD  180 (674)
T KOG0922|consen  159 ----------------------------------------------------------PLLSKYSVIILDEAHERSLHTD  180 (674)
T ss_pred             ----------------------------------------------------------CccccccEEEEechhhhhhHHH
Confidence                                                                      6789999999999999999999


Q ss_pred             hHHHHHHHHhccCCCCcEEEEccCCCHHHHHHHhccCceEEEeCCcccceeEEeccccccccccccCCCCChHHHHHHHH
Q psy3476         337 FLLGVIKCLLHSTAEVKIILMSATINIELFHTYFNRIAKIIKVPGRLYPIQLEYHPIVELDRTKSEKLDPGPYIRILSII  416 (1417)
Q Consensus       337 ~ll~llk~l~~~r~~~qvIlmSATln~~~~~~~f~~~~~vi~v~gr~~pv~v~~~~~~~~~~~~~~~~~~~~~~~il~~l  416 (1417)
                      ++++++|.+.+.|+++|+|+||||+|++.|++|| ++++++.++||.|||++.|.+.+..++..          ..+..+
T Consensus       181 iLlGlLKki~~~R~~LklIimSATlda~kfS~yF-~~a~i~~i~GR~fPVei~y~~~p~~dYv~----------a~~~tv  249 (674)
T KOG0922|consen  181 ILLGLLKKILKKRPDLKLIIMSATLDAEKFSEYF-NNAPILTIPGRTFPVEILYLKEPTADYVD----------AALITV  249 (674)
T ss_pred             HHHHHHHHHHhcCCCceEEEEeeeecHHHHHHHh-cCCceEeecCCCCceeEEeccCCchhhHH----------HHHHHH
Confidence            9999999999999999999999999999999999 68999999999999999999977766633          334444


Q ss_pred             HhhCCCCCCCcEEEEeCCHHHHHHHHHHHHhhhhccCC---cEEEEecCCCCHHHHHHHhccCCCCCceEEEecchhhcc
Q psy3476         417 DKKYPRTERGDVLIFMSGISEISSIVRAAQEYNEKSQG---WIVLPLHSTLSLEEQDRVFHYAPEGLRKCIVSTNIAETS  493 (1417)
Q Consensus       417 ~~~~~~~~~g~iLVFl~~~~eie~la~~L~~~~~~~~~---~~V~~LHs~Ls~~eR~~v~~~f~~G~rkVLVATnIae~G  493 (1417)
                      .+++...+.|+||||++|++||+.+++.|.+..+....   ..+.|+||.||.++|.+||+..+.|.||||+||||||+|
T Consensus       250 ~~Ih~~E~~GDILvFLtGqeEIe~~~~~l~e~~~~~~~~~~~~~lply~aL~~e~Q~rvF~p~p~g~RKvIlsTNIAETS  329 (674)
T KOG0922|consen  250 IQIHLTEPPGDILVFLTGQEEIEAACELLRERAKSLPEDCPELILPLYGALPSEEQSRVFDPAPPGKRKVILSTNIAETS  329 (674)
T ss_pred             HHHHccCCCCCEEEEeCCHHHHHHHHHHHHHHhhhccccCcceeeeecccCCHHHhhccccCCCCCcceEEEEcceeeee
Confidence            45555577899999999999999999999886543222   268999999999999999999999999999999999999


Q ss_pred             CCcCCeEEEEcCCcccceecccCCCccccceeecCHhhHHhhcCcCCCCCCCeEEEecCHHHHHHhhccCCCcccccChH
Q psy3476         494 ITIDGIRFVVDSGKVKEMSYDVTAKMSTLQEFWISKASAEQRKGRAGRTGPGVCYRLYSEEQYSLLAEYSTPEIRRVSID  573 (1417)
Q Consensus       494 IdIP~V~~VIdsG~~k~~~yD~~~~~~~l~~~~ISkasa~QR~GRAGR~g~G~cy~L~t~~~~~~l~~~~~pEI~r~~L~  573 (1417)
                      ||||+|.||||+|++|.+.|++..+++.+...|||++++.||+|||||++||+|||||++++|+.|++.+.|||.|++|.
T Consensus       330 lTI~GI~YVVDsG~vK~~~y~p~~g~~~L~v~~ISkasA~QRaGRAGRt~pGkcyRLYte~~~~~~~~~~~PEI~R~~Ls  409 (674)
T KOG0922|consen  330 LTIDGIRYVVDSGFVKQKKYNPRTGLDSLIVVPISKASANQRAGRAGRTGPGKCYRLYTESAYDKMPLQTVPEIQRVNLS  409 (674)
T ss_pred             EEecceEEEEcCCceEEEeeccccCccceeEEechHHHHhhhcccCCCCCCceEEEeeeHHHHhhcccCCCCceeeechH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhhCCCCCcCCCCCCCCCcchhHHHHHHHHhcCCCCCCCCcCh-hhhhccCCCCChhhHHHHHhhhccCChhhH
Q psy3476         574 SLLLSLVCMGLGDVRKFPFLEAPPAENIESSVRSLTQHGAIDSKERVTS-LGRFLSDLPVDIPLGKMLVFGSMFHQIDTV  652 (1417)
Q Consensus       574 ~~lL~lk~lgi~~~~~f~~l~pP~~~~l~~Al~~L~~lGaId~~~~lT~-LG~~ls~lpldp~lak~Ll~~~~f~cle~v  652 (1417)
                      .++|+||++|++|+..|+|++||+.+++..|++.|+.+||||.++.+|. +|+.|+.+|++|.++|||+.+..++|.+++
T Consensus       410 ~~vL~Lkalgi~d~l~F~f~d~P~~~~l~~AL~~L~~lgald~~g~lt~p~G~~ma~~Pl~p~lsk~ll~s~~~gc~~e~  489 (674)
T KOG0922|consen  410 SAVLQLKALGINDPLRFPFIDPPPPEALEEALEELYSLGALDDRGKLTSPLGRQMAELPLEPHLSKMLLKSSELGCSEEI  489 (674)
T ss_pred             HHHHHHHhcCCCCcccCCCCCCCChHHHHHHHHHHHhcCcccCcCCcCchHHhhhhhcCCCcchhhhhhhccccCCcchh
Confidence            9999999999999999999999999999999999999999999999998 999999999999999999999999999999


Q ss_pred             HHHhhhccCCCccccCCCCChh-HHHHHhhcccCCCChHHHHHHHHHHHHhhhhhchHHHHHHHcCCCHHHHHHHHHHHH
Q psy3476         653 LSLAAVLSVQSPFTNRAFRDPD-CETARKELESNHGDPLTVLNAYKEWLGVKKDRVRSKKWCKRRGIEEQRFYEVTKLRS  731 (1417)
Q Consensus       653 l~IaA~Lsv~~~F~~~~~~~~~-~~~~r~~f~~~~sD~ltlln~f~~w~~~~~~~~~~~~WC~~~~L~~~~L~ei~~lr~  731 (1417)
                      ++|+|+||+++.|.+|..++.+ +...|.+|.+.+|||+|++|+|+.|.+.    +..++||.+|+|+++.|+.+.++|.
T Consensus       490 l~i~a~Lsv~~~f~~p~~~~~~~a~~~~~kf~~~eGDh~tlL~vy~~~~~~----~~~~~wC~en~i~~r~l~~a~~ir~  565 (674)
T KOG0922|consen  490 LTIAAMLSVQSVFSRPKDKKAEDADRKRAKFANPEGDHLTLLNVYESWKEN----GTSKKWCKENFINARSLKRAKDIRK  565 (674)
T ss_pred             hhheeeeeccceecCccchhhhhhhHHHHhhcCcccCHHHHHHHHHHHHhc----CChhhHHHHhcccHHHHHHHHHHHH
Confidence            9999999999999999887777 8889999999999999999999999863    4678999999999999999999999


Q ss_pred             HHHHHHHHCCCCcCCCCCCCChhHHHHHHhcCchHHHHHHH
Q psy3476         732 QFKQVLGDSGLITDIPGPDASLSSRERALRHGEIKLLQAIK  772 (1417)
Q Consensus       732 QL~~iL~~~gl~~~~~~~~~~~~s~~ral~~G~~~~L~~l~  772 (1417)
                      ||.+++.+.++...+++.+  .+.+.+|+.+|+|+|++.+.
T Consensus       566 QL~~i~~~~~~~~~s~~~d--~~~i~k~l~aGff~N~A~~~  604 (674)
T KOG0922|consen  566 QLRRILDKFGLPVSSCGGD--MEKIRKCLCAGFFRNVAERD  604 (674)
T ss_pred             HHHHHHHHcCCCccCCCCC--HHHHHHHHHHHHHHHHHHhh
Confidence            9999999999988766555  68999999999999999986



>KOG0923|consensus Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>PF04408 HA2: Helicase associated domain (HA2); InterPro: IPR007502 This presumed domain is about 90 amino acid residues in length Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>PF04408 HA2: Helicase associated domain (HA2); InterPro: IPR007502 This presumed domain is about 90 amino acid residues in length Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00847 HA2 Helicase associated domain (HA2) Add an annotation Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>smart00847 HA2 Helicase associated domain (HA2) Add an annotation Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PF07717 OB_NTP_bind: Oligonucleotide/oligosaccharide-binding (OB)-fold; InterPro: IPR011709 This domain is found towards the C terminus of the DEAD-box helicases (IPR011545 from INTERPRO) Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>KOG2340|consensus Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00174 miaA tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>KOG1131|consensus Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>KOG2228|consensus Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>KOG1970|consensus Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1417
3kx2_B767 Crystal Structure Of Prp43p In Complex With Adp Len 3e-65
3kx2_B767 Crystal Structure Of Prp43p In Complex With Adp Len 3e-12
3kx2_B 767 Crystal Structure Of Prp43p In Complex With Adp Len 2e-08
2xau_A773 Crystal Structure Of The Prp43p Deah-Box Rna Helica 3e-65
2xau_A773 Crystal Structure Of The Prp43p Deah-Box Rna Helica 3e-12
2xau_A 773 Crystal Structure Of The Prp43p Deah-Box Rna Helica 2e-08
3llm_A235 Crystal Structure Analysis Of A Rna Helicase Length 1e-17
3llm_A235 Crystal Structure Analysis Of A Rna Helicase Length 2e-05
3llm_A235 Crystal Structure Analysis Of A Rna Helicase Length 2e-05
3i4u_A270 Crystal Structure Analysis Of A Helicase Associated 2e-08
>pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 Back     alignment and structure

Iteration: 1

Score = 247 bits (631), Expect = 3e-65, Method: Compositional matrix adjust. Identities = 162/455 (35%), Positives = 240/455 (52%), Gaps = 26/455 (5%) Query: 310 EVAADNFLSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTAEVKIILMSATINIELFHTY 369 E D+ LS Y ++LDE HER L D L+G++K ++ ++KII+MSAT++ E F Y Sbjct: 199 EAMEDHDLSRYSCIILDEAHERTLATDILMGLLKQVVKRRPDLKIIIMSATLDAEKFQRY 258 Query: 370 FNRIAKIIKVPGRLYPIQLEYHPIVELDRTKSEKLDPGPYIRILSIIDKKYPRTERGDVL 429 FN A ++ VPGR YP++L Y P + D S IR + I + E GD+L Sbjct: 259 FND-APLLAVPGRTYPVELYYTPEFQRDYLDSA-------IRTVLQI---HATEEAGDIL 307 Query: 430 IFMSGISEISSIVR-----AAQEYNEKSQGWI-VLPLHSTLSLEEQDRVFHYAPEGL--- 480 +F++G EI VR Q E+ G + V PL+ +L +Q R+F APE Sbjct: 308 LFLTGEDEIEDAVRKISLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESHNGR 367 Query: 481 --RKCIVSTNIAETSITIDGIRFVVDSGKVKEMSYDVTAKMSTLQEFWISKASAEQRKGR 538 RK ++STNIAETS+TIDGI +VVD G K+ Y+ ++ +L ISKASA+QR GR Sbjct: 368 PGRKVVISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGR 427 Query: 539 AGRTGPGVCYRLYSEEQYSL-LAEYSTPEIRRVSIDSLLLSLVCMGLGDVRKFPFLEAPP 597 AGRT PG C+RLY+EE + L E S PEI R ++ S +L L +G+ D+ F F++ P Sbjct: 428 AGRTRPGKCFRLYTEEAFQKELIEQSYPEILRSNLSSTVLELKKLGIDDLVHFDFMDPPA 487 Query: 598 AENIESSVRSLTQHGAIDSKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTVLSLAA 657 E + ++ L +D + +T LGR S P+D L ML+ F +L++ A Sbjct: 488 PETMMRALEELNYLACLDDEGNLTPLGRLASQFPLDPMLAVMLIGSFEFQCSQEILTIVA 547 Query: 658 VLSVQSPFTNRAFRDPDCETARKELESNHGDPLTVLNAYKEWLGVKKDRVRSKKWCKRRG 717 +LSV + F + A+ GD +T+LN Y + + KWC+ Sbjct: 548 MLSVPNVFIRPTKDKKRADDAKNIFAHPDGDHITLLNVYHAFKSDEAYEYGIHKWCRDHY 607 Query: 718 IEEQRFYEVTKLRSQFKQVLGDSGL---ITDIPGP 749 + + +RSQ ++++ L TD P Sbjct: 608 LNYRSLSAADNIRSQLERLMNRYNLELNTTDYESP 642
>pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 Back     alignment and structure
>pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 Back     alignment and structure
>pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 Back     alignment and structure
>pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 Back     alignment and structure
>pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 Back     alignment and structure
>pdb|3LLM|A Chain A, Crystal Structure Analysis Of A Rna Helicase Length = 235 Back     alignment and structure
>pdb|3LLM|A Chain A, Crystal Structure Analysis Of A Rna Helicase Length = 235 Back     alignment and structure
>pdb|3LLM|A Chain A, Crystal Structure Analysis Of A Rna Helicase Length = 235 Back     alignment and structure
>pdb|3I4U|A Chain A, Crystal Structure Analysis Of A Helicase Associated Domain Length = 270 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1417
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 1e-129
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 1e-31
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 6e-28
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 3e-15
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 3e-05
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 2e-04
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 1e-49
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 2e-16
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 9e-06
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 2e-48
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 6e-14
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 2e-05
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 1e-47
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 3e-19
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 5e-19
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 3e-05
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 3e-47
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 5e-15
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 1e-05
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 5e-46
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 4e-15
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 7e-05
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 1e-43
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 4e-12
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 5e-04
1yks_A440 Genome polyprotein [contains: flavivirin protease 1e-42
1yks_A440 Genome polyprotein [contains: flavivirin protease 9e-14
1yks_A440 Genome polyprotein [contains: flavivirin protease 4e-05
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 1e-41
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 4e-17
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 5e-06
3i4u_A270 ATP-dependent RNA helicase DHX8; splicing, ATP-bin 2e-27
3i4u_A270 ATP-dependent RNA helicase DHX8; splicing, ATP-bin 5e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-15
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
 Score =  417 bits (1074), Expect = e-129
 Identities = 153/456 (33%), Positives = 237/456 (51%), Gaps = 25/456 (5%)

Query: 310 EVAADNFLSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTAEVKIILMSATINIELFHTY 369
           E   D+ LS Y  ++LDE HER L  D L+G++K ++    ++KII+MSAT++ E F  Y
Sbjct: 199 EAMEDHDLSRYSCIILDEAHERTLATDILMGLLKQVVKRRPDLKIIIMSATLDAEKFQRY 258

Query: 370 FNRIAKIIKVPGRLYPIQLEYHPIVELDRTKSEKLDPGPYIR-ILSIIDKKYPRTERGDV 428
           FN  A ++ VPGR YP++L Y P  + D           Y+   +  + + +   E GD+
Sbjct: 259 FND-APLLAVPGRTYPVELYYTPEFQRD-----------YLDSAIRTVLQIHATEEAGDI 306

Query: 429 LIFMSGISEISSIVRAAQEYNEKSQGW------IVLPLHSTLSLEEQDRVFHYAPEGL-- 480
           L+F++G  EI   VR      ++           V PL+ +L   +Q R+F  APE    
Sbjct: 307 LLFLTGEDEIEDAVRKISLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESHNG 366

Query: 481 ---RKCIVSTNIAETSITIDGIRFVVDSGKVKEMSYDVTAKMSTLQEFWISKASAEQRKG 537
              RK ++STNIAETS+TIDGI +VVD G  K+  Y+   ++ +L    ISKASA+QR G
Sbjct: 367 RPGRKVVISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAG 426

Query: 538 RAGRTGPGVCYRLYSEEQY-SLLAEYSTPEIRRVSIDSLLLSLVCMGLGDVRKFPFLEAP 596
           RAGRT PG C+RLY+EE +   L E S PEI R ++ S +L L  +G+ D+  F F++ P
Sbjct: 427 RAGRTRPGKCFRLYTEEAFQKELIEQSYPEILRSNLSSTVLELKKLGIDDLVHFDFMDPP 486

Query: 597 PAENIESSVRSLTQHGAIDSKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQIDTVLSLA 656
             E +  ++  L     +D +  +T LGR  S  P+D  L  ML+    F     +L++ 
Sbjct: 487 APETMMRALEELNYLACLDDEGNLTPLGRLASQFPLDPMLAVMLIGSFEFQCSQEILTIV 546

Query: 657 AVLSVQSPFTNRAFRDPDCETARKELESNHGDPLTVLNAYKEWLGVKKDRVRSKKWCKRR 716
           A+LSV + F          + A+       GD +T+LN Y  +   +       KWC+  
Sbjct: 547 AMLSVPNVFIRPTKDKKRADDAKNIFAHPDGDHITLLNVYHAFKSDEAYEYGIHKWCRDH 606

Query: 717 GIEEQRFYEVTKLRSQFKQVLGDSGLITDIPGPDAS 752
            +  +       +RSQ ++++    L  +    ++ 
Sbjct: 607 YLNYRSLSAADNIRSQLERLMNRYNLELNTTDYESP 642


>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Length = 235 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Length = 235 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Length = 235 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Length = 235 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} Length = 270 Back     alignment and structure
>3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} Length = 270 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1417
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 100.0
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 100.0
3i4u_A270 ATP-dependent RNA helicase DHX8; splicing, ATP-bin 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
4f92_B1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
3l9o_A1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 100.0
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
4a4z_A997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.98
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.98
2xgj_A1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.98
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 99.97
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.97
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.97
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 99.97
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.97
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.97
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.97
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.97
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.97
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.97
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 99.96
1yks_A440 Genome polyprotein [contains: flavivirin protease 99.96
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 99.96
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 99.96
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.96
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 99.96
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.96
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 99.96
3i4u_A270 ATP-dependent RNA helicase DHX8; splicing, ATP-bin 99.95
4gl2_A699 Interferon-induced helicase C domain-containing P; 99.95
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.95
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.95
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 99.94
4ddu_A1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.93
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 99.93
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.93
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.92
1tf5_A844 Preprotein translocase SECA subunit; ATPase, helic 99.91
1gku_B1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.91
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.9
2fsf_A853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.88
3h1t_A590 Type I site-specific restriction-modification syst 99.88
1nkt_A922 Preprotein translocase SECA 1 subunit; preprotein 99.88
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.85
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.82
3jux_A822 Protein translocase subunit SECA; protein transloc 99.81
3dmq_A968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.79
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.78
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.77
2w00_A1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.75
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.72
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.71
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.71
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.68
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.67
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.66
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.66
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.65
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.65
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.45
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.63
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.6
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.6
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.59
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.58
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.58
3bor_A237 Human initiation factor 4A-II; translation initiat 99.58
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.57
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.56
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.56
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.54
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.53
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.53
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.52
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.47
2ipc_A997 Preprotein translocase SECA subunit; nucleotide bi 99.47
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.35
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.21
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.19
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.17
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.14
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.12
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.02
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 98.85
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 98.81
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 97.85
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 97.8
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 97.69
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 97.3
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 96.79
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 96.54
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 96.53
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 96.16
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 95.58
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 95.15
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 95.13
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 94.81
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 94.73
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 94.42
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 94.33
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 93.67
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 92.73
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 91.71
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 91.6
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 91.57
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 91.17
3lfu_A647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 91.11
2zpa_A671 Uncharacterized protein YPFI; RNA modification enz 89.99
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 89.88
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 89.73
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 89.57
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 89.1
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 88.07
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 87.8
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 87.28
3co5_A143 Putative two-component system transcriptional RES 87.01
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 86.82
3u4q_A1232 ATP-dependent helicase/nuclease subunit A; helicas 86.78
1uaa_A673 REP helicase, protein (ATP-dependent DNA helicase 86.66
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 86.42
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 86.4
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 86.07
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 85.91
2oap_1511 GSPE-2, type II secretion system protein; hexameri 85.75
2eyu_A261 Twitching motility protein PILT; pilus retraction 85.67
1pjr_A724 PCRA; DNA repair, DNA replication, SOS response, h 85.61
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 85.48
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 85.1
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 84.99
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 84.87
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 84.85
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 84.64
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 84.57
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 84.43
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 84.12
2gno_A305 DNA polymerase III, gamma subunit-related protein; 84.03
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 83.75
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 83.72
3vaa_A199 Shikimate kinase, SK; structural genomics, center 83.45
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 83.41
4a4z_A997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 83.31
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 83.27
1p9r_A418 General secretion pathway protein E; bacterial typ 83.05
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 82.67
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 82.49
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 82.19
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 82.17
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 82.02
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 81.9
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 81.32
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 81.29
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 81.26
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 81.26
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 81.04
2ewv_A372 Twitching motility protein PILT; pilus retraction 80.88
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 80.78
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 80.78
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 80.62
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 80.43
2chg_A226 Replication factor C small subunit; DNA-binding pr 80.43
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 80.42
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 80.27
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
Probab=100.00  E-value=4.8e-81  Score=805.39  Aligned_cols=572  Identities=34%  Similarity=0.563  Sum_probs=507.0

Q ss_pred             hhhhhhhhchHHHHHHhcCCCcHHHHHHHHHHHhcCCeEEEEcCCCcchhHHHHHHHHHcCC-----CcEEEecchHHHH
Q psy3476          19 FKQKEKFSTLMKIRETQNSLPVAQYKQEIIDTVLKERVVIIAGDTGCGKSTQIPQYLVQAGF-----QRIACTQPRRIAC   93 (1417)
Q Consensus        19 ~~~~~~~~~~~~~~~~r~~lp~~~~q~~il~~i~~~~~~iI~a~TGsGKTt~ipq~ile~~~-----~~i~~tqPrr~aa   93 (1417)
                      |.....-.++.++.+.|..+|++.+|++|...+.++++++|+|||||||||++|+++++.+.     .+++|++|+|.+|
T Consensus        74 f~~~~l~~~~~~~l~~r~~lP~~~q~~~i~~~l~~~~~vii~gpTGSGKTtllp~ll~~~~~~~~~g~~ilvl~P~r~La  153 (773)
T 2xau_A           74 FTGREFTPKYVDILKIRRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQVACTQPRRVAA  153 (773)
T ss_dssp             TTCSBCCHHHHHHHHHHTTSGGGGGHHHHHHHHHHCSEEEEECCTTSSHHHHHHHHHHHHHCGGGGTCEEEEEESCHHHH
T ss_pred             ccccCCCHHHHHHHHHhhcCChHHHHHHHHHHHhCCCeEEEECCCCCCHHHHHHHHHHHhccccCCCceEEecCchHHHH
Confidence            44333334567788888899999999999999999999999999999999999999887543     3599999999999


Q ss_pred             HHHHHHHHHHHccccCCeEEEEEeecccccCCccEEEEccchhHHhhcCCCCCCCCCCCcchhhHHhhhhhhHHHHHHHH
Q psy3476          94 ISLSKRVAYETLSQYSNLVGYQIRFEKHRREKTKIVFITEGLLLRQDSGLITDIPGPDASLSSRERALRHGEIKLLQAIK  173 (1417)
Q Consensus        94 ~~~a~rva~e~~~~~g~~vGy~ir~e~~~~~~t~I~~~T~g~llr~l~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  173 (1417)
                      .+++++++.+++..+|..+||.++++......++|+++|+|++++.+..+                              
T Consensus       154 ~q~~~~l~~~~~~~v~~~vG~~i~~~~~~~~~~~I~v~T~G~l~r~l~~~------------------------------  203 (773)
T 2xau_A          154 MSVAQRVAEEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMED------------------------------  203 (773)
T ss_dssp             HHHHHHHHHHTTCCBTTTEEEEETTEEECCTTCSEEEEEHHHHHHHHHHS------------------------------
T ss_pred             HHHHHHHHHHhCCchhheecceeccccccCCCCCEEEECHHHHHHHHhhC------------------------------
Confidence            99999999999999999999999999888889999999999999865432                              


Q ss_pred             hhhhhhhhHHhhhhccccchhhhhHHHHhhhhhhhccchhhhhhhhcCCcccccccccccccccchhhhhhhhhcccccc
Q psy3476         174 RKKAEEAPKRRKMLKADNAYEIEEEEEEEEGERLESMDANEVEFRLKHDPKQVQVATDNFLSSYDILILDEVHERHLYGD  253 (1417)
Q Consensus       174 ~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~de~h~r~~~~d  253 (1417)
                                                                                                      
T Consensus       204 --------------------------------------------------------------------------------  203 (773)
T 2xau_A          204 --------------------------------------------------------------------------------  203 (773)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             ceeeccCCCCcCCCccccccccccccchhhhhhhhhcccccccchhhhhhccccccccccccCCCCccEEEEecCccccc
Q psy3476         254 FLLGVISPPLHCGGEIVAADYFLSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTVEVAADNFLSSYDVLVLDEIHERHL  333 (1417)
Q Consensus       254 ~l~~~~s~~~~~~~~~~~~~~~l~~~~~~~~~~~~~r~~~~d~~lgt~~~L~~~~~~~~~d~~L~~~~~VIlDEaHER~l  333 (1417)
                                                                                   ..+.++++|||||+|+|++
T Consensus       204 -------------------------------------------------------------~~l~~~~~lIlDEah~R~l  222 (773)
T 2xau_A          204 -------------------------------------------------------------HDLSRYSCIILDEAHERTL  222 (773)
T ss_dssp             -------------------------------------------------------------TTCTTEEEEEECSGGGCCH
T ss_pred             -------------------------------------------------------------ccccCCCEEEecCcccccc
Confidence                                                                         3467889999999999999


Q ss_pred             CcchHHHHHHHHhccCCCCcEEEEccCCCHHHHHHHhccCceEEEeCCcccceeEEeccccccccccccCCCCChHHHHH
Q psy3476         334 HGDFLLGVIKCLLHSTAEVKIILMSATINIELFHTYFNRIAKIIKVPGRLYPIQLEYHPIVELDRTKSEKLDPGPYIRIL  413 (1417)
Q Consensus       334 ~~d~ll~llk~l~~~r~~~qvIlmSATln~~~~~~~f~~~~~vi~v~gr~~pv~v~~~~~~~~~~~~~~~~~~~~~~~il  413 (1417)
                      +.+++..+++.+...+++.++|+||||++.+.+.+|| ++++++.++++.+|++++|.+....++          ....+
T Consensus       223 d~d~~~~~l~~l~~~~~~~~iIl~SAT~~~~~l~~~~-~~~~vi~v~gr~~pv~~~~~~~~~~~~----------~~~~l  291 (773)
T 2xau_A          223 ATDILMGLLKQVVKRRPDLKIIIMSATLDAEKFQRYF-NDAPLLAVPGRTYPVELYYTPEFQRDY----------LDSAI  291 (773)
T ss_dssp             HHHHHHHHHHHHHHHCTTCEEEEEESCSCCHHHHHHT-TSCCEEECCCCCCCEEEECCSSCCSCH----------HHHHH
T ss_pred             chHHHHHHHHHHHHhCCCceEEEEeccccHHHHHHHh-cCCCcccccCcccceEEEEecCCchhH----------HHHHH
Confidence            9999999999988888899999999999999999999 578899999999999998876543222          22233


Q ss_pred             HHHHhhCCCCCCCcEEEEeCCHHHHHHHHHHHHhhhh------ccCCcEEEEecCCCCHHHHHHHhccCC-----CCCce
Q psy3476         414 SIIDKKYPRTERGDVLIFMSGISEISSIVRAAQEYNE------KSQGWIVLPLHSTLSLEEQDRVFHYAP-----EGLRK  482 (1417)
Q Consensus       414 ~~l~~~~~~~~~g~iLVFl~~~~eie~la~~L~~~~~------~~~~~~V~~LHs~Ls~~eR~~v~~~f~-----~G~rk  482 (1417)
                      ..+.+.+....+|++||||+|+++++.+++.|.+...      ...++.+.++||+|++++|.++++.|+     +|.++
T Consensus       292 ~~l~~~~~~~~~g~iLVF~~~~~~i~~l~~~L~~~~~~l~~~~~~~~~~v~~lhg~l~~~eR~~v~~~f~~~~~~~g~~k  371 (773)
T 2xau_A          292 RTVLQIHATEEAGDILLFLTGEDEIEDAVRKISLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESHNGRPGRK  371 (773)
T ss_dssp             HHHHHHHHHSCSCEEEEECSCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECTTCCHHHHGGGGSCCCCCSSSSCCEE
T ss_pred             HHHHHHHHhcCCCCEEEECCCHHHHHHHHHHHHHHHHhhcccccCCCeEEEEeCCCCCHHHHHHHHhhcccccCCCCceE
Confidence            3333333224578999999999999999999975321      236789999999999999999999999     99999


Q ss_pred             EEEecchhhccCCcCCeEEEEcCCcccceecccCCCccccceeecCHhhHHhhcCcCCCCCCCeEEEecCHHHH-HHhhc
Q psy3476         483 CIVSTNIAETSITIDGIRFVVDSGKVKEMSYDVTAKMSTLQEFWISKASAEQRKGRAGRTGPGVCYRLYSEEQY-SLLAE  561 (1417)
Q Consensus       483 VLVATnIae~GIdIP~V~~VIdsG~~k~~~yD~~~~~~~l~~~~ISkasa~QR~GRAGR~g~G~cy~L~t~~~~-~~l~~  561 (1417)
                      ||||||++|+|||||+|++|||+|+.|.+.||+..++..+...|+|+++|.||+|||||.++|.||+||+++++ ..+.+
T Consensus       372 VlVAT~iae~GidIp~v~~VId~g~~k~~~yd~~~g~~~L~~~p~S~~s~~QR~GRaGR~~~G~~~~l~~~~~~~~~l~~  451 (773)
T 2xau_A          372 VVISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQKELIE  451 (773)
T ss_dssp             EEEECTHHHHTCCCTTEEEEEECSEEEEEEEETTTTEEEEEEEECCHHHHHHHHHGGGSSSSEEEEESSCHHHHHHTSCS
T ss_pred             EEEeCcHHHhCcCcCCeEEEEeCCCccceeeccccCccccccccCCHHHHHhhccccCCCCCCEEEEEecHHHhcccccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999 57999


Q ss_pred             cCCCcccccChHHHHHHHHhhCCCCCcCCCCCCCCCcchhHHHHHHHHhcCCCCCCCCcChhhhhccCCCCChhhHHHHH
Q psy3476         562 YSTPEIRRVSIDSLLLSLVCMGLGDVRKFPFLEAPPAENIESSVRSLTQHGAIDSKERVTSLGRFLSDLPVDIPLGKMLV  641 (1417)
Q Consensus       562 ~~~pEI~r~~L~~~lL~lk~lgi~~~~~f~~l~pP~~~~l~~Al~~L~~lGaId~~~~lT~LG~~ls~lpldp~lak~Ll  641 (1417)
                      +..|||.+.+|.+++|+++.+|+.++..|+|++||+.+.+..|++.|..+||||.++++|++|+.|+.||++|++||||+
T Consensus       452 ~~~pEi~r~~L~~~~L~l~~~gi~~~~~f~~~~~p~~~~i~~a~~~L~~lgald~~~~lT~lG~~~a~~pl~p~~~~~l~  531 (773)
T 2xau_A          452 QSYPEILRSNLSSTVLELKKLGIDDLVHFDFMDPPAPETMMRALEELNYLACLDDEGNLTPLGRLASQFPLDPMLAVMLI  531 (773)
T ss_dssp             SCCCGGGGSCCHHHHHHHHHTTCCCGGGCCCSSCCCHHHHHHHHHHHHHTTSBCTTSCBCHHHHHHTTSSSCHHHHHHHH
T ss_pred             cCCCccccCcHHHHHHHHHHcCCCChhhccccCCCcHHHHHHHHHHHHHcCCcccCCCcChhhhhhccccCCHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhccCChhhHHHHhhhccCCCccccCCCCChhHHHHHhhcccCCCChHHHHHHHHHHHHhhhhhchHHHHHHHcCCCHH
Q psy3476         642 FGSMFHQIDTVLSLAAVLSVQSPFTNRAFRDPDCETARKELESNHGDPLTVLNAYKEWLGVKKDRVRSKKWCKRRGIEEQ  721 (1417)
Q Consensus       642 ~~~~f~cle~vl~IaA~Lsv~~~F~~~~~~~~~~~~~r~~f~~~~sD~ltlln~f~~w~~~~~~~~~~~~WC~~~~L~~~  721 (1417)
                      .|+.++|++++++|+|+|+++++|..|...+++++.+|+.|....|||++++|+|++|.+....+...++||++|||+++
T Consensus       532 ~~~~~~c~~~~l~i~a~ls~~~~f~~~~~~~~~~~~~~~~f~~~~~D~~~~l~~~~~~~~~~~~~~~~~~~c~~~~l~~~  611 (773)
T 2xau_A          532 GSFEFQCSQEILTIVAMLSVPNVFIRPTKDKKRADDAKNIFAHPDGDHITLLNVYHAFKSDEAYEYGIHKWCRDHYLNYR  611 (773)
T ss_dssp             HGGGGTCHHHHHHHHHHHTSCCCBCCCTTCHHHHHHHHHTTCCTTBHHHHHHHHHHHHTSHHHHHHCHHHHHHHTTBCHH
T ss_pred             hhcccCchhHHHHHHHhcccCCcccCChHHHHHHHHHHHhccCCCCcHHHHHHHHHHHHHhccccchHHHHHHHhCCCHH
Confidence            99999999999999999999999999998888888999999999999999999999997653211122789999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCcCCCCC--CCChhHHHHHHhcCchHHHHHHH
Q psy3476         722 RFYEVTKLRSQFKQVLGDSGLITDIPGP--DASLSSRERALRHGEIKLLQAIK  772 (1417)
Q Consensus       722 ~L~ei~~lr~QL~~iL~~~gl~~~~~~~--~~~~~s~~ral~~G~~~~L~~l~  772 (1417)
                      +|+++.++|+||.++|.+.|+....++.  ..+.+.+.+++.+|++++++...
T Consensus       612 ~l~~~~~~~~ql~~~~~~~~~~~~~~~~~~~~~~~~i~~~l~~g~~~~~a~~~  664 (773)
T 2xau_A          612 SLSAADNIRSQLERLMNRYNLELNTTDYESPKYFDNIRKALASGFFMQVAKKR  664 (773)
T ss_dssp             HHHHHHHHHHHHHHHHHHTTCCCCCCCTTSTTHHHHHHHHHHHHHTTSEEEEC
T ss_pred             HHHHHHHHHHHHHHHHHhcCCCcCCCCCCchhhHHHHHHHHHHhChHhheeec
Confidence            9999999999999999999987654332  12346789999999998887554



>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1417
d1yksa2299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 4e-36
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 3e-25
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 6e-10
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 9e-09
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 3e-07
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 3e-07
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 2e-06
d1yksa1140 c.37.1.14 (A:185-324) YFV helicase domain {Yellow 7e-04
d1yksa1140 c.37.1.14 (A:185-324) YFV helicase domain {Yellow 9e-04
d1c4oa2174 c.37.1.19 (A:410-583) Nucleotide excision repair e 0.004
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: YFV helicase domain
species: Yellow fever virus [TaxId: 11089]
 Score =  137 bits (346), Expect = 4e-36
 Identities = 39/274 (14%), Positives = 82/274 (29%), Gaps = 27/274 (9%)

Query: 381 GRLYPIQLEYHPIVELDRTKSEKLDPGPYIRILSIIDKKYPRTERGDVLIFMSGISEISS 440
           G           I ++      +     +  I           ++     F+  I   + 
Sbjct: 1   GTSDEFPHSNGEIEDVQTDIPSEPWNTGHDWI---------LADKRPTAWFLPSIRAANV 51

Query: 441 IVRAAQEYNEKSQGWIVLPLHSTLSLEEQDRVFHYAPEGLRKCIVSTNIAETSITIDGIR 500
           +  + ++      G  V+ L+      E   +    P      I++T+IAE    +  + 
Sbjct: 52  MAASLRK-----AGKSVVVLNRKTFEREYPTIKQKKP----DFILATDIAEMGANLC-VE 101

Query: 501 FVVDSG-KVKEMSYDVTAKMSTLQEFWISKASAEQRKGRAGRTGPG----VCYRLYSEEQ 555
            V+D     K +  D   K++      IS +SA QR+GR GR          Y   + E 
Sbjct: 102 RVLDCRTAFKPVLVDEGRKVAIKGPLRISASSAAQRRGRIGRNPNRDGDSYYYSEPTSEN 161

Query: 556 YSLLAEYSTPEIRRVSIDSLLLSLVCMGLGDVRKFPFLEAPPAENIESSVRSLTQHGAID 615
            +    +    +   +++        +      +       P E      +       + 
Sbjct: 162 NAHHVCWLEASMLLDNMEVRGGM---VAPLYGVEGTKTPVSPGEMRLRDDQRKVFRELVR 218

Query: 616 SKERVTSLGRFLSDLPVDIPLGKMLVFGSMFHQI 649
           + +    L   ++   +     K    G   H+I
Sbjct: 219 NCDLPVWLSWQVAKAGLKTNDRKWCFEGPEEHEI 252


>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140 Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140 Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Length = 174 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1417
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.96
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.9
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.76
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.76
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.74
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.74
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.73
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.73
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.73
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.71
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.69
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.64
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.6
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.58
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.56
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.56
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.53
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.53
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.52
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.51
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.49
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.49
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.48
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.45
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.44
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.41
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.4
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.39
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.31
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.31
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.31
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.3
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.21
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.18
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.14
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 98.98
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 98.77
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 98.67
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 98.62
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 98.33
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.31
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 98.28
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 97.54
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 96.91
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 96.31
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 96.06
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 95.1
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 94.71
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 94.6
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 94.34
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 93.14
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus 92.74
d1okkd2207 GTPase domain of the signal recognition particle r 92.48
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 91.99
d1vmaa2213 GTPase domain of the signal recognition particle r 91.87
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 91.38
d1ls1a2207 GTPase domain of the signal sequence recognition p 91.27
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 91.24
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 91.16
d1j8yf2211 GTPase domain of the signal sequence recognition p 91.13
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 91.01
d2qy9a2211 GTPase domain of the signal recognition particle r 90.7
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 90.64
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 90.47
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 90.32
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 90.32
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 90.08
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 89.71
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 89.61
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 89.34
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 89.26
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 89.08
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 88.67
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 88.17
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 88.04
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 87.89
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 87.47
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 87.07
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 86.75
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 85.64
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 85.49
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 85.45
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 85.41
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 85.15
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 85.08
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 84.99
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 84.91
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 84.77
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 84.76
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 84.47
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 84.42
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 84.34
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 84.28
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 84.09
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 84.08
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 84.06
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 83.95
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 83.46
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 83.34
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 83.3
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 83.21
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 83.12
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 83.02
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 82.81
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 82.65
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 82.59
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 82.45
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 81.97
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 81.91
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 81.9
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 81.89
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 81.42
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 80.98
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 80.91
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 80.88
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 80.77
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 80.76
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 80.48
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 80.37
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: Dengue virus helicase
species: Dengue virus type 2 [TaxId: 11060]
Probab=99.96  E-value=4.8e-29  Score=284.01  Aligned_cols=199  Identities=21%  Similarity=0.208  Sum_probs=138.6

Q ss_pred             CCCCccEEEEecCcccccCcchHHHHHHHHhccCCCCcEEEEccCCCHHHHHHHhccCceEEEeCCcccceeEEeccccc
Q psy3476         316 FLSSYDVLVLDEIHERHLHGDFLLGVIKCLLHSTAEVKIILMSATINIELFHTYFNRIAKIIKVPGRLYPIQLEYHPIVE  395 (1417)
Q Consensus       316 ~L~~~~~VIlDEaHER~l~~d~ll~llk~l~~~r~~~qvIlmSATln~~~~~~~f~~~~~vi~v~gr~~pv~v~~~~~~~  395 (1417)
                      .+.++++||+||+|....++....++++.+. .+++.++++||||++...           .....+..|+.........
T Consensus        97 ~~~~~~~vViDE~H~~~~~~~~~~~~l~~~~-~~~~~~~v~~SAT~~~~~-----------~~~~~~~~~~~~~~~~~~~  164 (305)
T d2bmfa2          97 RVPNYNLIIMDEAHFTDPASIAARGYISTRV-EMGEAAGIFMTATPPGSR-----------DPFPQSNAPIMDEEREIPE  164 (305)
T ss_dssp             CCCCCSEEEEESTTCCSHHHHHHHHHHHHHH-HHTSCEEEEECSSCTTCC-----------CSSCCCSSCEEEEECCCCC
T ss_pred             cccceeEEEeeeeeecchhhHHHHHHHHHhh-ccccceEEEeecCCCcce-----------eeecccCCcceEEEEeccH
Confidence            4567899999999954444434444554443 346789999999985211           0111122222222111111


Q ss_pred             cccccccCCCCChHHHHHHHHHhhCCCCCCCcEEEEeCCHHHHHHHHHHHHhhhhccCCcEEEEecCCCCHHHHHHHhcc
Q psy3476         396 LDRTKSEKLDPGPYIRILSIIDKKYPRTERGDVLIFMSGISEISSIVRAAQEYNEKSQGWIVLPLHSTLSLEEQDRVFHY  475 (1417)
Q Consensus       396 ~~~~~~~~~~~~~~~~il~~l~~~~~~~~~g~iLVFl~~~~eie~la~~L~~~~~~~~~~~V~~LHs~Ls~~eR~~v~~~  475 (1417)
                      .  ...     ..    ...+.     ..++++||||+++++++.+++.|.+     .++.+..+||+++.+.+    ..
T Consensus       165 ~--~~~-----~~----~~~~~-----~~~~~~lvf~~~~~~~~~l~~~L~~-----~~~~~~~l~~~~~~~~~----~~  219 (305)
T d2bmfa2         165 R--SWN-----SG----HEWVT-----DFKGKTVWFVPSIKAGNDIAACLRK-----NGKKVIQLSRKTFDSEY----IK  219 (305)
T ss_dssp             S--CCS-----SC----CHHHH-----SSCSCEEEECSCHHHHHHHHHHHHH-----HTCCCEECCTTCHHHHG----GG
T ss_pred             H--HHH-----HH----HHHHH-----hhCCCEEEEeccHHHHHHHHHHHHh-----CCCCEEEeCCcChHHHH----hh
Confidence            0  000     00    11111     3468899999999999999999987     45678999999965543    46


Q ss_pred             CCCCCceEEEecchhhccCCcCCeEEEEcCCcccc--eecccCCCccccceeecCHhhHHhhcCcCCCCCCCe-EEEecC
Q psy3476         476 APEGLRKCIVSTNIAETSITIDGIRFVVDSGKVKE--MSYDVTAKMSTLQEFWISKASAEQRKGRAGRTGPGV-CYRLYS  552 (1417)
Q Consensus       476 f~~G~rkVLVATnIae~GIdIP~V~~VIdsG~~k~--~~yD~~~~~~~l~~~~ISkasa~QR~GRAGR~g~G~-cy~L~t  552 (1417)
                      +++|.++++|||+++++|+|+ +++.|||+|....  ..||.+.....+...++|.++|.||+|||||.|.|. ...+|.
T Consensus       220 ~~~~~~~~lvaT~~~~~G~~~-~~~~Vi~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~Qr~GR~GR~~~~~~~~~~~~  298 (305)
T d2bmfa2         220 TRTNDWDFVVTTDISEMGANF-KAERVIDPRRCMKPVILTDGEERVILAGPMPVTHSSAAQRRGRVGRNPKNENDQYIYM  298 (305)
T ss_dssp             GGTSCCSEEEECGGGGTTCCC-CCSEEEECCEEEEEEEECSSSCEEEEEEEEECCHHHHHHHHTTSSCSSSCCCEEEEEC
T ss_pred             hhccchhhhhhhHHHHhcCCC-CccEEEEcCCceeeeEecCCCCceEEeccccCCHHHHhhhhcCcCcCCCCceEEEEEC
Confidence            788999999999999999999 5788999887654  358888888889999999999999999999999544 444554



>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure