Psyllid ID: psy3487

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------54
MSALNTTDIKASHSDAEMKGWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAIIQTEDSCTFIISNGVQTFHIKASNEVERQRWVTALELAKSKARQHALVAAFSTSAYSTTAVRTGKPFNPLLGETYECDRTADAGWKAFSEQVSHHPPIAAQYVEGKAWKAWQDLAVHSKFRGKYIQVTPAGRFNLVFTKSNQHYTWNRVQSTVHNVIVGNLWVDQHGESDVINVTTGSTCRLTFYPYSYFSRQTQRRVLPWKPNTPRRSIIPEKPPGSMQIWSILKNSIGKDLSTIPMPLNFSEPLSMLQRLTEDFEYAHVLDEAAATDDVFRAPQYYCFTKFACQLNELEEGVAPTDSRLRPDQRLLEVSHHPPIAAQYVEGKAWKAWQDLAVHSKFRGKYIQVTPAGRFNLVFTKSSMAVLHEVLGMYHSGVFKDGQLVSNKSTNKQDLKTIRGDQITWIDGRETYCSNIGRLISEVDAIIMRANRMVNNGRMGDFVINGRTKMLKEVYGHARVGHEKLGRLSRYQKIV
ccccccccccccccccEEEEEEEEEEcccccEEEEEEEEEccEEcEEccccccccccccEEEcccEEEEccccEEEEEEcccHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccccccccccccccccEEEEEcccccEEEEEccccccccEEEEEEEcccEEEEEEEcEEEEEEEEEEEEEEcEEEEEEEEcccEEEEEEEccEEEEEEEEccEEEEccccEEEEEcccccEEEEEEEEccccccccccccccccccccccEEccccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccHHcccccccccccccccccccccccccccHHHcccEEcccEEEEEEcccEEcccccEEEEEEcEEEEEEEEcccccEEEEEEEEEEEEEEEcEEEEEcccccEEEEEEEEccEEEEEEcccccccEEEEEEEEEccEEEEccccccccccccEEEccEEEEEEEEEccccccEEEEEccccccccc
cccccccccccccccccccEEEEEcHHHccccccEEEEEcccEEEEEcccHHHHHHHHHcccccHcEEEcccccccEEEcccHHHHHHHcHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccccccccEEcccccccccEEEEEcccccccEEEEEEcccccEEEEEEEcccccccEEEEEEEcEEEEEEEcccccEEEEEcccEEEEEEEEEEEEEEcccEEEEEEcccccEEEEEEEEccccccccccEEEEEEEccccEEEEEcccccccEEEEEEccccccccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccHHHHEEHHHHHHccccccccccccccccccccccEEEcccccEEEEEEcccccEEEEEEEccccEccEEEEEEccEEEEEEEccccEEEEEEEEEEEEEEcccEEEEEEcccccEEEEEEEEEEEEEEEEcccccccEEEEEEccccHHEEEEcccHcccccccccEccccEEEccccccccccccccccccHHEEcc
msalnttdikashsdaeMKGWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAIIQTEDSCTFIISNGVQTFHIKASNEVERQRWVTALELAKSKARQHALVAAFstsaysttavrtgkpfnpllgetyecdrtADAGWKAFSEqvshhppiaaqyVEGKAWKAWQDLAVHSKFRGKYiqvtpagrfnlvftksnqhytWNRVQSTVHNVIVGNLwvdqhgesdvinvttgstcrltfypysyfsrqtqrrvlpwkpntprrsiipekppgsmQIWSILKNSigkdlstipmplnfsepLSMLQRLTEDFEYAHVldeaaatddvfrapqyycfTKFACQlneleegvaptdsrlrpdqrllevshhppiaaqyVEGKAWKAWQDLAVHSKFRGKYiqvtpagrfnlVFTKSSMAVLHEVLGMyhsgvfkdgqlvsnkstnkqdlktirgdqitwidgrETYCSNIGRLISEVDAIIMRANRMvnngrmgdfvINGRTKMLKEVYGharvgheklGRLSRYQKIV
msalnttdikashsdaemkGWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAIIQTEDSCTFIISNGVQTFHIKASNEVERQRWVTALELAKSKARQHALVAAfstsaysttavrtGKPFNPLLGETYECDRTADAGWKAFSEQVSHHPPIAAQYVEGKAWKAWQDLAVHSKFRGKYIQVTPAGRFNLVFTKSNQHYTWNRVQSTVHNVIVGNLWVDQHGESDVINVTTGSTCRLTFYPysyfsrqtqrrvlpwkpntprrsiipekppgsmQIWSILKNSIGKDLSTIPMPLNFSEPLSMLQRLTEDFEYAHVLDEAAATDDVFRAPQYYCFTKFACQLNELEEGVAPTDSRLRPDQRLLEVSHHPPIAAQYVEGKAWKAWQDLAVHSKFRGKYIQVTPAGRFNLVFTKSSMAVLHEVLGMYHSGvfkdgqlvsnkstnkqdlktirgdqitwidgrETYCSNIGRLISEVDAIIMRANRMVNNGRMGDFVINGRTKMLKEVYgharvgheklgrlsryqkiv
MSALNTTDIKASHSDAEMKGWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAIIQTEDSCTFIISNGVQTFHIKASNEVERQRWVTALELAKSKARQHALVaafstsaysttaVRTGKPFNPLLGETYECDRTADAGWKAFSEQVSHHPPIAAQYVEGKAWKAWQDLAVHSKFRGKYIQVTPAGRFNLVFTKSNQHYTWNRVQSTVHNVIVGNLWVDQHGESDVINVTTGSTCRLTFYPYSYFSRQTQRRVLPWKPNTPRRSIIPEKPPGSMQIWSILKNSIGKDLSTIPMPLNFSEPLSMLQRLTEDFEYAHVLDEAAATDDVFRAPQYYCFTKFACQLNELEEGVAPTDSRLRPDQRLLEVSHHPPIAAQYVEGKAWKAWQDLAVHSKFRGKYIQVTPAGRFNLVFTKSSMAVLHEVLGMYHSGVFKDGQLVSNKSTNKQDLKTIRGDQITWIDGRETYCSNIGRLISEVDAIIMRANRMVNNGRMGDFVINGRTKMLKEVYGHARVGHEKLGRLSRYQKIV
*****************MKGWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAIIQTEDSCTFIISNGVQTFHIKASNEVERQRWVTALELAKSKARQHALVAAFSTSAYSTTAVRTGKPFNPLLGETYECDRTADAGWKAFSEQVSHHPPIAAQYVEGKAWKAWQDLAVHSKFRGKYIQVTPAGRFNLVFTKSNQHYTWNRVQSTVHNVIVGNLWVDQHGESDVINVTTGSTCRLTFYPYSYFSRQTQRRVLPW*****************MQIWSILKNSIGKDLSTIPMPLNFSEPLSMLQRLTEDFEYAHVLDEAAATDDVFRAPQYYCFTKFACQLNELEEG*************LLEVSHHPPIAAQYVEGKAWKAWQDLAVHSKFRGKYIQVTPAGRFNLVFTKSSMAVLHEVLGMYHSGVFKDGQLVS*******DLKTIRGDQITWIDGRETYCSNIGRLISEVDAIIMRANRMVNNGRMGDFVINGRTKMLKEVYGHARVGHEK***********
*********************LFKWTNYLKGYQKRWFVLSNGLLSYYRN********RGTISLRGAIIQTEDSCTFIISNGVQTFHIKASNEVERQRWVTALELAKSKARQHALVAAFSTSAYSTTAVRTGKPFNPLLGETYECDRTADAGWKAFSEQVSHHPPIAAQYVEGKAWKAWQDLAVHSKFRGKYIQVTPAGRFNLVFTKSNQHYTWNRVQSTVHNVIVGNLWVDQHGESDVINVTTGSTCRLTFYPYSYFSRQTQR*******NTPRRSIIPEKPPGSMQIWSILKNSIGKDLSTIPMPLNFSEPLSMLQRLTEDFEYAHVLDEAAATDDVFRAPQYYCFTKFACQLNELEEGVAPTDSRLRPDQRLLEVSHHPPIAAQYVEGKAWKAWQDLAVHSKFRGKYIQVTPAGRFNLVFTKSSMAVLHEVLGMYHSGVFKDGQLVSNKSTNKQDLKTIRGDQITWIDGRETYCSNIGRLISEVDAIIMRANRMVNNGRMGDFVINGRTKMLKEVYGHARVGHEKLGRLSRYQKI*
MSALNTTDIKASHSDAEMKGWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAIIQTEDSCTFIISNGVQTFHIKASNEVERQRWVTALELAKSKARQHALVAAFSTSAYSTTAVRTGKPFNPLLGETYECDRTADAGWKAFSEQVSHHPPIAAQYVEGKAWKAWQDLAVHSKFRGKYIQVTPAGRFNLVFTKSNQHYTWNRVQSTVHNVIVGNLWVDQHGESDVINVTTGSTCRLTFYPYSYFSRQTQRRVLPWKPNTPRRSIIPEKPPGSMQIWSILKNSIGKDLSTIPMPLNFSEPLSMLQRLTEDFEYAHVLDEAAATDDVFRAPQYYCFTKFACQLNELEEGVAPTDSRLRPDQRLLEVSHHPPIAAQYVEGKAWKAWQDLAVHSKFRGKYIQVTPAGRFNLVFTKSSMAVLHEVLGMYHSGVFKDGQLVSNKSTNKQDLKTIRGDQITWIDGRETYCSNIGRLISEVDAIIMRANRMVNNGRMGDFVINGRTKMLKEVYGHARVGHEKLGRLSRYQKIV
***************AEMKGWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAIIQTEDSCTFIISNGVQTFHIKASNEVERQRWVTALELAKSKARQHALVAAFSTSAYSTTAVRTGKPFNPLLGETYECDRTADAGWKAFSEQVSHHPPIAAQYVEGKAWKAWQDLAVHSKFRGKYIQVTPAGRFNLVFTKSNQHYTWNRVQSTVHNVIVGNLWVDQHGESDVINVTTGSTCRLTFYPYSYFSRQTQRRVLPWKPNTPRRSIIPEKPPGSMQIWSILKNSIGKDLSTIPMPLNFSEPLSMLQRLTEDFEYAHVLDEAAATDDVFRAPQYYCFTKFACQLNELEEGVAPTDSRLRPDQRLLEVSHHPPIAAQYVEGKAWKAWQDLAVHSKFRGKYIQVTPAGRFNLVFTKSSMAVLHEVLGMYHSGVFKDGQLVSNKSTNKQDLKTIRGDQITWIDGRETYCSNIGRLISEVDAIIMRANRMVNNGRMGDFVINGRTKMLKEVYGHARVGHEKLGRLSRYQKIV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSALNTTDIKASHSDAEMKGWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAIIQTEDSCTFIISNGVQTFHIKASNEVERQRWVTALELAKSKARQHALVAAFSTSAYSTTAVRTGKPFNPLLGETYECDRTADAGWKAFSEQVSHHPPIAAQYVEGKAWKAWQDLAVHSKFRGKYIQVTPAGRFNLVFTKSNQHYTWNRVQSTVHNVIVGNLWVDQHGESDVINVTTGSTCRLTFYPYSYFSRQTQRRVLPWKPNTPRRSIIPEKPPGSMQIWSILKNSIGKDLSTIPMPLNFSEPLSMLQRLTEDFEYAHVLDEAAATDDVFRAPQYYCFTKFACQLNELEEGVAPTDSRLRPDQRLLEVSHHPPIAAQYVEGKAWKAWQDLAVHSKFRGKYIQVTPAGRFNLVFTKSSMAVLHEVLGMYHSGVFKDGQLVSNKSTNKQDLKTIRGDQITWIDGRETYCSNIGRLISEVDAIIMRANRMVNNGRMGDFVINGRTKMLKEVYGHARVGHEKLGRLSRYQKIV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query538 2.2.26 [Sep-21-2011]
Q5QNQ6908 Oxysterol-binding protein yes N/A 0.466 0.276 0.436 1e-54
Q969R2916 Oxysterol-binding protein yes N/A 0.295 0.173 0.537 2e-47
P16258809 Oxysterol-binding protein no N/A 0.470 0.312 0.434 3e-47
P22059807 Oxysterol-binding protein no N/A 0.470 0.313 0.419 1e-46
Q3B7Z2805 Oxysterol-binding protein no N/A 0.535 0.357 0.374 2e-46
Q9DBS9855 Oxysterol-binding protein no N/A 0.410 0.258 0.341 5e-36
Q9H4L5887 Oxysterol-binding protein no N/A 0.410 0.249 0.338 1e-34
Q9BZF2842 Oxysterol-binding protein no N/A 0.405 0.258 0.345 6e-34
Q8L751814 Oxysterol-binding protein yes N/A 0.431 0.285 0.361 2e-33
Q9BZF3934 Oxysterol-binding protein no N/A 0.269 0.155 0.445 9e-33
>sp|Q5QNQ6|OSBP2_MOUSE Oxysterol-binding protein 2 OS=Mus musculus GN=Osbp2 PE=2 SV=1 Back     alignment and function desciption
 Score =  214 bits (546), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 120/275 (43%), Positives = 158/275 (57%), Gaps = 24/275 (8%)

Query: 107 SKARQHALVAAFSTSAYSTTAVRTGKPFNPLLGETYECDRTADAGWKAFSEQVSHHPPIA 166
           S   Q  LVAAFS S+YSTT  R  KPFNP+LGET+E DR  D G ++  EQVSHHPP A
Sbjct: 569 SSVEQMCLVAAFSVSSYSTTVHRIAKPFNPMLGETFELDRMEDMGLRSLCEQVSHHPPSA 628

Query: 167 AQYVEGK-AWKAWQDLAVHSKFRGKYIQVTPAGRFNLVFTKSNQHYTWNRVQSTVHNVIV 225
           A +V  K  W  WQ++ + SKFRGKYI + P G  +L F  S  HY W +  STVHN+IV
Sbjct: 629 AHHVFSKHGWSLWQEITIASKFRGKYISIMPLGAIHLEFQASGNHYVWRKSTSTVHNIIV 688

Query: 226 GNLWVDQHGESDVINVTTGSTCRLTFYPYSYFSRQTQRRVLPWKPNTPRRS--IIPEKPP 283
           G LW+DQ G+ +++N  T   C+L F PYSYFS++  R+V     ++  ++  ++     
Sbjct: 689 GKLWIDQSGDIEIVNHKTKDRCQLKFVPYSYFSKEAARKVTGVVSDSQGKAHYVLSGSWD 748

Query: 284 GSMQIWSILKNSIGKD--LSTIPMPLNFSEPLSMLQRLTEDFEYAHVLDEAAATDDVFRA 341
             M+   I+ +S   D    T+   L    P  +L R        + L E         A
Sbjct: 749 DQMECSKIVHSSPSSDGRQKTVYQTL----PAKLLWR-------KYPLPE--------NA 789

Query: 342 PQYYCFTKFACQLNELEEGVAPTDSRLRPDQRLLE 376
              Y F++ A  LNE E+GVAPTDSRLRPDQRL+E
Sbjct: 790 ENMYYFSELALTLNEQEDGVAPTDSRLRPDQRLME 824
Binds 7-ketocholesterol.
Mus musculus (taxid: 10090)
>sp|Q969R2|OSBP2_HUMAN Oxysterol-binding protein 2 OS=Homo sapiens GN=OSBP2 PE=1 SV=2 Back     alignment and function description
>sp|P16258|OSBP1_RABIT Oxysterol-binding protein 1 OS=Oryctolagus cuniculus GN=OSBP PE=1 SV=1 Back     alignment and function description
>sp|P22059|OSBP1_HUMAN Oxysterol-binding protein 1 OS=Homo sapiens GN=OSBP PE=1 SV=1 Back     alignment and function description
>sp|Q3B7Z2|OSBP1_MOUSE Oxysterol-binding protein 1 OS=Mus musculus GN=Osbp PE=1 SV=3 Back     alignment and function description
>sp|Q9DBS9|OSBL3_MOUSE Oxysterol-binding protein-related protein 3 OS=Mus musculus GN=Osbpl3 PE=1 SV=2 Back     alignment and function description
>sp|Q9H4L5|OSBL3_HUMAN Oxysterol-binding protein-related protein 3 OS=Homo sapiens GN=OSBPL3 PE=1 SV=1 Back     alignment and function description
>sp|Q9BZF2|OSBL7_HUMAN Oxysterol-binding protein-related protein 7 OS=Homo sapiens GN=OSBPL7 PE=2 SV=1 Back     alignment and function description
>sp|Q8L751|ORP1C_ARATH Oxysterol-binding protein-related protein 1C OS=Arabidopsis thaliana GN=ORP1C PE=2 SV=1 Back     alignment and function description
>sp|Q9BZF3|OSBL6_HUMAN Oxysterol-binding protein-related protein 6 OS=Homo sapiens GN=OSBPL6 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query538
242010905 794 Oxysterol-binding protein, putative [Ped 0.457 0.309 0.522 3e-70
307180369 798 Oxysterol-binding protein 1 [Camponotus 0.457 0.308 0.511 5e-69
332023864583 Oxysterol-binding protein 2 [Acromyrmex 0.451 0.416 0.501 8e-68
307214029 808 Oxysterol-binding protein 1 [Harpegnatho 0.468 0.311 0.494 1e-67
345494533 804 PREDICTED: oxysterol-binding protein 1-l 0.460 0.308 0.492 3e-67
345494531 782 PREDICTED: oxysterol-binding protein 1-l 0.460 0.317 0.492 3e-67
321472736 730 hypothetical protein DAPPUDRAFT_315619 [ 0.447 0.330 0.489 5e-67
328778935 792 PREDICTED: oxysterol-binding protein 1 i 0.460 0.313 0.483 2e-65
328700813 793 PREDICTED: oxysterol-binding protein 1-l 0.472 0.320 0.488 3e-65
350407554 793 PREDICTED: oxysterol-binding protein 1-l 0.451 0.306 0.487 6e-65
>gi|242010905|ref|XP_002426198.1| Oxysterol-binding protein, putative [Pediculus humanus corporis] gi|212510249|gb|EEB13460.1| Oxysterol-binding protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  272 bits (696), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 139/266 (52%), Positives = 177/266 (66%), Gaps = 20/266 (7%)

Query: 111 QHALVAAFSTSAYSTTAVRTGKPFNPLLGETYECDRTADAGWKAFSEQVSHHPPIAAQYV 170
           Q A +AAF+ S+Y+ TA RTGKPFNPLLGETYECDRT D GWKA SEQVSHHPP+ AQY 
Sbjct: 433 QLAYIAAFTVSSYANTANRTGKPFNPLLGETYECDRTDDLGWKAISEQVSHHPPMLAQYC 492

Query: 171 EGKAWKAWQDLAVHSKFRGKYIQVTPAGRFNLVFTKSNQHYTWNRVQSTVHNVIVGNLWV 230
           EGK W+ WQ+  + SKFRGKY+QV P G  +L FT S  HYTW +V +TVHN IVG LWV
Sbjct: 493 EGKLWRCWQEFTMASKFRGKYLQVIPLGTAHLTFTNSKNHYTWKKVTTTVHNFIVGKLWV 552

Query: 231 DQHGESDVINVTTGSTCRLTFYPYSYFSRQTQRRVLPWKPNTPRRSIIPEKPPGSMQIWS 290
           DQHG++D+IN TTG  C L + PYSYFS+ TQR+V           ++ +K  G+M+ W 
Sbjct: 553 DQHGDADIINHTTGDKCHLKYLPYSYFSKDTQRKV--------NGCVMDKK--GNMK-W- 600

Query: 291 ILKNSIGKDLSTIPMPLNFSEPLSMLQRLTEDFEYAHVLDEAAATDDVFRAPQYYCFTKF 350
           ++       +   P+ ++ S   ++++       Y    +      D   + +YY FT+F
Sbjct: 601 VVNGEWDNKIEIAPV-ISASNNCAVVK----TGPYILAWERKMPPPD---SEKYYNFTEF 652

Query: 351 ACQLNELEEGVAPTDSRLRPDQRLLE 376
           ACQLNE E GVAPTDSRLRPDQRL+E
Sbjct: 653 ACQLNEPEPGVAPTDSRLRPDQRLME 678

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307180369|gb|EFN68395.1| Oxysterol-binding protein 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332023864|gb|EGI64088.1| Oxysterol-binding protein 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307214029|gb|EFN89236.1| Oxysterol-binding protein 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|345494533|ref|XP_003427315.1| PREDICTED: oxysterol-binding protein 1-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|345494531|ref|XP_001604970.2| PREDICTED: oxysterol-binding protein 1-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|321472736|gb|EFX83705.1| hypothetical protein DAPPUDRAFT_315619 [Daphnia pulex] Back     alignment and taxonomy information
>gi|328778935|ref|XP_392480.4| PREDICTED: oxysterol-binding protein 1 isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|328700813|ref|XP_001946447.2| PREDICTED: oxysterol-binding protein 1-like isoform 1 [Acyrthosiphon pisum] gi|328700815|ref|XP_003241391.1| PREDICTED: oxysterol-binding protein 1-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|350407554|ref|XP_003488123.1| PREDICTED: oxysterol-binding protein 1-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query538
FB|FBgn0020626784 Osbp "Oxysterol binding protei 0.494 0.339 0.429 1.6e-96
ZFIN|ZDB-GENE-090312-18760 osbp "oxysterol binding protei 0.297 0.210 0.496 4e-92
UNIPROTKB|F1NRB3756 OSBP2 "Oxysterol-binding prote 0.297 0.211 0.484 1.3e-90
UNIPROTKB|P22059807 OSBP "Oxysterol-binding protei 0.330 0.220 0.430 1.5e-88
MGI|MGI:97447805 Osbp "oxysterol binding protei 0.330 0.221 0.430 1.8e-88
UNIPROTKB|F1RMJ9809 OSBP "Oxysterol-binding protei 0.330 0.220 0.430 2e-88
ZFIN|ZDB-GENE-060526-3808 si:ch211-106a19.1 "si:ch211-10 0.509 0.339 0.385 3.6e-87
UNIPROTKB|F1PJ53920 OSBP2 "Oxysterol-binding prote 0.479 0.280 0.400 1.9e-85
UNIPROTKB|E1B7M8916 OSBP2 "Oxysterol-binding prote 0.516 0.303 0.386 2.1e-85
ZFIN|ZDB-GENE-091113-18748 osbp2 "oxysterol binding prote 0.295 0.212 0.487 5.4e-85
FB|FBgn0020626 Osbp "Oxysterol binding protein" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 566 (204.3 bits), Expect = 1.6e-96, Sum P(2) = 1.6e-96
 Identities = 124/289 (42%), Positives = 162/289 (56%)

Query:    93 VERQRWVTALELA---KSKARQHALVXXXXXXXXXXXXVRTGKPFNPLLGETYECDRTAD 149
             VE   +   L+ A   + +  Q A +             RTGKPFNPLLGETYECDR  D
Sbjct:   432 VEDYEYTEILDYAATCQDECEQLAYIAAGTVSAYATTTNRTGKPFNPLLGETYECDRMDD 491

Query:   150 AGWKAFSEQVSHHPPIAAQYVEGKAWKAWQDLAVHSKFRGKYIQVTPAGRFNLVFTKSNQ 209
              GW+  +EQVSHHPP+AA + E K W  WQ+ ++ SKFRGKY+Q+ P G   + F  S +
Sbjct:   492 YGWRCLAEQVSHHPPVAALHCESKNWTCWQEFSMTSKFRGKYVQINPLGGVYVQFPNSGR 551

Query:   210 HYTWNRVQSTVHNVIVGNLWVDQHGESDV--INVTTGSTCRLTFYPYSYFSRQTQRRVLP 267
              Y+W +V +TV+N+IVG LWVDQHGE ++       G  C L F PYSYFSR  QR V  
Sbjct:   552 RYSWRKVTTTVNNIIVGKLWVDQHGEMEIRGSQAAEGHKCILNFIPYSYFSRDVQRSV-- 609

Query:   268 WKPNTPRRSIIPEKPPGSMQIWSILKNSIGKDLSTIPMPLNFSEPLSMLQRLTEDFEYAH 327
                    + ++  K    ++ W +++ +    +   P+ L  S  +S     T +F+ A 
Sbjct:   610 -------KGVVMNKD-NEVK-W-VVRGTWDMKIEIAPV-LKTSGSVSSPTYTTGEFKLAW 658

Query:   328 VLDEAAATDDVFRAPQYYCFTKFACQLNELEEGVAPTDSRLRPDQRLLE 376
                 A    D F     Y FT  ACQLNE EEGVAPTDSRLRPDQRL+E
Sbjct:   659 RRRPAPPDSDKF-----YNFTTLACQLNEEEEGVAPTDSRLRPDQRLME 702
GO:0008142 "oxysterol binding" evidence=ISS;NAS
GO:0005543 "phospholipid binding" evidence=IEA
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0007291 "sperm individualization" evidence=IMP
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0006886 "intracellular protein transport" evidence=IMP
GO:0007030 "Golgi organization" evidence=IMP
ZFIN|ZDB-GENE-090312-18 osbp "oxysterol binding protein" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NRB3 OSBP2 "Oxysterol-binding protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P22059 OSBP "Oxysterol-binding protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:97447 Osbp "oxysterol binding protein" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1RMJ9 OSBP "Oxysterol-binding protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060526-3 si:ch211-106a19.1 "si:ch211-106a19.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1PJ53 OSBP2 "Oxysterol-binding protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1B7M8 OSBP2 "Oxysterol-binding protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-091113-18 osbp2 "oxysterol binding protein 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query538
pfam01237335 pfam01237, Oxysterol_BP, Oxysterol-binding protein 7e-72
cd1328499 cd13284, PH_OSBP_ORP4, Human Oxysterol binding pro 9e-62
cd13283100 cd13283, PH_GPBP, Goodpasture antigen binding prot 6e-31
cd13292103 cd13292, PH_Osh1p_Osh2p_yeast, Yeast oxysterol bin 1e-27
cd13290102 cd13290, PH_ORP9, Human Oxysterol binding protein 2e-24
cd01247100 cd01247, PH_FAPP1_FAPP2, Four phosphate adaptor pr 4e-24
pfam01237335 pfam01237, Oxysterol_BP, Oxysterol-binding protein 2e-23
cd13291107 cd13291, PH_ORP10_ORP11, Human Oxysterol binding p 2e-18
pfam00169101 pfam00169, PH, PH domain 4e-18
smart00233102 smart00233, PH, Pleckstrin homology domain 2e-17
cd0082192 cd00821, PH, Pleckstrin homology (PH) domain 1e-14
cd1329388 cd13293, PH_CpORP2-like, Cryptosporidium-like Oxys 3e-13
cd13276117 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin 4e-13
cd13294100 cd13294, PH_ORP_plant, Plant Oxysterol binding pro 5e-13
cd1328990 cd13289, PH_Osh3p_yeast, Yeast oxysterol binding p 6e-13
cd1328296 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology 1e-12
cd13248104 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate 6e-11
cd13288120 cd13288, PH_Ses, Sesquipedalian family Pleckstrin 6e-10
cd01265101 cd01265, PH_TBC1D2A, TBC1 domain family member 2A 5e-09
cd13255110 cd13255, PH_TAAP2-like, Tandem PH-domain-containin 1e-08
cd1325098 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin 1e-08
cd13285125 cd13285, PH_ORP1, Human Oxysterol binding protein 4e-08
cd13287123 cd13287, PH_ORP3_ORP6_ORP7, Human Oxysterol bindin 5e-08
cd13215130 cd13215, PH-GRAM1_AGT26, Autophagy-related protein 1e-07
cd13298106 cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin 3e-07
cd13263114 cd13263, PH_RhoGap25-like, Rho GTPase activating p 4e-07
cd13296111 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (P 7e-07
cd01252118 cd01252, PH_GRP1-like, General Receptor for Phosph 1e-06
cd01235106 cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (als 1e-06
cd01220123 cd01220, PH1_FARP1-like, FERM, RhoGEF and pleckstr 1e-06
cd13273110 cd13273, PH_SWAP-70, Switch-associated protein-70 3e-06
cd1325393 cd13253, PH1_ARAP, ArfGAP with RhoGAP domain, anky 4e-06
cd13271114 cd13271, PH2_TAPP1_2, Tandem PH-domain-containing 7e-06
cd01238140 cd01238, PH_Btk, Bruton's tyrosine kinase pleckstr 1e-05
cd13380106 cd13380, PH_Skap1, Src kinase-associated phosphopr 2e-05
cd01237110 cd01237, PH_fermitin, Fermitin family pleckstrin h 1e-04
cd13301108 cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin 2e-04
cd13324103 cd13324, PH_Gab-like, Grb2-associated binding prot 2e-04
cd13266106 cd13266, PH_Skap_family, Src kinase-associated pho 2e-04
cd13378116 cd13378, PH_RhoGAP2, Rho GTPase activating protein 2e-04
cd13265108 cd13265, PH_evt, Evectin Pleckstrin homology (PH) 3e-04
cd13385125 cd13385, PH_Gab3, Grb2-associated binding protein 4e-04
cd13384115 cd13384, PH_Gab2_2, Grb2-associated binding protei 0.001
cd13275103 cd13275, PH_M-RIP, Myosin phosphatase-RhoA Interac 0.001
cd01250114 cd01250, PH_AGAP, Arf-GAP with GTPase, ANK repeat 0.001
cd13308113 cd13308, PH_3BP2, SH3 domain-binding protein 2 Ple 0.001
cd01260114 cd01260, PH_CNK_mammalian-like, Connector enhancer 0.002
cd01251105 cd01251, PH2_ADAP, ArfGAP with dual PH domains Ple 0.003
cd13272116 cd13272, PH_INPP4A_INPP4B, Type I inositol 3,4-bis 0.004
>gnl|CDD|216381 pfam01237, Oxysterol_BP, Oxysterol-binding protein Back     alignment and domain information 
 Score =  232 bits (594), Expect = 7e-72
 Identities = 102/276 (36%), Positives = 135/276 (48%), Gaps = 49/276 (17%)

Query: 113 ALVAAFSTSAYSTT-AVRTGKPFNPLLGETYECDRTADAGWKAFSEQVSHHPPIAAQYVE 171
             VAAF+ S YS+T   RT KPFNPLLGET+E  R  D G++  SEQVSHHPPI+A + E
Sbjct: 38  LYVAAFAVSTYSSTRKRRTKKPFNPLLGETFELVRE-DGGFRFISEQVSHHPPISAYHAE 96

Query: 172 GKAWKAWQDLAVHSKFRGKYIQVTPAGRFNLVFTKSNQHYTWNRVQSTVHNVIVGNLWVD 231
            K W  W   A  SKF GK I+V P G  +L   K+ +HYTW +  + +HN+I G  +V+
Sbjct: 97  SKGWTLWGSSAPKSKFWGKSIEVKPEGHAHLTLKKTGEHYTWTKPTTHIHNIIFGKPYVE 156

Query: 232 QHGESDVINVTTGSTCRLTFYPYSYFSRQTQRRVLPWKPNTPRRSIIPEKPPGSMQIWSI 291
            +GE  + N TTG    + F    +FS          + N               ++   
Sbjct: 157 LYGEMYIKNSTTGYKAVIEFKKKGWFSG---------RKN---------------EVEGK 192

Query: 292 LKNSIGKDLSTIPMPLNFSEPLSMLQRLTEDFEYAHVLDEAAATDDVFRA-------PQY 344
           + +  GK L TI              +  E      V         +++A        + 
Sbjct: 193 VYDKKGKVLYTI------------SGKWNESLYIKKVKSSTGEKKLLWKANPLPPNSEKV 240

Query: 345 YCFTKFACQLNEL----EEGVAPTDSRLRPDQRLLE 376
           Y FTKFA  LNEL    +E + PTDSRLRPDQR LE
Sbjct: 241 YGFTKFAIPLNELTPELKEELPPTDSRLRPDQRALE 276

Length = 335
>gnl|CDD|241438 cd13284, PH_OSBP_ORP4, Human Oxysterol binding protein and OSBP-related protein 4 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241437 cd13283, PH_GPBP, Goodpasture antigen binding protein Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241446 cd13292, PH_Osh1p_Osh2p_yeast, Yeast oxysterol binding protein homologs 1 and 2 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241444 cd13290, PH_ORP9, Human Oxysterol binding protein related protein 9 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241278 cd01247, PH_FAPP1_FAPP2, Four phosphate adaptor protein 1 and 2 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|216381 pfam01237, Oxysterol_BP, Oxysterol-binding protein Back     alignment and domain information
>gnl|CDD|241445 cd13291, PH_ORP10_ORP11, Human Oxysterol binding protein (OSBP) related proteins 10 and 11 (ORP10 and ORP11) Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|215766 pfam00169, PH, PH domain Back     alignment and domain information
>gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain Back     alignment and domain information
>gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241447 cd13293, PH_CpORP2-like, Cryptosporidium-like Oxysterol binding protein related protein 2 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241430 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin homolog (PH) 1 (AtPH1) PH domain Back     alignment and domain information
>gnl|CDD|241448 cd13294, PH_ORP_plant, Plant Oxysterol binding protein related protein Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241443 cd13289, PH_Osh3p_yeast, Yeast oxysterol binding protein homolog 3 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241436 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology (PH) domain containing, family H (with MyTH4 domain) members 1 and 2 (PLEKHH1) PH domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241402 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate binding proteins 1, 2, and 3 pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241442 cd13288, PH_Ses, Sesquipedalian family Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241296 cd01265, PH_TBC1D2A, TBC1 domain family member 2A pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241409 cd13255, PH_TAAP2-like, Tandem PH-domain-containing protein 2 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241404 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin repeat and PH domains Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241439 cd13285, PH_ORP1, Human Oxysterol binding protein related protein 1 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241441 cd13287, PH_ORP3_ORP6_ORP7, Human Oxysterol binding protein related proteins 3, 6, and 7 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241369 cd13215, PH-GRAM1_AGT26, Autophagy-related protein 26/Sterol 3-beta-glucosyltransferase Pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241452 cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241417 cd13263, PH_RhoGap25-like, Rho GTPase activating protein 25 and related proteins Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241450 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (PH) domain, repeat 2 Back     alignment and domain information
>gnl|CDD|241283 cd01252, PH_GRP1-like, General Receptor for Phosphoinositides-1-like Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241268 cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (also called Human MTMR5) Pleckstrin Homology (PH) domain Back     alignment and domain information
>gnl|CDD|241255 cd01220, PH1_FARP1-like, FERM, RhoGEF and pleckstrin domain-containing protein 1 and related proteins Pleckstrin Homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241427 cd13273, PH_SWAP-70, Switch-associated protein-70 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241407 cd13253, PH1_ARAP, ArfGAP with RhoGAP domain, ankyrin repeat and PH domain Pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241425 cd13271, PH2_TAPP1_2, Tandem PH-domain-containing proteins 1 and 2 Pleckstrin homology (PH) domain, C-terminal repeat Back     alignment and domain information
>gnl|CDD|241271 cd01238, PH_Btk, Bruton's tyrosine kinase pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241531 cd13380, PH_Skap1, Src kinase-associated phosphoprotein 1 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241270 cd01237, PH_fermitin, Fermitin family pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241455 cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241478 cd13324, PH_Gab-like, Grb2-associated binding protein family Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241420 cd13266, PH_Skap_family, Src kinase-associated phosphoprotein family Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241529 cd13378, PH_RhoGAP2, Rho GTPase activating protein 2 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241419 cd13265, PH_evt, Evectin Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241536 cd13385, PH_Gab3, Grb2-associated binding protein 3 pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241535 cd13384, PH_Gab2_2, Grb2-associated binding protein family pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241429 cd13275, PH_M-RIP, Myosin phosphatase-RhoA Interacting Protein Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241281 cd01250, PH_AGAP, Arf-GAP with GTPase, ANK repeat and PH domain-containing protein Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241462 cd13308, PH_3BP2, SH3 domain-binding protein 2 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241291 cd01260, PH_CNK_mammalian-like, Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241282 cd01251, PH2_ADAP, ArfGAP with dual PH domains Pleckstrin homology (PH) domain, repeat 2 Back     alignment and domain information
>gnl|CDD|241426 cd13272, PH_INPP4A_INPP4B, Type I inositol 3,4-bisphosphate 4-phosphatase and Type II inositol 3,4-bisphosphate 4-phosphatase Pleckstrin homology (PH) domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 538
KOG2209|consensus445 100.0
KOG1737|consensus799 100.0
PF01237354 Oxysterol_BP: Oxysterol-binding protein ; InterPro 100.0
KOG2209|consensus 445 100.0
KOG2210|consensus392 100.0
KOG1737|consensus799 99.98
PF01237354 Oxysterol_BP: Oxysterol-binding protein ; InterPro 99.96
KOG3710|consensus 280 99.93
cd0124791 PH_GPBP Goodpasture antigen binding protein (GPBP) 99.86
KOG2210|consensus392 99.81
cd0126595 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain 99.8
cd01233100 Unc104 Unc-104 pleckstrin homology (PH) domain. Un 99.79
cd01251103 PH_centaurin_alpha Centaurin alpha Pleckstrin homo 99.79
cd01238106 PH_Tec Tec pleckstrin homology (PH) domain. Tec pl 99.75
cd01264101 PH_melted Melted pleckstrin homology (PH) domain. 99.74
cd0126096 PH_CNK Connector enhancer of KSR (Kinase suppresso 99.74
cd01235101 PH_SETbf Set binding factor Pleckstrin Homology (P 99.72
PF1540989 PH_8: Pleckstrin homology domain 99.71
cd01252125 PH_cytohesin Cytohesin Pleckstrin homology (PH) do 99.7
cd0124691 PH_oxysterol_bp Oxysterol binding protein (OSBP) P 99.67
cd01257101 PH_IRS Insulin receptor substrate (IRS) pleckstrin 99.66
cd0124598 PH_RasGAP_CG5898 RAS GTPase-activating protein (GA 99.64
cd01266108 PH_Gab Gab (Grb2-associated binder) pleckstrin hom 99.63
cd01236104 PH_outspread Outspread Pleckstrin homology (PH) do 99.63
cd0125094 PH_centaurin Centaurin Pleckstrin homology (PH) do 99.63
cd01241102 PH_Akt Akt pleckstrin homology (PH) domain. Akt pl 99.56
KOG0930|consensus395 99.54
PF00169104 PH: PH domain; InterPro: IPR001849 The pleckstrin 99.52
cd01237106 Unc112 Unc-112 pleckstrin homology (PH) domain. Un 99.52
cd0124498 PH_RasGAP_CG9209 RAS_GTPase activating protein (GA 99.49
PF15413112 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE 99.48
cd01263122 PH_anillin Anillin Pleckstrin homology (PH) domain 99.44
cd01219101 PH_FGD FGD (faciogenital dysplasia protein) plecks 99.41
cd01254121 PH_PLD Phospholipase D (PLD) pleckstrin homology ( 99.32
cd01253104 PH_beta_spectrin Beta-spectrin pleckstrin homology 99.27
smart00233102 PH Pleckstrin homology domain. Domain commonly fou 99.24
cd0122099 PH_CDEP Chondrocyte-derived ezrin-like domain cont 99.23
cd0082196 PH Pleckstrin homology (PH) domain. Pleckstrin hom 99.05
cd01256110 PH_dynamin Dynamin pleckstrin homology (PH) domain 99.04
cd0090099 PH-like Pleckstrin homology-like domain. Pleckstri 98.97
cd01230117 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 98.97
KOG1739|consensus611 98.89
KOG0690|consensus516 98.8
KOG1090|consensus1732 98.78
cd01234117 PH_CADPS CADPS (Ca2+-dependent activator protein) 98.76
PF14593104 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. 98.71
PF15410119 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN 98.68
cd01243122 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-bin 98.57
cd01242112 PH_ROK Rok (Rho- associated kinase) pleckstrin hom 98.52
cd01218104 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain 98.51
cd01239117 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin hom 98.5
cd01259114 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor pr 98.28
cd01261112 PH_SOS Son of Sevenless (SOS) Pleckstrin homology 98.16
cd01249104 PH_oligophrenin Oligophrenin Pleckstrin homology ( 98.03
KOG2059|consensus800 97.95
cd01240116 PH_beta-ARK Beta adrenergic receptor kinase 1(beta 97.91
KOG0248|consensus 936 97.9
cd0126289 PH_PDK1 3-Phosphoinositide dependent protein kinas 97.85
KOG0521|consensus785 97.8
KOG3640|consensus1116 97.77
cd01258108 PH_syntrophin Syntrophin pleckstrin homology (PH) 97.53
PLN00188 719 enhanced disease resistance protein (EDR2); Provis 97.49
KOG3531|consensus1036 97.49
KOG1117|consensus 1186 97.48
cd01224109 PH_Collybistin Collybistin pleckstrin homology (PH 97.32
KOG3723|consensus851 97.31
PF12814123 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin 97.23
PF15406112 PH_6: Pleckstrin homology domain 97.23
KOG3751|consensus622 97.22
PLN02866 1068 phospholipase D 97.21
PTZ00267478 NIMA-related protein kinase; Provisional 97.2
cd0122297 PH_clg Clg (common-site lymphoma/leukemia guanine 97.16
cd01225111 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK- 96.33
cd01221125 PH_ephexin Ephexin Pleckstrin homology (PH) domain 96.29
cd01226100 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin 96.28
KOG3543|consensus 1218 95.92
PF15404185 PH_4: Pleckstrin homology domain 95.89
KOG4424|consensus623 95.45
PTZ00283496 serine/threonine protein kinase; Provisional 95.2
KOG0932|consensus774 95.05
cd01232114 PH_TRIO Trio pleckstrin homology (PH) domain. Trio 94.93
KOG0705|consensus749 94.65
KOG1117|consensus 1186 94.55
KOG1451|consensus812 94.34
cd0122896 PH_BCR-related BCR (breakpoint cluster region)-rel 94.07
KOG3727|consensus664 93.98
cd01223116 PH_Vav Vav pleckstrin homology (PH) domain. Vav pl 92.97
cd01231107 PH_Lnk LNK-family Pleckstrin homology (PH) domain. 92.32
cd01248115 PH_PLC Phospholipase C (PLC) pleckstrin homology ( 92.29
cd01227133 PH_Dbs Dbs (DBL's big sister) pleckstrin homology 92.01
KOG0248|consensus 936 90.7
KOG4807|consensus593 90.67
PF15408104 PH_7: Pleckstrin homology domain 88.65
KOG3551|consensus506 88.37
KOG1738|consensus638 87.72
KOG4424|consensus623 81.77
>KOG2209|consensus Back     alignment and domain information 
Probab=100.00  E-value=6.8e-55  Score=420.70  Aligned_cols=328  Identities=32%  Similarity=0.487  Sum_probs=258.9

Q ss_pred             EeccHHHHHHHHHHhHhhhhhhcccceeeceeeccccccccccCCCCCCCcccceeeeecCCCCeEEeeccccCCCceeE
Q psy3487          88 KASNEVERQRWVTALELAKSKARQHALVAAFSTSAYSTTAVRTGKPFNPLLGETYECDRTADAGWKAFSEQVSHHPPIAA  167 (538)
Q Consensus        88 ~A~s~~e~~~Wi~al~~a~~~~~Rm~~v~a~~iS~~~~~~~~~~KPfNpllGEtfe~~~~~~~g~~~~~EQVSHHPPisa  167 (538)
                      +...--|....+.......++.+||++|+||++|..++...++.|||||||||||++.+ .|.|++|++|||||||||||
T Consensus        74 RltEyme~~yLi~kAs~~~~p~eRmqyVAAFAvsavas~weR~gKPFNPLl~et~el~r-~dlg~R~i~EQVSHHPPiSA  152 (445)
T KOG2209|consen   74 RLTEYMEHTYLIHKASSQSDPVERMQYVAAFAVSAVASQWERTGKPFNPLLGETYELER-EDLGFRFISEQVSHHPPISA  152 (445)
T ss_pred             HHHHHHHHHHHHHHHhhCCChHHHHHHHHHHHHHHHHHhHHHhcCCCcchhhhhhhhee-cccceEEeehhhccCCChhH
Confidence            33334444455555566678899999999999999999889999999999999999987 45799999999999999999


Q ss_pred             EEEE--cCCEEEEEEEeeeEEEeeeEEEEEeceeEEEEEcCCCeEEEEEeeceEEEeeEecceEEeecceEEEEECCCCC
Q psy3487         168 QYVE--GKAWKAWQDLAVHSKFRGKYIQVTPAGRFNLVFTKSNQHYTWNRVQSTVHNVIVGNLWVDQHGESDVINVTTGS  245 (538)
Q Consensus       168 ~~~e--~~g~~~~g~~~~~~kF~g~sv~i~~~G~~~i~f~~~~e~y~~~~p~~~v~~li~G~~~~e~~G~~~i~~~~tg~  245 (538)
                      ||+|  +..|.+.|++.++-+|||++|+..|.|.+.++|.+.+|.|+|+.|+.+|+|||+|++|++++|.|+|+++.||+
T Consensus       153 fhaEgl~~dF~fhGsi~PklkFWgksvea~Pkgtitle~~k~nEaYtWtnp~CcvhNiIvGklwieqyg~~eI~nh~Tg~  232 (445)
T KOG2209|consen  153 FHAEGLNNDFIFHGSIYPKLKFWGKSVEAEPKGTITLELLKHNEAYTWTNPTCCVHNIIVGKLWIEQYGNVEIINHKTGH  232 (445)
T ss_pred             hhhcccCcceEEeeeecccceeccceeecCCCceEEEEecccCcceeccCCcceeeeehhhhhhHhhcCcEEEEecCccc
Confidence            9999  56899999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eEEEEEeeeeeccCCceeeeeccC--CCCCeeeeeCCCCCCCcceee------eeecc----------CCCCCC--CCCC
Q psy3487         246 TCRLTFYPYSYFSRQTQRRVLPWK--PNTPRRSIIPEKPPGSMQIWS------ILKNS----------IGKDLS--TIPM  305 (538)
Q Consensus       246 ~~~l~f~~~~~fs~~~~~~v~G~v--~g~~~~~~l~G~W~~~i~lw~------i~k~~----------iGkdls--~i~~  305 (538)
                      +|++.|.|.|+|+++ .++|+|.|  .++...+.|.|+|..-+..-+      ..|+.          +-+.-|  .-.+
T Consensus       233 ~~vl~Fk~~G~~gk~-lHkVEG~i~d~~k~kl~~lYGkWTe~l~~cd~esf~~~~Kq~~r~~~~r~~s~~~~~see~dd~  311 (445)
T KOG2209|consen  233 KCVLNFKPCGLFGKE-LHKVEGHIQDKSKKKLCALYGKWTECLYSCDPESFDAFKKQDKRNTEERKNSKQMSTSEELDDM  311 (445)
T ss_pred             eeEEecccccccccc-hhheeehhhccccccchhhhccHHHHHhcCCHHHHHHHHHhhhhcchhhhhhccCCchhhccCC
Confidence            999999999999887 47899999  466666999999997653221      11211          111111  1125


Q ss_pred             CCCCC------CCcccchhccccccchhHHHhhhcCCCCCCccceEEEeeeeeccccccCC----CCCCCCcCCCCCeEE
Q psy3487         306 PLNFS------EPLSMLQRLTEDFEYAHVLDEAAATDDVFRAPQYYCFTKFACQLNELEEG----VAPTDSRLRPDQRLL  375 (538)
Q Consensus       306 Pv~~~------ep~s~Lqr~~e~~ey~~ll~~a~~~~d~~~~~r~~~~~~fa~~l~e~~~~----~~ptd~r~r~d~r~~  375 (538)
                      ||...      --..+||+            .++.|+   +...||.||.|+++|||+.+.    ++|||+|+|||.|.+
T Consensus       312 P~~ds~~v~~iPgSk~LW~------------~n~rP~---n~~~~y~FT~FalsLNem~~~M~~tl~pTD~RlRpDi~~m  376 (445)
T KOG2209|consen  312 PVPDSESVFIIPGSKLLWR------------INPRPP---NSAQMYNFTSFALSLNEMDKGMESTLPPTDCRLRPDIRAM  376 (445)
T ss_pred             CCCCcceeEecCCCeEEEE------------ecCCCC---CHHHhhchhhheeehhhhccCcccccCCcccccCchhhhh
Confidence            64332      23568999            788888   678999999999999998754    899999999999999


Q ss_pred             eeeeccccccee--eecCCeeEeEeeeeecccccceEEEEecceE-EEEeecccceEeeeeeccEEeEEEcc
Q psy3487         376 EVSHHPPIAAQY--VEGKAWKAWQDLAVHSKFRGKYIQVTPAGRF-NLVFTKSSMAVLHEVLGMYHSGVFKD  444 (538)
Q Consensus       376 e~~hhpp~~a~~--~e~~~~~~~~~~~~~~kF~G~s~~~~~~G~~-~~~~~~~g~~V~nEv~gl~~~g~f~~  444 (538)
                      |+|..+.|+.++  .|.+     |.-+-+.|  .+     ..+.+ .-||..........--.+|.+|.|..
T Consensus       377 E~G~~D~AseeK~rlEEk-----QRe~Rk~r--s~-----~~~dw~~rWF~~~~np~t~~~dWlYsGgYwdR  436 (445)
T KOG2209|consen  377 ENGNIDQASEEKKRLEEK-----QREARKNR--SK-----SEEDWKTRWFHQGPNPYTGAQDWLYSGGYWDR  436 (445)
T ss_pred             hcCCcchhHHHHHHHHHH-----HHHHHhhc--cc-----ccccCcchhcccCCCCCCCcccceeecCcccc
Confidence            999999998874  3433     11111111  11     12222 35666666655555556777776643

>KOG1737|consensus Back     alignment and domain information
>PF01237 Oxysterol_BP: Oxysterol-binding protein ; InterPro: IPR000648 A number of eukaryotic proteins that seem to be involved with sterol synthesis and/or its regulation have been found [] to be evolutionary related Back     alignment and domain information
>KOG2209|consensus Back     alignment and domain information
>KOG2210|consensus Back     alignment and domain information
>KOG1737|consensus Back     alignment and domain information
>PF01237 Oxysterol_BP: Oxysterol-binding protein ; InterPro: IPR000648 A number of eukaryotic proteins that seem to be involved with sterol synthesis and/or its regulation have been found [] to be evolutionary related Back     alignment and domain information
>KOG3710|consensus Back     alignment and domain information
>cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG2210|consensus Back     alignment and domain information
>cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01238 PH_Tec Tec pleckstrin homology (PH) domain Back     alignment and domain information
>cd01264 PH_melted Melted pleckstrin homology (PH) domain Back     alignment and domain information
>cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain Back     alignment and domain information
>PF15409 PH_8: Pleckstrin homology domain Back     alignment and domain information
>cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01241 PH_Akt Akt pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0930|consensus Back     alignment and domain information
>PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] Back     alignment and domain information
>cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain Back     alignment and domain information
>PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C Back     alignment and domain information
>cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain Back     alignment and domain information
>smart00233 PH Pleckstrin homology domain Back     alignment and domain information
>cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd00821 PH Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain Back     alignment and domain information
>cd00900 PH-like Pleckstrin homology-like domain Back     alignment and domain information
>cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain Back     alignment and domain information
>KOG1739|consensus Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>KOG1090|consensus Back     alignment and domain information
>cd01234 PH_CADPS CADPS (Ca2+-dependent activator protein) Pleckstrin homology (PH) domain Back     alignment and domain information
>PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A Back     alignment and domain information
>PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A Back     alignment and domain information
>cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01239 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01259 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG2059|consensus Back     alignment and domain information
>cd01240 PH_beta-ARK Beta adrenergic receptor kinase 1(beta ARK1)(GRK2) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0248|consensus Back     alignment and domain information
>cd01262 PH_PDK1 3-Phosphoinositide dependent protein kinase 1 (PDK1) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG3640|consensus Back     alignment and domain information
>cd01258 PH_syntrophin Syntrophin pleckstrin homology (PH) domain Back     alignment and domain information
>PLN00188 enhanced disease resistance protein (EDR2); Provisional Back     alignment and domain information
>KOG3531|consensus Back     alignment and domain information
>KOG1117|consensus Back     alignment and domain information
>cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain Back     alignment and domain information
>KOG3723|consensus Back     alignment and domain information
>PF12814 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin homology; InterPro: IPR024774 This pleckstrin homology domain is found in eukaryotic proteins, including Mcp5, a fungal protein that anchors dynein at the cell cortex during the horsetail phase (prophase I) of meiosis Back     alignment and domain information
>PF15406 PH_6: Pleckstrin homology domain Back     alignment and domain information
>KOG3751|consensus Back     alignment and domain information
>PLN02866 phospholipase D Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01226 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin Homology (PH) domain Back     alignment and domain information
>KOG3543|consensus Back     alignment and domain information
>PF15404 PH_4: Pleckstrin homology domain Back     alignment and domain information
>KOG4424|consensus Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0932|consensus Back     alignment and domain information
>cd01232 PH_TRIO Trio pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG1117|consensus Back     alignment and domain information
>KOG1451|consensus Back     alignment and domain information
>cd01228 PH_BCR-related BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain Back     alignment and domain information
>KOG3727|consensus Back     alignment and domain information
>cd01223 PH_Vav Vav pleckstrin homology (PH) domain Back     alignment and domain information
>cd01231 PH_Lnk LNK-family Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01248 PH_PLC Phospholipase C (PLC) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01227 PH_Dbs Dbs (DBL's big sister) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0248|consensus Back     alignment and domain information
>KOG4807|consensus Back     alignment and domain information
>PF15408 PH_7: Pleckstrin homology domain Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>KOG4424|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query538
2kcj_A108 Solution Structure Of Fapp1 Ph Domain Length = 108 5e-16
2rsg_A94 Solution Structure Of The Cert Ph Domain Length = 9 4e-15
3rcp_A103 Crystal Structure Of The Fapp1 Pleckstrin Homology 9e-15
3ouh_A237 Phd2-R127 With Jnj41536014 Length = 237 2e-14
2g19_A244 Cellular Oxygen Sensing: Crystal Structure Of Hypox 2e-14
3hqr_A 246 Phd2:mn:nog:hif1-Alpha Substrate Complex Length = 2 2e-14
2g1m_A 246 Cellular Oxygen Sensing: Crystal Structure Of Hypox 2e-14
3oui_A213 Phd2-R717 With 40787422 Length = 213 2e-14
2hbt_A 247 Crystal Structure Of Hif Prolyl Hydroxylase Egln-1 3e-14
2y33_A 252 S-Nitrosylated Phd2 (Gsno Soaked) In Complex With Z 3e-14
2d9x_A120 Solution Structure Of The Ph Domain Of Oxysterol Bi 2e-11
2yry_A122 Solution Structure Of The Ph Domain Of Pleckstrin H 3e-05
2d9y_A117 Solution Structure Of The Ph Domain Of Pepp-3 From 4e-05
>pdb|2KCJ|A Chain A, Solution Structure Of Fapp1 Ph Domain Length = 108 Back     alignment and structure 
Iteration: 1

 Score = 82.4 bits (202), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 61/93 (65%), Gaps = 3/93 (3%)
Query: 18  MKGWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMSHTCRGTISLRGAIIQT---EDSC 74
           M+G L+KWTNYL G+Q RWFVL NG+LSYY +Q ++    +G+I +    I+    +++ 
Sbjct: 9   MEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHSADNTR 68
Query: 75  TFIISNGVQTFHIKASNEVERQRWVTALELAKS 107
             +I  G Q F++KA N  ERQRW+ AL  +K+
Sbjct: 69  MELIIPGEQHFYMKAVNAAERQRWLVALGSSKA 101
>pdb|2RSG|A Chain A, Solution Structure Of The Cert Ph Domain Length = 94 Back     alignment and structure
>pdb|3RCP|A Chain A, Crystal Structure Of The Fapp1 Pleckstrin Homology Domain Length = 103 Back     alignment and structure
>pdb|3OUH|A Chain A, Phd2-R127 With Jnj41536014 Length = 237 Back     alignment and structure
>pdb|2G19|A Chain A, Cellular Oxygen Sensing: Crystal Structure Of Hypoxia- Inducible Factor Prolyl Hydroxylase (Phd2) Length = 244 Back     alignment and structure
>pdb|3HQR|A Chain A, Phd2:mn:nog:hif1-Alpha Substrate Complex Length = 246 Back     alignment and structure
>pdb|2G1M|A Chain A, Cellular Oxygen Sensing: Crystal Structure Of Hypoxia- Inducible Factor Prolyl Hydroxylase (Phd2) Length = 246 Back     alignment and structure
>pdb|3OUI|A Chain A, Phd2-R717 With 40787422 Length = 213 Back     alignment and structure
>pdb|2HBT|A Chain A, Crystal Structure Of Hif Prolyl Hydroxylase Egln-1 In Complex With A Biologically Active Inhibitor Length = 247 Back     alignment and structure
>pdb|2Y33|A Chain A, S-Nitrosylated Phd2 (Gsno Soaked) In Complex With Zn(Ii) And Un9 Length = 252 Back     alignment and structure
>pdb|2D9X|A Chain A, Solution Structure Of The Ph Domain Of Oxysterol Binding Protein-Related Protein 11 From Human Length = 120 Back     alignment and structure
>pdb|2YRY|A Chain A, Solution Structure Of The Ph Domain Of Pleckstrin Homology Domain-Containing Family A Member 6 From Human Length = 122 Back     alignment and structure
>pdb|2D9Y|A Chain A, Solution Structure Of The Ph Domain Of Pepp-3 From Human Length = 117 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query538
1zhx_A438 KES1 protein; oxysterol,sterol binding protein, li 5e-45
1zhx_A 438 KES1 protein; oxysterol,sterol binding protein, li 2e-22
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 4e-38
3rcp_A103 Pleckstrin homology domain-containing family A ME; 1e-35
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 2e-34
2d9v_A130 Pleckstrin homology domain-containing protein fami 3e-27
2ys3_A137 UNC-112-related protein 2; PH domain, kindlin-3, s 3e-26
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 8e-23
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 1e-22
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 1e-21
2d9y_A117 Pleckstrin homology domain-containing protein fami 1e-20
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 1e-20
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 1e-19
4f7h_A173 Fermitin family homolog 2; beta-barrel, membrane b 2e-19
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 3e-19
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 2e-18
3aj4_A112 Pleckstrin homology domain-containing family B ME; 2e-18
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 2e-18
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 2e-18
2yry_A122 Pleckstrin homology domain-containing family A mem 3e-18
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 6e-18
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 1e-17
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 2e-17
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 2e-17
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 3e-17
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 5e-17
2dkp_A128 Pleckstrin homology domain-containing family A mem 1e-16
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 1e-16
1u5e_A211 SRC-associated adaptor protein; novel dimerization 1e-16
1wi1_A126 Calcium-dependent activator protein for secretion, 2e-16
3cxb_B112 Pleckstrin homology domain-containing family M mem 2e-16
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 6e-16
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 9e-16
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 1e-15
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 1e-15
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 1e-15
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 9e-15
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 1e-14
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 4e-13
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 5e-13
1v5p_A126 Pleckstrin homology domain-containing, family A; T 1e-12
1v88_A130 Oxysterol binding protein-related protein 8; vesic 4e-12
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 2e-11
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 8e-11
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 1e-10
2coc_A112 FYVE, rhogef and PH domain containing protein 3; s 4e-10
1qqg_A264 IRS-1, insulin receptor substrate 1; beta-sandwhic 6e-10
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 1e-09
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 5e-09
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 7e-08
3a8p_A263 T-lymphoma invasion and metastasis-inducing protei 8e-08
3a8n_A279 TIAM-1, T-lymphoma invasion and metastasis-inducin 9e-08
2hbt_A 247 EGL nine homolog 1; prolyl hydroxylase, hypoxia in 1e-07
1v61_A132 RAC/CDC42 guanine nucleotide exchange factor (GEF) 2e-07
1dyn_A125 Dynamin; signal transduction protein; 2.20A {Homo 8e-07
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 1e-06
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 2e-06
3hk0_A256 Growth factor receptor-bound protein 10; GRB10, RA 2e-06
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 7e-06
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 2e-05
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 5e-05
3mpx_A434 FYVE, rhogef and PH domain-containing protein 5; s 1e-04
2d9w_A127 Docking protein 2; PH domain, structural genomics, 4e-04
2rov_A117 RHO-associated protein kinase 2; ATP-binding, coil 8e-04
>1zhx_A KES1 protein; oxysterol,sterol binding protein, lipid binding protein; HET: HC3; 1.50A {Saccharomyces cerevisiae} SCOP: d.338.1.1 PDB: 1zht_A* 1zhw_A* 1zhy_A* 1zhz_A* 3spw_A* 1zi7_A Length = 438 Back     alignment and structure
 Score =  163 bits (414), Expect = 5e-45
 Identities = 36/161 (22%), Positives = 60/161 (37%), Gaps = 16/161 (9%)

Query: 113 ALVAAFSTSAYST-------TAVRTGKPFNPLLGETYECDRTADAGWKA-----FSEQVS 160
             V  +  S   +       +     KP NP LGE +          +       SEQVS
Sbjct: 87  LAVTKWFISTLKSQYCSRNESLGSEKKPLNPFLGELFVGKWENKEHPEFGETVLLSEQVS 146

Query: 161 HHPPIAAQYVEGKA--WKAWQDLAVHSKFRGKYIQVTPAGRFNLVFTKSNQHYTWNRVQS 218
           HHPP+ A  +       K      + + F  K + +T     + +    ++ Y       
Sbjct: 147 HHPPVTAFSIFNDKNKVKLQGYNQIKASF-TKSLMLTVKQFGHTMLDIKDESYLVTPPPL 205

Query: 219 TVHNVIVGNLWVDQHGESDVINVTTGSTCRLTFYPYSYFSR 259
            +  ++V + +V+  G+S  I  +TG  C + F    YFS 
Sbjct: 206 HIEGILVASPFVELEGKS-YIQSSTGLLCVIEFSGRGYFSG 245
>1zhx_A KES1 protein; oxysterol,sterol binding protein, lipid binding protein; HET: HC3; 1.50A {Saccharomyces cerevisiae} SCOP: d.338.1.1 PDB: 1zht_A* 1zhw_A* 1zhy_A* 1zhz_A* 3spw_A* 1zi7_A Length = 438 Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Length = 103 Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 Back     alignment and structure
>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 137 Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 115 Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126 Back     alignment and structure
>4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* Length = 173 Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Length = 123 Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 109 Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Length = 112 Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 107 Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Length = 148 Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 122 Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125 Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Length = 117 Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Length = 108 Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 113 Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Length = 228 Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 118 Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Length = 129 Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Length = 211 Back     alignment and structure
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 126 Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112 Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Length = 109 Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 129 Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 149 Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Length = 125 Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 150 Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Length = 127 Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Length = 134 Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 126 Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 130 Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Length = 120 Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Length = 168 Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Length = 386 Back     alignment and structure
>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 112 Back     alignment and structure
>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Length = 264 Back     alignment and structure
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Length = 385 Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Length = 169 Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Length = 126 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Length = 129 Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Length = 263 Back     alignment and structure
>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Length = 279 Back     alignment and structure
>2hbt_A EGL nine homolog 1; prolyl hydroxylase, hypoxia inducible factor, HIF, 2- oxoglutarate, oxygenase, oxidoreductase; HET: UN9; 1.60A {Homo sapiens} PDB: 2hbu_A* 2g1m_A* 3hqu_A* 3hqr_A* 2y33_A* 2y34_A* 2g19_A* 3ouj_A* 3ouh_A* 3oui_A* Length = 247 Back     alignment and structure
>1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 132 Back     alignment and structure
>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Length = 125 Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 123 Back     alignment and structure
>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Length = 122 Back     alignment and structure
>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Length = 256 Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Length = 106 Back     alignment and structure
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Length = 124 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Length = 434 Back     alignment and structure
>2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Length = 117 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query538
1zhx_A438 KES1 protein; oxysterol,sterol binding protein, li 100.0
1zhx_A 438 KES1 protein; oxysterol,sterol binding protein, li 99.94
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 99.84
3rcp_A103 Pleckstrin homology domain-containing family A ME; 99.81
1wi1_A126 Calcium-dependent activator protein for secretion, 99.8
1v88_A130 Oxysterol binding protein-related protein 8; vesic 99.8
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 99.79
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 99.79
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 99.78
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 99.78
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 99.77
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 99.76
2coc_A112 FYVE, rhogef and PH domain containing protein 3; s 99.76
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 99.76
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 99.75
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 99.75
1dyn_A125 Dynamin; signal transduction protein; 2.20A {Homo 99.75
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 99.75
2d9v_A130 Pleckstrin homology domain-containing protein fami 99.75
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 99.74
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 99.74
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 99.74
2dkp_A128 Pleckstrin homology domain-containing family A mem 99.73
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 99.73
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 99.73
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 99.73
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 99.73
3aj4_A112 Pleckstrin homology domain-containing family B ME; 99.73
1v5p_A126 Pleckstrin homology domain-containing, family A; T 99.72
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 99.72
2d9y_A117 Pleckstrin homology domain-containing protein fami 99.72
2yry_A122 Pleckstrin homology domain-containing family A mem 99.71
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 99.71
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 99.71
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 99.71
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 99.71
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 99.7
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 99.7
2w2x_D124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.7
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 99.7
3cxb_B112 Pleckstrin homology domain-containing family M mem 99.69
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 99.69
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 99.69
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 99.68
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 99.68
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 99.68
1u5e_A211 SRC-associated adaptor protein; novel dimerization 99.66
2ys3_A137 UNC-112-related protein 2; PH domain, kindlin-3, s 99.64
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 99.64
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 99.63
2r09_A347 Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph 99.6
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 99.59
3a8p_A263 T-lymphoma invasion and metastasis-inducing protei 99.58
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 99.58
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 99.57
1qqg_A264 IRS-1, insulin receptor substrate 1; beta-sandwhic 99.57
4bbk_A165 Kindlin-1, fermitin family homolog 1; PH domain, c 99.55
4f7h_A173 Fermitin family homolog 2; beta-barrel, membrane b 99.54
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 99.54
3tca_A291 Amyloid beta A4 precursor protein-binding family 1 99.53
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 99.53
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 99.51
4h8s_A407 DCC-interacting protein 13-beta; BAR domain, pleck 99.49
2rov_A117 RHO-associated protein kinase 2; ATP-binding, coil 99.42
2fjl_A150 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.32
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.3
3hk0_A256 Growth factor receptor-bound protein 10; GRB10, RA 99.28
4gmv_A281 RAS-associated and pleckstrin homology domains-CO 99.21
2d9w_A127 Docking protein 2; PH domain, structural genomics, 99.2
3a8n_A279 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.19
1w1g_A151 HPDK1, 3-phosphoinositide dependent protein kinase 99.18
2coa_A125 Protein kinase C, D2 type; protein kinase D2, PH d 98.93
2d9z_A129 Protein kinase C, NU type; PH domain, structural g 98.76
2hbt_A 247 EGL nine homolog 1; prolyl hydroxylase, hypoxia in 98.46
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 98.3
1v61_A132 RAC/CDC42 guanine nucleotide exchange factor (GEF) 97.82
1v5m_A136 SH2 and PH domain-containing adapter protein APS; 97.69
3ml4_A224 Protein DOK-7; tyrosine phosphorylation, adapter p 97.51
1zc3_B113 Exocyst complex protein EXO84; exocytosis, small G 97.46
3mpx_A434 FYVE, rhogef and PH domain-containing protein 5; s 97.4
3qwm_A140 Iqsec1, IQ motif and SEC7 domain-containing protei 97.04
2dfk_A402 Collybistin II; DH domain, PH domain, cell cycle; 97.02
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 96.92
2lg1_A185 A-kinase anchor protein 13; metal binding protein; 96.9
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 96.88
1dbh_A354 Protein (human SOS 1); guanine nucleotide exchange 96.86
1mai_A131 Phospholipase C delta-1; pleckstrin, inositol tris 96.76
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 96.7
1xcg_A368 PDZ-rhogef, RHO guanine nucleotide exchange factor 96.69
1kz7_A353 Guanine nucleotide exchange factor DBS; guanine nu 96.62
3t06_A418 PDZ-rhogef, RHO guanine nucleotide exchange factor 96.59
1nty_A311 Triple functional domain protein; DBL, pleckstrin, 96.41
3p6a_A377 RHO guanine nucleotide exchange factor 1; regulati 96.19
2rgn_B354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 96.06
1txd_A385 RHO guanine nucleotide exchange factor 12; helical 95.96
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 95.72
3odw_A536 RHO guanine nucleotide exchange factor 1; regulati 95.68
2z0q_A346 XPLN, RHO guanine nucleotide exchange factor 3; DH 95.56
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 94.48
3ksy_A1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 93.31
1foe_A377 T-lymphoma invasion and metastasis inducing protei 92.16
3zvr_A772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 91.96
1fho_A119 UNC-89; pleckstrin homology domain, electrostatics 90.84
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 85.5
2adz_A178 Alpha-1-syntrophin; protein binding; NMR {Mus musc 83.94
>1zhx_A KES1 protein; oxysterol,sterol binding protein, lipid binding protein; HET: HC3; 1.50A {Saccharomyces cerevisiae} SCOP: d.338.1.1 PDB: 1zht_A* 1zhw_A* 1zhy_A* 1zhz_A* 3spw_A* 1zi7_A Back     alignment and structure
Probab=100.00  E-value=9.1e-45  Score=381.84  Aligned_cols=234  Identities=21%  Similarity=0.261  Sum_probs=192.4

Q ss_pred             hhcccceeeceeeccccccc-------cccCCCCCCCcccceeeeecC----CCC-eEEeeccccCCCceeEEEEEcC--
Q psy3487         108 KARQHALVAAFSTSAYSTTA-------VRTGKPFNPLLGETYECDRTA----DAG-WKAFSEQVSHHPPIAAQYVEGK--  173 (538)
Q Consensus       108 ~~~Rm~~v~a~~iS~~~~~~-------~~~~KPfNpllGEtfe~~~~~----~~g-~~~~~EQVSHHPPisa~~~e~~--  173 (538)
                      +.+||++|++|++|+|+...       .+.+|||||+|||||+|.+.+    +.| ++|+||||||||||||||++++  
T Consensus        82 p~eRm~~V~af~lS~~~~~y~~~~~~~~~~kKPfNPiLGETFe~~~~d~~~~~~g~~~~iaEQVSHHPPISA~~~e~~~~  161 (438)
T 1zhx_A           82 ELARMLAVTKWFISTLKSQYCSRNESLGSEKKPLNPFLGELFVGKWENKEHPEFGETVLLSEQVSHHPPVTAFSIFNDKN  161 (438)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHSSCCEEECCCTTCEEEEEECCTTCTTTCCEEEEEEEEEETTEEEEEEEEETTT
T ss_pred             HHHHHHHHHHHHHhhhhhhcccccccccccccCcCCcccceEEEEecCccCCCCCcEEEEEEeccCCCCeeEEEEEcCCC
Confidence            89999999999999986532       467899999999999999854    246 7999999999999999999997  


Q ss_pred             CEEEEEEEeeeEEEeee-EEEEEeceeEEEEEcCCCeEEEEEeeceEEEeeEecceEEeecceEEEEECCCCCeEEEEEe
Q psy3487         174 AWKAWQDLAVHSKFRGK-YIQVTPAGRFNLVFTKSNQHYTWNRVQSTVHNVIVGNLWVDQHGESDVINVTTGSTCRLTFY  252 (538)
Q Consensus       174 g~~~~g~~~~~~kF~g~-sv~i~~~G~~~i~f~~~~e~y~~~~p~~~v~~li~G~~~~e~~G~~~i~~~~tg~~~~l~f~  252 (538)
                      +|.++|+..++++|+|+ |+++.+.|..+|+|.  +|+|+|++|+++++|||+|++|+|++|+++|+| +||++|.|+|.
T Consensus       162 g~~~~g~~~~kskF~G~~Sv~v~~~G~~~l~l~--~E~Y~~t~P~~~v~gIi~G~~~vE~~G~~~I~~-~tg~~~~l~F~  238 (438)
T 1zhx_A          162 KVKLQGYNQIKASFTKSLMLTVKQFGHTMLDIK--DESYLVTPPPLHIEGILVASPFVELEGKSYIQS-STGLLCVIEFS  238 (438)
T ss_dssp             TEEEEEEEEEEEEECTTCCEEEEEECCEEEEET--TEEEEEECCCEEEECTTTTCCEEEECSEEEEEE-TTSCEEEEEEE
T ss_pred             CEEEEEEeeeEEEEcCceEEEEEcceEEEEEEC--CcEEEEecCcEEEEEEEecceeEecCCeEEEEc-CCCCEEEEEEc
Confidence            89999999999999999 999999999999998  899999999999999999999999999999999 69999999999


Q ss_pred             eeeeccCCceeeeeccC-C-------CCCeeeeeCCCCCCCcceeeeeeccCCCCCCCCCCCCCCCCCcccchhcccccc
Q psy3487         253 PYSYFSRQTQRRVLPWK-P-------NTPRRSIIPEKPPGSMQIWSILKNSIGKDLSTIPMPLNFSEPLSMLQRLTEDFE  324 (538)
Q Consensus       253 ~~~~fs~~~~~~v~G~v-~-------g~~~~~~l~G~W~~~i~lw~i~k~~iGkdls~i~~Pv~~~ep~s~Lqr~~e~~e  324 (538)
                      ++|||+++. +.|+|.| +       +....++|.|+|++.+.+.+.-.   |             +....+|.+     
T Consensus       239 ~kg~f~g~~-n~v~G~I~~~~~~~~~~~~~l~~i~G~W~~~l~i~~~~~---~-------------~~~~~~~~~-----  296 (438)
T 1zhx_A          239 GRGYFSGKK-NSFKARIYKDSKDSKDKEKALYTISGQWSGSSKIIKANK---K-------------EESRLFYDA-----  296 (438)
T ss_dssp             CSSSSCSSS-SEEEEEEESSTTGGGCGGGCSEEEEEETTSEEEEEETTC---G-------------GGCEEEEET-----
T ss_pred             CCCCcCCCc-cEEEEEEEcCCcccCCCCcEEEEEEEEEcceEEEEeCCC---C-------------ccceEEecc-----
Confidence            999999874 8999999 3       23334999999999988754310   0             001344442     


Q ss_pred             chhHHHhhhcCCCCCCccceEEEeeeeeccccccCCCCCCCCcC--CCCCeEEeeeeccccccee
Q psy3487         325 YAHVLDEAAATDDVFRAPQYYCFTKFACQLNELEEGVAPTDSRL--RPDQRLLEVSHHPPIAAQY  387 (538)
Q Consensus       325 y~~ll~~a~~~~d~~~~~r~~~~~~fa~~l~e~~~~~~ptd~r~--r~d~r~~e~~hhpp~~a~~  387 (538)
                             ...+..  +         +.  +. ..+..+|||||+  |||+|++|.|.++.|+..+
T Consensus       297 -------~~~~~~--~---------~~--v~-p~e~q~ptdSR~~Wr~d~~ale~Gd~d~A~~eK  340 (438)
T 1zhx_A          297 -------ARIPAE--H---------LN--VK-PLEEQHPLESRKAWYDVAGAIKLGDFNLIAKTK  340 (438)
T ss_dssp             -------TTSCCC--C---------CB--CC-CGGGCCTTBHHHHTHHHHHHHHHTCHHHHHHHH
T ss_pred             -------CCCCCc--c---------cc--CC-ChhhCCCcccchhhHHHHHHHHcCCHHHHHHHH
Confidence                   111111  0         00  11 112357999996  9999999999999998865
>1zhx_A KES1 protein; oxysterol,sterol binding protein, lipid binding protein; HET: HC3; 1.50A {Saccharomyces cerevisiae} SCOP: d.338.1.1 PDB: 1zht_A* 1zhw_A* 1zhy_A* 1zhz_A* 3spw_A* 1zi7_A Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Back     alignment and structure
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Back     alignment and structure
>2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Back     alignment and structure
>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Back     alignment and structure
>2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* Back     alignment and structure
>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Back     alignment and structure
>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Back     alignment and structure
>4bbk_A Kindlin-1, fermitin family homolog 1; PH domain, cell adhesion; 2.10A {Mus musculus} Back     alignment and structure
>4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* Back     alignment and structure
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Back     alignment and structure
>3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} Back     alignment and structure
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} Back     alignment and structure
>2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Back     alignment and structure
>2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Back     alignment and structure
>4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A Back     alignment and structure
>2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Back     alignment and structure
>1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A Back     alignment and structure
>2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hbt_A EGL nine homolog 1; prolyl hydroxylase, hypoxia inducible factor, HIF, 2- oxoglutarate, oxygenase, oxidoreductase; HET: UN9; 1.60A {Homo sapiens} PDB: 2hbu_A* 2g1m_A* 3hqu_A* 3hqr_A* 2y33_A* 2y34_A* 2g19_A* 3ouj_A* 3ouh_A* 3oui_A* Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1v5m_A SH2 and PH domain-containing adapter protein APS; adaptor protein, pleckstrin homology domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>3ml4_A Protein DOK-7; tyrosine phosphorylation, adapter protein, dimerization, SIG protein; HET: PTR; 2.60A {Mus musculus} Back     alignment and structure
>1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Back     alignment and structure
>3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} Back     alignment and structure
>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Back     alignment and structure
>2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Back     alignment and structure
>1mai_A Phospholipase C delta-1; pleckstrin, inositol trisphosphate, signal transduction protein, hydrolase; HET: I3P; 1.90A {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* Back     alignment and structure
>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Back     alignment and structure
>3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} Back     alignment and structure
>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Back     alignment and structure
>3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A Back     alignment and structure
>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Back     alignment and structure
>1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Back     alignment and structure
>2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Back     alignment and structure
>1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>1fho_A UNC-89; pleckstrin homology domain, electrostatics, muscle, signal transduction, signaling protein; NMR {Caenorhabditis elegans} SCOP: b.55.1.1 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>2adz_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 538
d1zhxa1433 d.338.1.1 (A:2-434) Oxysterol-binding protein homo 6e-39
d1zhxa1 433 d.338.1.1 (A:2-434) Oxysterol-binding protein homo 1e-20
d1eaza_103 b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 6e-17
d1faoa_100 b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 1e-16
d1x1ga1116 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie 3e-16
d1fgya_127 b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 1 8e-16
d1v5ua_117 b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M 3e-15
d2i5fa1104 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie 4e-15
d1v89a_118 b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KI 1e-14
d1plsa_113 b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [Ta 3e-14
d1u5da1106 b.55.1.1 (A:108-213) Src kinase-associated phospho 2e-13
d1u5ea1209 b.55.1.1 (A:14-222) Src-associated adaptor protein 4e-13
d1omwa2119 b.55.1.1 (A:550-668) G-protein coupled receptor ki 2e-12
d1v88a_130 b.55.1.1 (A:) Oxysterol binding protein-related pr 6e-12
d1upqa_107 b.55.1.1 (A:) Phosphoinositol 3-phosphate binding 8e-12
d2coda1102 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo 9e-12
d1wgqa_109 b.55.1.1 (A:) FYVE, RhoGEF and PH domain containin 9e-12
d1wi1a_126 b.55.1.1 (A:) Calcium-dependent activator protein 1e-11
d1u5fa1111 b.55.1.1 (A:109-219) Src-associated adaptor protei 2e-11
d2cofa195 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) 5e-11
d2fjla1101 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phosph 2e-10
d2coca199 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain cont 4e-10
d1qqga1103 b.55.1.2 (A:12-114) Insulin receptor substrate 1, 5e-10
d1unqa_118 b.55.1.1 (A:) Rac-alpha serine/threonine kinase {H 7e-10
d1droa_122 b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila 9e-10
d1w1ha_147 b.55.1.1 (A:) 3-phosphoinositide dependent protein 4e-09
d1x1fa1136 b.55.1.1 (A:8-143) Signal-transducing adaptor prot 4e-09
d2j59m1133 b.55.1.1 (M:931-1063) Rho GTPase-activating protei 5e-09
d1v5pa_126 b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 7e-09
d1btna_106 b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), 1e-08
d2elba2101 b.55.1.1 (A:274-374) DCC-interacting protein 13-al 3e-08
d1wjma_123 b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), 3e-08
d1v5ma_136 b.55.1.1 (A:) SH2 and PH domain-containing adapter 1e-07
d1btka_169 b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Hom 1e-07
d1wg7a_150 b.55.1.1 (A:) Dedicator of cytokinesis protein 9, 5e-07
d2dyna_111 b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId 2e-06
d1v61a_132 b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (M 4e-06
d2coaa1112 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Huma 7e-05
d1maia_119 b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus 1e-04
d1fhoa_119 b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis ele 0.004
>d1zhxa1 d.338.1.1 (A:2-434) Oxysterol-binding protein homolog 4, KES1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 433 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Oxysterol-binding protein-like
superfamily: Oxysterol-binding protein-like
family: Oxysterol-binding protein
domain: Oxysterol-binding protein homolog 4, KES1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score =  145 bits (367), Expect = 6e-39
 Identities = 45/307 (14%), Positives = 100/307 (32%), Gaps = 57/307 (18%)

Query: 88  KASNEVERQRWVTALELAKSKARQHALVAAFSTSAY-------STTAVRTGKPFNPLLGE 140
             +++  ++  +   E+   +  +   V  +  S         + +     KP NP LGE
Sbjct: 57  FINDDNYKEHCLIDPEVESPELARMLAVTKWFISTLKSQYCSRNESLGSEKKPLNPFLGE 116

Query: 141 TYECDRTADAGWKA-----FSEQVSHHPPIAAQYVEGKA--WKAWQDLAVHSKFRGKYIQ 193
            +          +       SEQVSHHPP+ A  +       K      + + F  K + 
Sbjct: 117 LFVGKWENKEHPEFGETVLLSEQVSHHPPVTAFSIFNDKNKVKLQGYNQIKASF-TKSLM 175

Query: 194 VTPAGRFNLVFTKSNQHYTWNRVQSTVHNVIVGNLWVDQHGESDVINVTTGSTCRLTFYP 253
           +T     + +    ++ Y        +  ++V + +V+  G+S  I  +TG  C + F  
Sbjct: 176 LTVKQFGHTMLDIKDESYLVTPPPLHIEGILVASPFVELEGKS-YIQSSTGLLCVIEFSG 234

Query: 254 YSYFSRQTQRRVLPWKPNTPRRSIIPEKPPGSMQIWSILKNSIGKDLSTIPMPLNFSEPL 313
             YFS   +                        +I+   K+S  K+              
Sbjct: 235 RGYFSG-KKNSF-------------------KARIYKDSKDSKDKE-------------- 260

Query: 314 SMLQRLTEDFEYAHVLDEAAATDDVFRAPQYYCFTKFACQLNEL----EEGVAPTDSRLR 369
             L  ++  +  +  + +A   ++   +  +Y   +   +   +    E+    +     
Sbjct: 261 KALYTISGQWSGSSKIIKANKKEE---SRLFYDAARIPAEHLNVKPLEEQHPLESRKAWY 317

Query: 370 PDQRLLE 376
                ++
Sbjct: 318 DVAGAIK 324
>d1zhxa1 d.338.1.1 (A:2-434) Oxysterol-binding protein homolog 4, KES1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 433 Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 Back     information, alignment and structure
>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Length = 119 Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 101 Back     information, alignment and structure
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 147 Back     information, alignment and structure
>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 136 Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Length = 106 Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Length = 132 Back     information, alignment and structure
>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 119 Back     information, alignment and structure
>d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 119 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query538
d1zhxa1433 Oxysterol-binding protein homolog 4, KES1 {Baker's 100.0
d1zhxa1 433 Oxysterol-binding protein homolog 4, KES1 {Baker's 99.91
d1faoa_100 Dual adaptor of phosphotyrosine and 3-phosphoinosi 99.8
d2coaa1112 Protein kinase c, d2 type {Human (Homo sapiens) [T 99.73
d2coda1102 Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 99.72
d1v88a_130 Oxysterol binding protein-related protein 8 (ORP-8 99.72
d1wgqa_109 FYVE, RhoGEF and PH domain containing protein 6, F 99.7
d1eaza_103 Tapp1 {Human (Homo sapiens) [TaxId: 9606]} 99.7
d2fjla1101 Phosphoinositide phospholipase C, PLC-gamma-1 {Rat 99.69
d1x1fa1136 Signal-transducing adaptor protein 1, STAP-1 {Huma 99.69
d1v5ua_117 SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ 99.69
d1v89a_118 Rho-GTPase-activating protein 25 (KIAA0053) {Human 99.69
d2coca199 FYVE, RhoGEF and PH domain containing protein 3, F 99.68
d1fgya_127 Grp1 {Mouse (Mus musculus) [TaxId: 10090]} 99.68
d1plsa_113 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 99.67
d2dyna_111 Dynamin {Human (Homo sapiens) [TaxId: 9606]} 99.67
d1btka_169 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 99.67
d1wi1a_126 Calcium-dependent activator protein for secretion, 99.67
d1upqa_107 Phosphoinositol 3-phosphate binding protein-1, PEP 99.66
d1u5fa1111 Src-associated adaptor protein Skap2 {Mouse (Mus m 99.66
d1w1ha_147 3-phosphoinositide dependent protein kinase-1 {Hum 99.64
d2cofa195 KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1u5da1106 Src kinase-associated phosphoprotein SKAP55 (SCAP1 99.64
d1omwa2119 G-protein coupled receptor kinase 2 (beta-adrenerg 99.63
d2j59m1133 Rho GTPase-activating protein 21 {Human (Homo sapi 99.61
d2i5fa1104 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1qqga1103 Insulin receptor substrate 1, IRS-1 {Human (Homo s 99.61
d1v5pa_126 Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} 99.61
d2elba2101 DCC-interacting protein 13-alpha, APPL1 {Human (Ho 99.61
d1unqa_118 Rac-alpha serine/threonine kinase {Human (Homo sap 99.6
d1wg7a_150 Dedicator of cytokinesis protein 9, DOCK9 {Human ( 99.58
d1u5ea1209 Src-associated adaptor protein Skap2 {Mouse (Mus m 99.58
d1x1ga1116 Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1btna_106 beta-spectrin {Mouse (Mus musculus), brain [TaxId: 99.52
d1wjma_123 beta-spectrin {Human (Homo sapiens), brain 2 isofo 99.51
d1v5ma_136 SH2 and PH domain-containing adapter protein APS { 99.49
d1droa_122 beta-spectrin {Fruit fly (Drosophila melanogaster) 99.45
d1v61a_132 Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ 98.89
d2dfka2162 Rho guanine nucleotide exchange factor 9, Collybis 98.62
d1maia_119 Phospholipase C delta-1 {Rat (Rattus norvegicus) [ 98.25
d1zc3b1109 Exocyst complex protein EXO84 {Rat (Rattus norvegi 98.16
d1dbha2133 Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ 97.87
d1ntya2121 Triple functional domain protein TRIO {Human (Homo 97.53
d1ki1b2142 GEF of intersectin {Human (Homo sapiens) [TaxId: 9 97.44
d1xcga2140 Rho guanine nucleotide exchange factor 11, PDZ-Rho 97.42
d1fhoa_119 UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 97.27
d1txda2114 Rho guanine nucleotide exchange factor 12 {Human ( 97.14
d1kz7a2147 Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId 96.77
d2adza1105 Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 1 95.71
d2zkmx3131 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 91.73
>d1zhxa1 d.338.1.1 (A:2-434) Oxysterol-binding protein homolog 4, KES1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Oxysterol-binding protein-like
superfamily: Oxysterol-binding protein-like
family: Oxysterol-binding protein
domain: Oxysterol-binding protein homolog 4, KES1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=100.00  E-value=4.7e-42  Score=360.23  Aligned_cols=233  Identities=18%  Similarity=0.231  Sum_probs=185.0

Q ss_pred             hhcccceeeceeeccccc-------cccccCCCCCCCcccceeeeecCC-----CCeEEeeccccCCCceeEEEEEcC--
Q psy3487         108 KARQHALVAAFSTSAYST-------TAVRTGKPFNPLLGETYECDRTAD-----AGWKAFSEQVSHHPPIAAQYVEGK--  173 (538)
Q Consensus       108 ~~~Rm~~v~a~~iS~~~~-------~~~~~~KPfNpllGEtfe~~~~~~-----~g~~~~~EQVSHHPPisa~~~e~~--  173 (538)
                      +.+||++|++|++|+|+.       ...+.+|||||||||||+|.+.+.     .+++++||||||||||+|||++++  
T Consensus        77 p~eRm~~V~~f~lS~~~~~~~~~~~~~~~~kKPfNPiLGETfe~~~~d~~~~~~~~~~~iaEQVSHHPPIsA~~~~~~~~  156 (433)
T d1zhxa1          77 ELARMLAVTKWFISTLKSQYCSRNESLGSEKKPLNPFLGELFVGKWENKEHPEFGETVLLSEQVSHHPPVTAFSIFNDKN  156 (433)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHSSCCEEECCCTTCEEEEEECCTTCTTTCCEEEEEEEEEETTEEEEEEEEETTT
T ss_pred             HHHHHHHHHHHHHHHhhhhhcccccccccccCCCCCcccceEEEEEecCCCCcCCcEEEEEeCCCCCCcceeEEEEcCCC
Confidence            578999999999999864       345789999999999999998543     358999999999999999999997  


Q ss_pred             CEEEEEEEeeeEEEeeeEEEEEeceeEEEEEcCCCeEEEEEeeceEEEeeEecceEEeecceEEEEECCCCCeEEEEEee
Q psy3487         174 AWKAWQDLAVHSKFRGKYIQVTPAGRFNLVFTKSNQHYTWNRVQSTVHNVIVGNLWVDQHGESDVINVTTGSTCRLTFYP  253 (538)
Q Consensus       174 g~~~~g~~~~~~kF~g~sv~i~~~G~~~i~f~~~~e~y~~~~p~~~v~~li~G~~~~e~~G~~~i~~~~tg~~~~l~f~~  253 (538)
                      +|.++|+..++++|.| ++.+.+.|..++.|...+|+|+|++|++.++||++|++|+|+.|.+.|.| +||+.|.|+|.+
T Consensus       157 ~~~~~g~~~~~~~f~~-s~~i~~~g~~~~~l~~~~E~Y~~~~P~~~i~gii~G~~~vE~~G~~~I~~-~tg~~a~i~f~~  234 (433)
T d1zhxa1         157 KVKLQGYNQIKASFTK-SLMLTVKQFGHTMLDIKDESYLVTPPPLHIEGILVASPFVELEGKSYIQS-STGLLCVIEFSG  234 (433)
T ss_dssp             TEEEEEEEEEEEEECT-TCCEEEEEECCEEEEETTEEEEEECCCEEEECTTTTCCEEEECSEEEEEE-TTSCEEEEEEEC
T ss_pred             CEEEEEEeeeeeeecc-eEEEEEcceEEEEEEecCcEEEEecCCEEEEEEEcCCceEEecceEEEEe-CCCCEEEEEEcC
Confidence            7999999999999965 55666666666666668999999999999999999999999999999988 789999999999


Q ss_pred             eeeccCCceeeeeccC---CCC-----CeeeeeCCCCCCCcceeeeeeccCCCCCCCCCCCCCCCCCcccchhccccccc
Q psy3487         254 YSYFSRQTQRRVLPWK---PNT-----PRRSIIPEKPPGSMQIWSILKNSIGKDLSTIPMPLNFSEPLSMLQRLTEDFEY  325 (538)
Q Consensus       254 ~~~fs~~~~~~v~G~v---~g~-----~~~~~l~G~W~~~i~lw~i~k~~iGkdls~i~~Pv~~~ep~s~Lqr~~e~~ey  325 (538)
                      +|+|+++ .+.|+|.|   ++.     ...++|.|.|++.+.++..-.                                
T Consensus       235 kg~fsg~-~~~v~g~I~~~~~~~~~~~~~l~~i~G~W~~~~~~~~~~~--------------------------------  281 (433)
T d1zhxa1         235 RGYFSGK-KNSFKARIYKDSKDSKDKEKALYTISGQWSGSSKIIKANK--------------------------------  281 (433)
T ss_dssp             SSSSCSS-SSEEEEEEESSTTGGGCGGGCSEEEEEETTSEEEEEETTC--------------------------------
T ss_pred             CCccCCC-cceEEEEEEeCCCCCccccceeEEEecccCceEEEEeCCC--------------------------------
Confidence            9999987 48999999   221     233999999999988754310                                


Q ss_pred             hhHHHhhhcCCCCCCccceEEEeeeeecccccc---C-CCCCCCCcCCCCCeEEeeeeccccccee
Q psy3487         326 AHVLDEAAATDDVFRAPQYYCFTKFACQLNELE---E-GVAPTDSRLRPDQRLLEVSHHPPIAAQY  387 (538)
Q Consensus       326 ~~ll~~a~~~~d~~~~~r~~~~~~fa~~l~e~~---~-~~~ptd~r~r~d~r~~e~~hhpp~~a~~  387 (538)
                               ..   ....+|.++.++..++++.   + ...|++.++|||++++|.|+.+.|+..+
T Consensus       282 ---------~~---~~~~~~d~~~~~~~~~~~~p~e~~~p~eS~~~wr~d~~ale~Gd~d~A~~eK  335 (433)
T d1zhxa1         282 ---------KE---ESRLFYDAARIPAEHLNVKPLEEQHPLESRKAWYDVAGAIKLGDFNLIAKTK  335 (433)
T ss_dssp             ---------GG---GCEEEEETTTSCCCCCBCCCGGGCCTTBHHHHTHHHHHHHHHTCHHHHHHHH
T ss_pred             ---------CC---cceEEEeCCcCCcccccCCCcccCCCCCCccccHHHHHHHHCCCHHHHHHHH
Confidence                     00   1122333333444433332   2 2234566789999999999999998764
>d1zhxa1 d.338.1.1 (A:2-434) Oxysterol-binding protein homolog 4, KES1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Back     information, alignment and structure
>d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adza1 b.55.1.1 (A:1-43,A:117-178) Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2zkmx3 b.55.1.1 (X:11-141) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure