Psyllid ID: psy3532

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240--
MDLDEGALKLTDPENLTVLNTQPIHTIRVWGVGRDNGRDFAYVARDRSTRRHMCHVFRCDMPARTIANTLRDICKKIMIERSLQANQLAKPVLGGEGGRGGAVRPTNLPTERPQSFPTPMEEPKKILRAQYLGSIQVSKPGGMDILNNAIDTLVSTVPQHLWQDVNIAVAPSMITIHSTDEETGGTLMAECRVRFLSFLGIGHNVKQCAFIMHTAQDLFIAHVFVTEPSSGALCKTIEAACK
cccccccccEEccccccEEEEEEccEEEEEEEEcccccccEEEEEccccccEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEccccccccHHHHHHHHHHHccccccccccEEEEEcccEEEEEEEccccccEEEccEEEEEEEEEEccccccEEEEEEEccccEEEEEEEEEccccHHHHHHHHHHHc
ccccccccEEEccccccEEEcccEEEEEEEEEcccccccEEEEEEcccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccEEEEEEEEccccccccHHHHHHHHHHHHHHcccccccccEEEEEEcccEEEEEcccccccccEEEEEEEEEEEEEcccccccEEEEEEEcccccEEEEEEEEcccHHHHHHHHHHHcc
mdldegalkltdpenltvlntqpihtirvwgvgrdngrdfAYVArdrstrrhmchvfrcdmparTIANTLRDICKKIMIERSLQANqlakpvlggeggrggavrptnlpterpqsfptpmeepKKILRAQYLgsiqvskpggmdiLNNAIDTLVSTvpqhlwqdvniavapsmitihstdeetggtlMAECRVRFLSFLGIGHNVKQCAFIMHTAQDLFIAHVfvtepssgalCKTIEAACK
mdldegalkltdpenltvlntqpihtirvwgvgrdngRDFAYVardrstrrhmchvfrcdmpartIANTLRDICKKIMIERSLQANQLAkpvlggeggrggavrptnlpterpqsfptpmeEPKKILRAQYLGSIQVSKPGGMDILNNAIDTLVSTVPQHLWQDVNIAVAPSMITIHSTDEETGGTLMAECRVRFLSFLGIGHNVKQCAFIMHTAQDLFIAHVFVTEPSSGALCKTIEAACK
MDLDEGALKLTDPENLTVLNTQPIHTIRVWGVGRDNGRDFAYVARDRSTRRHMCHVFRCDMPARTIANTLRDICKKIMIERSLQANQLAKPVLggeggrggAVRPTNLPTERPQSFPTPMEEPKKILRAQYLGSIQVSKPGGMDILNNAIDTLVSTVPQHLWQDVNIAVAPSMITIHSTDEETGGTLMAECRVRFLSFLGIGHNVKQCAFIMHTAQDLFIAHVFVTEPSSGALCKTIEAACK
**************NLTVLNTQPIHTIRVWGVGRDNGRDFAYVARDRSTRRHMCHVFRCDMPARTIANTLRDICKKIMIERSLQANQL*************************************ILRAQYLGSIQVSKPGGMDILNNAIDTLVSTVPQHLWQDVNIAVAPSMITIHSTDEETGGTLMAECRVRFLSFLGIGHNVKQCAFIMHTAQDLFIAHVFVTEPSSGALCKTI*****
*DLDEGALKLTDPENLTVLNTQPIHTIRVWGVGRDNGRDFAYVARDRSTRRHMCHVFRCDMPARTIANTLRDICK******************************************TPMEEPKKILRAQYLGSIQVSKPGGMDILNNAIDTLV******LWQDVNIAVAPSMITIHSTDEETGGTLMAECRVRFLSFLGIGHNVKQCAFIMHTAQDLFIAHVFVTEPSSGALCKTIEAACK
MDLDEGALKLTDPENLTVLNTQPIHTIRVWGVGRDNGRDFAYVARDRSTRRHMCHVFRCDMPARTIANTLRDICKKIMIERSLQANQLAKPVLGGEGGRGGAVRPTNLPTERPQSFPTPMEEPKKILRAQYLGSIQVSKPGGMDILNNAIDTLVSTVPQHLWQDVNIAVAPSMITIHSTDEETGGTLMAECRVRFLSFLGIGHNVKQCAFIMHTAQDLFIAHVFVTEPSSGALCKTIEAACK
*DL*EGALKLTDPENLTVLNTQPIHTIRVWGVGRDNGRDFAYVARDRSTRRHMCHVFRCDMPARTIANTLRDICKKIMIERSLQA*********************NLPTERPQSFPTPMEEPKKILRAQYLGSIQVSKPGGMDILNNAIDTLVSTVPQHLWQDVNIAVAPSMITIHSTDEETGGTLMAECRVRFLSFLGIGHNVKQCAFIMHTAQDLFIAHVFVTEPSSGALCKTIEAACK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDLDEGALKLTDPENLTVLNTQPIHTIRVWGVGRDNGRDFAYVARDRSTRRHMCHVFRCDMPARTIANTLRDICKKIMIERSLQANQLAKPVLGGEGGRGGAVRPTNLPTERPQSFPTPMEEPKKILRAQYLGSIQVSKPGGMDILNNAIDTLVSTVPQHLWQDVNIAVAPSMITIHSTDEETGGTLMAECRVRFLSFLGIGHNVKQCAFIMHTAQDLFIAHVFVTEPSSGALCKTIEAACK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query242 2.2.26 [Sep-21-2011]
Q92870758 Amyloid beta A4 precursor yes N/A 0.946 0.302 0.472 2e-54
Q9DBR4760 Amyloid beta A4 precursor yes N/A 0.946 0.301 0.457 6e-52
Q9QXJ1710 Amyloid beta A4 precursor no N/A 0.946 0.322 0.407 6e-48
P46933711 Amyloid beta A4 precursor no N/A 0.946 0.322 0.407 8e-48
O00213710 Amyloid beta A4 precursor no N/A 0.946 0.322 0.399 1e-46
O35827504 Amyloid beta A4 precursor no N/A 0.933 0.448 0.326 1e-32
Q8R1C9486 Amyloid beta A4 precursor no N/A 0.933 0.465 0.318 2e-31
O95704486 Amyloid beta A4 precursor no N/A 0.933 0.465 0.318 2e-30
>sp|Q92870|APBB2_HUMAN Amyloid beta A4 precursor protein-binding family B member 2 OS=Homo sapiens GN=APBB2 PE=1 SV=3 Back     alignment and function desciption
 Score =  212 bits (539), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 113/239 (47%), Positives = 147/239 (61%), Gaps = 10/239 (4%)

Query: 3   LDEGALKLTDPENLTVLNTQPIHTIRVWGVGRDNGRDFAYVARDRSTRRHMCHVFRCDMP 62
           L+   L L DP + +VL++QPI +IRVWGVGRDNGRDFAYVARD+ TR   CHVFRCD P
Sbjct: 474 LENDMLSLVDPMDRSVLHSQPIVSIRVWGVGRDNGRDFAYVARDKDTRILKCHVFRCDTP 533

Query: 63  ARTIANTLRDICKKIMIERSLQANQLAKPVLGGEGGRGGAVRPTNLPTERPQSFPTPMEE 122
           A+ IA +L +IC KIM ER   A  LA   L             NL       FPTP  E
Sbjct: 534 AKAIATSLHEICSKIMAERK-NAKALACSSLQERAN-------VNLDVPLQVDFPTPKTE 585

Query: 123 PKKILRAQYLGSIQVSKPGGMDILNNAIDTLVSTVPQHLWQDVNIAVAPSMITIHSTDEE 182
             +    QYLG + V KP GMDILN+AI+ L+++  +  W  VN+ VA + +T+ S  E+
Sbjct: 586 LVQKFHVQYLGMLPVDKPVGMDILNSAIENLMTSSNKEDWLSVNMNVADATVTVIS--EK 643

Query: 183 TGGTLMAECRVRFLSFLGIGHNVKQCAFIMHTAQDLFIAHVFVTEPSSGALCKTIEAAC 241
               ++ ECRVRFLSF+G+G +V   AFIM T    F  HVF  EP++G + + ++AAC
Sbjct: 644 NEEEVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAGNVSEAVQAAC 702
May modulate the internalization of beta-amyloid precursor protein.
Homo sapiens (taxid: 9606)
>sp|Q9DBR4|APBB2_MOUSE Amyloid beta A4 precursor protein-binding family B member 2 OS=Mus musculus GN=Apbb2 PE=1 SV=2 Back     alignment and function description
>sp|Q9QXJ1|APBB1_MOUSE Amyloid beta A4 precursor protein-binding family B member 1 OS=Mus musculus GN=Apbb1 PE=1 SV=3 Back     alignment and function description
>sp|P46933|APBB1_RAT Amyloid beta A4 precursor protein-binding family B member 1 OS=Rattus norvegicus GN=Apbb1 PE=1 SV=3 Back     alignment and function description
>sp|O00213|APBB1_HUMAN Amyloid beta A4 precursor protein-binding family B member 1 OS=Homo sapiens GN=APBB1 PE=1 SV=2 Back     alignment and function description
>sp|O35827|APBB3_RAT Amyloid beta A4 precursor protein-binding family B member 3 OS=Rattus norvegicus GN=Apbb3 PE=2 SV=1 Back     alignment and function description
>sp|Q8R1C9|APBB3_MOUSE Amyloid beta A4 precursor protein-binding family B member 3 OS=Mus musculus GN=Apbb3 PE=2 SV=1 Back     alignment and function description
>sp|O95704|APBB3_HUMAN Amyloid beta A4 precursor protein-binding family B member 3 OS=Homo sapiens GN=APBB3 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query242
270006137 669 hypothetical protein TcasGA2_TC008304 [T 0.975 0.352 0.747 1e-103
345485884 784 PREDICTED: amyloid beta A4 precursor pro 0.979 0.302 0.737 1e-101
383853419 777 PREDICTED: amyloid beta A4 precursor pro 0.979 0.305 0.737 1e-100
307197740 531 Amyloid beta A4 precursor protein-bindin 0.979 0.446 0.731 1e-100
340710569 638 PREDICTED: amyloid beta A4 precursor pro 0.979 0.371 0.733 1e-99
328789665 776 PREDICTED: amyloid beta A4 precursor pro 0.979 0.305 0.733 1e-99
350396513 776 PREDICTED: amyloid beta A4 precursor pro 0.979 0.305 0.733 2e-99
340710571 779 PREDICTED: amyloid beta A4 precursor pro 0.979 0.304 0.733 2e-99
242006821 646 predicted protein [Pediculus humanus cor 0.983 0.368 0.738 4e-99
332024801 580 Amyloid beta A4 precursor protein-bindin 0.979 0.408 0.723 6e-99
>gi|270006137|gb|EFA02585.1| hypothetical protein TcasGA2_TC008304 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 189/253 (74%), Positives = 206/253 (81%), Gaps = 17/253 (6%)

Query: 1   MDLDEGALKLTDPENLTVLNTQPIHTIRVWGVGRDNGRDFAYVARDRSTRRHMCHVFRCD 60
           MDLDEGALKL DPENLTVLNTQPIHTIRVWGVGRDNGRDFAYVARDRSTR+HMCHVFRCD
Sbjct: 374 MDLDEGALKLIDPENLTVLNTQPIHTIRVWGVGRDNGRDFAYVARDRSTRKHMCHVFRCD 433

Query: 61  MPARTIANTLRDICKKIMIERSLQANQLAKPVLGGEGGRGGAVRPTNLPTER-------- 112
           MPARTIANTLRDICKKIMIERSLQ N LAKP+     GR  A RPTNLPTE         
Sbjct: 434 MPARTIANTLRDICKKIMIERSLQQN-LAKPI--DINGRTLATRPTNLPTEHRRLTRNGQ 490

Query: 113 ---PQSFPTPMEEPKKILRAQYLGSIQVSKPGGMDILNNAIDTLVSTVPQHLWQDVNIAV 169
               QSFPTPMEEPKK+LRAQYLG+ QVS+  GM++LN AID LV+TVP   WQ VN+AV
Sbjct: 491 SLVTQSFPTPMEEPKKVLRAQYLGTTQVSQATGMEVLNEAIDRLVATVPPEQWQCVNVAV 550

Query: 170 APSMITIHSTDEETGGTLMAECRVRFLSFLGIGHNVKQCAFIMHTAQDLFIAHVFVTEPS 229
           APSMI+I    ++    L+AECRVR+LSFLGIG  +K CAF+MHTAQD F+AHVF  EPS
Sbjct: 551 APSMISIQCPSDD---RLIAECRVRYLSFLGIGKIIKHCAFVMHTAQDTFVAHVFYCEPS 607

Query: 230 SGALCKTIEAACK 242
           SGALCKTIEAACK
Sbjct: 608 SGALCKTIEAACK 620

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|345485884|ref|XP_001603939.2| PREDICTED: amyloid beta A4 precursor protein-binding family B member 2-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383853419|ref|XP_003702220.1| PREDICTED: amyloid beta A4 precursor protein-binding family B member 2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307197740|gb|EFN78889.1| Amyloid beta A4 precursor protein-binding family B member 2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|340710569|ref|XP_003393860.1| PREDICTED: amyloid beta A4 precursor protein-binding family B member 2-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|328789665|ref|XP_394328.4| PREDICTED: amyloid beta A4 precursor protein-binding family B member 2-like [Apis mellifera] Back     alignment and taxonomy information
>gi|350396513|ref|XP_003484579.1| PREDICTED: amyloid beta A4 precursor protein-binding family B member 2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340710571|ref|XP_003393861.1| PREDICTED: amyloid beta A4 precursor protein-binding family B member 2-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|242006821|ref|XP_002424243.1| predicted protein [Pediculus humanus corporis] gi|212507612|gb|EEB11505.1| predicted protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|332024801|gb|EGI64989.1| Amyloid beta A4 precursor protein-binding family B member 2 [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query242
UNIPROTKB|E2QZC4739 APBB2 "Uncharacterized protein 0.938 0.307 0.481 6.5e-51
UNIPROTKB|I3LJX4759 APBB2 "Uncharacterized protein 0.942 0.300 0.479 2.4e-50
UNIPROTKB|Q92870758 APBB2 "Amyloid beta A4 precurs 0.946 0.302 0.472 5.4e-50
UNIPROTKB|E2R1T9762 APBB2 "Uncharacterized protein 0.938 0.297 0.477 1.7e-49
UNIPROTKB|F1MDE6758 APBB2 "Uncharacterized protein 0.942 0.300 0.468 1.3e-48
UNIPROTKB|F1NND3686 APBB2 "Uncharacterized protein 0.946 0.333 0.464 3.7e-48
MGI|MGI:108405760 Apbb2 "amyloid beta (A4) precu 0.946 0.301 0.457 8.6e-48
RGD|1562438638 Apbb2 "amyloid beta (A4) precu 0.938 0.355 0.452 1.2e-47
UNIPROTKB|Q17QV1707 APBB1 "Uncharacterized protein 0.942 0.322 0.409 3.8e-45
UNIPROTKB|F1RMN5709 APBB1 "Uncharacterized protein 0.942 0.321 0.404 1.5e-44
UNIPROTKB|E2QZC4 APBB2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 529 (191.3 bits), Expect = 6.5e-51, P = 6.5e-51
 Identities = 116/241 (48%), Positives = 148/241 (61%)

Query:     3 LDEGALKLTDPENLTVLNTQPIHTIRVWGVGRDNGRDFAYVARDRSTRRHMCHVFRCDMP 62
             L+   L L DP + +VL++QPI +IRVWGVGRDNGRDFAYVARD+ TR   CHVFRCD P
Sbjct:   455 LENDTLSLVDPMDRSVLHSQPIASIRVWGVGRDNGRDFAYVARDKDTRILKCHVFRCDTP 514

Query:    63 ARTIANTLRDICKKIMIERSLQANQLAKPVLXXXXXXXXAVRPTNLPTERPQSFPTPMEE 122
             A+ IA +L +IC KIM ER   A  LA   L             NL       FPTP  E
Sbjct:   515 AKAIATSLHEICSKIMAERK-NAKALACSSLQERTN-------VNLDVPLQVDFPTPKTE 566

Query:   123 PKKILRAQYLGSIQVSKPGGMDILNNAIDTLVSTVPQHLWQDVNIAVAPSMITIHS--TD 180
               +    QYLG + V KP GMD LNNAI++L+++  Q  W  VN+ VA + +T+ S   +
Sbjct:   567 LVQKFHVQYLGMLPVDKPVGMDTLNNAIESLMTSSNQEDWLSVNMNVADATVTVISEKNE 626

Query:   181 EETGGTLMAECRVRFLSFLGIGHNVKQCAFIMHTAQDLFIAHVFVTEPSSGALCKTIEAA 240
             EET    + ECRVRFLSF+G+G +V   AFIM T    F  HVF  EP++G + + ++AA
Sbjct:   627 EET----LVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAGNVSEAVQAA 682

Query:   241 C 241
             C
Sbjct:   683 C 683
GO:0045749 "negative regulation of S phase of mitotic cell cycle" evidence=IEA
GO:0043066 "negative regulation of apoptotic process" evidence=IEA
GO:0043065 "positive regulation of apoptotic process" evidence=IEA
GO:0030308 "negative regulation of cell growth" evidence=IEA
GO:0030198 "extracellular matrix organization" evidence=IEA
GO:0008134 "transcription factor binding" evidence=IEA
GO:0007411 "axon guidance" evidence=IEA
GO:0007050 "cell cycle arrest" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0001764 "neuron migration" evidence=IEA
UNIPROTKB|I3LJX4 APBB2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q92870 APBB2 "Amyloid beta A4 precursor protein-binding family B member 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2R1T9 APBB2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MDE6 APBB2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NND3 APBB2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:108405 Apbb2 "amyloid beta (A4) precursor protein-binding, family B, member 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1562438 Apbb2 "amyloid beta (A4) precursor protein-binding, family B, member 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q17QV1 APBB1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RMN5 APBB1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query242
cd01271127 cd01271, PTB2_Fe65, Fe65 C-terminal Phosphotyrosin 6e-60
cd01272138 cd01272, PTB1_Fe65, Fe65 N-terminal Phosphotyrosin 4e-55
smart00462134 smart00462, PTB, Phosphotyrosine-binding domain, p 1e-20
pfam00640133 pfam00640, PID, Phosphotyrosine interaction domain 4e-20
pfam00640133 pfam00640, PID, Phosphotyrosine interaction domain 5e-17
smart00462134 smart00462, PTB, Phosphotyrosine-binding domain, p 6e-17
cd00934119 cd00934, PTB, Phosphotyrosine-binding (PTB) PH-lik 3e-13
cd00934119 cd00934, PTB, Phosphotyrosine-binding (PTB) PH-lik 3e-08
cd13161120 cd13161, PTB_TK_HMTK, Tyrosine-specific kinase/HM- 4e-06
cd01211131 cd01211, PTB_Rab6GAP, GTPase activating protein fo 2e-05
cd01274146 cd01274, PTB_Anks, Ankyrin repeat and sterile alph 6e-05
cd13161120 cd13161, PTB_TK_HMTK, Tyrosine-specific kinase/HM- 1e-04
cd01273144 cd01273, PTB_CED-6, Cell death protein 6 homolog ( 2e-04
cd01268135 cd01268, PTB_Numb, Numb Phosphotyrosine-binding (P 8e-04
cd13159123 cd13159, PTB_LDLRAP-mammal-like, Low Density Lipop 0.002
>gnl|CDD|241301 cd01271, PTB2_Fe65, Fe65 C-terminal Phosphotyrosine-binding (PTB) domain Back     alignment and domain information 
 Score =  184 bits (470), Expect = 6e-60
 Identities = 65/124 (52%), Positives = 83/124 (66%), Gaps = 2/124 (1%)

Query: 119 PMEEPKKILRAQYLGSIQVSKPGGMDILNNAIDTLVSTVPQHLWQDVNIAVAPSMITIHS 178
           P  EP K   A YLGS  VSKP GMD+LN AI+ L+S+VP+  W  VN++VAPS +T+ S
Sbjct: 1   PKTEPVKKFEALYLGSTPVSKPTGMDVLNEAIEQLLSSVPKEDWTPVNVSVAPSTVTVLS 60

Query: 179 TDEETGGTLMAECRVRFLSFLGIGHNVKQCAFIMHTAQDLFIAHVFVTEPSSGALCKTIE 238
             +E    ++ ECRVRFLSFLGIG +V   AFIM T    F  HVF  EP++GAL + ++
Sbjct: 61  QKDE--EEVLVECRVRFLSFLGIGKDVHTFAFIMDTGPQRFQCHVFWCEPNAGALSEAVQ 118

Query: 239 AACK 242
           AAC 
Sbjct: 119 AACM 122

The neuronal adaptor protein Fe65 is involved in brain development, Alzheimer disease amyloid precursor protein (APP) signaling, and proteolytic processing of APP. It contains three protein-protein interaction domains, one WW domain, and a unique tandem array of phosphotyrosine-binding (PTB) domains. The C-terminal PTB domain is responsible for APP binding. PTB domains have a common PH-like fold and are found in various eukaryotic signaling molecules. This domain was initially shown to binds peptides with a NPXY motif with differing requirements for phosphorylation of the tyrosine, although more recent studies have found that some types of PTB domains can bind to peptides lack tyrosine residues altogether. In contrast to SH2 domains, which recognize phosphotyrosine and adjacent carboxy-terminal residues, PTB-domain binding specificity is conferred by residues amino-terminal to the phosphotyrosine. PTB domains are classified into three groups: phosphotyrosine-dependent Shc-like, phosphotyrosine-dependent IRS-like, and phosphotyrosine-independent Dab-like PTB domains. This cd is part of the Dab-like subgroup. Length = 127
>gnl|CDD|241302 cd01272, PTB1_Fe65, Fe65 N-terminal Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>gnl|CDD|214675 smart00462, PTB, Phosphotyrosine-binding domain, phosphotyrosine-interaction (PI) domain Back     alignment and domain information
>gnl|CDD|144292 pfam00640, PID, Phosphotyrosine interaction domain (PTB/PID) Back     alignment and domain information
>gnl|CDD|144292 pfam00640, PID, Phosphotyrosine interaction domain (PTB/PID) Back     alignment and domain information
>gnl|CDD|214675 smart00462, PTB, Phosphotyrosine-binding domain, phosphotyrosine-interaction (PI) domain Back     alignment and domain information
>gnl|CDD|241236 cd00934, PTB, Phosphotyrosine-binding (PTB) PH-like fold Back     alignment and domain information
>gnl|CDD|241236 cd00934, PTB, Phosphotyrosine-binding (PTB) PH-like fold Back     alignment and domain information
>gnl|CDD|241315 cd13161, PTB_TK_HMTK, Tyrosine-specific kinase/HM-motif TK (TM/HMTK) Phosphotyrosine-binding (PTB) PH-like fold Back     alignment and domain information
>gnl|CDD|241247 cd01211, PTB_Rab6GAP, GTPase activating protein for Rab 6 Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>gnl|CDD|241304 cd01274, PTB_Anks, Ankyrin repeat and sterile alpha motif (SAM) domain-containing (Anks) protein family Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>gnl|CDD|241315 cd13161, PTB_TK_HMTK, Tyrosine-specific kinase/HM-motif TK (TM/HMTK) Phosphotyrosine-binding (PTB) PH-like fold Back     alignment and domain information
>gnl|CDD|241303 cd01273, PTB_CED-6, Cell death protein 6 homolog (CED-6/GULP1) Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>gnl|CDD|241298 cd01268, PTB_Numb, Numb Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>gnl|CDD|241313 cd13159, PTB_LDLRAP-mammal-like, Low Density Lipoprotein Receptor Adaptor Protein 1 (LDLRAP1) in mammals and similar proteins Phosphotyrosine-binding (PTB) PH-like fold Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 242
cd01271124 Fe65_C Fe65 C-terminal Phosphotyrosine-binding (PT 100.0
cd01216123 Fe65 Fe65 Phosphotyrosine-binding (PTB) domain, ph 100.0
cd01272138 FE65_N Fe65 Phosphotyrosine-binding (PTB) domain. 100.0
cd01268138 Numb Numb Phosphotyrosine-binding (PTB) domain. Nu 99.97
cd01212148 JIP JNK-interacting protein (JIP) Phosphotyrosine- 99.96
cd01267132 CED6_AIDA1b Phosphotyrosine-binding (PTB) domain, 99.96
cd01274127 AIDA-1b AIDA-1b Phosphotyrosine-binding (PTB) doma 99.96
smart00462134 PTB Phosphotyrosine-binding domain, phosphotyrosin 99.96
cd01273142 CED-6 CED-6 Phosphotyrosine-binding (PTB) domain. 99.95
PF00640140 PID: Phosphotyrosine interaction domain (PTB/PID) 99.95
cd00934123 PTB Phosphotyrosine-binding (PTB) domain. Phosphot 99.94
cd01270140 DYC-1 DYC-1 (DYB-1 binding and Capon related) Phos 99.92
cd01215139 Dab Disabled (Dab) Phosphotyrosine-binding domain. 99.89
cd01211125 GAPCenA GAPCenA Phosphotyrosine-binding (PTB) doma 99.88
cd01216123 Fe65 Fe65 Phosphotyrosine-binding (PTB) domain, ph 99.87
cd01214133 CG8312 CG8312 Phosphotyrosine-binding (PTB) domain 99.85
KOG3775|consensus482 99.84
KOG3536|consensus 321 99.76
cd01209160 SHC SHC phosphotyrosine-binding (PTB) domain. SHC 99.76
KOG3537|consensus 543 99.75
cd01208156 X11 X11 Phosphotyrosine-binding (PTB) domain. X11 99.71
cd01268138 Numb Numb Phosphotyrosine-binding (PTB) domain. Nu 99.69
cd01211125 GAPCenA GAPCenA Phosphotyrosine-binding (PTB) doma 99.68
PF14719182 PID_2: Phosphotyrosine interaction domain (PTB/PID 99.66
cd01213138 tensin Tensin Phosphotyrosine-binding (PTB) domain 99.65
cd01267132 CED6_AIDA1b Phosphotyrosine-binding (PTB) domain, 99.64
cd01272138 FE65_N Fe65 Phosphotyrosine-binding (PTB) domain. 99.57
cd00934123 PTB Phosphotyrosine-binding (PTB) domain. Phosphot 99.55
smart00462134 PTB Phosphotyrosine-binding domain, phosphotyrosin 99.54
cd01274127 AIDA-1b AIDA-1b Phosphotyrosine-binding (PTB) doma 99.53
cd01269129 PLX Pollux (PLX) Phosphotyrosine-binding (PTB) dom 99.52
PF00640140 PID: Phosphotyrosine interaction domain (PTB/PID) 99.47
cd01273142 CED-6 CED-6 Phosphotyrosine-binding (PTB) domain. 99.44
cd01212148 JIP JNK-interacting protein (JIP) Phosphotyrosine- 99.42
KOG3537|consensus 543 99.42
cd01270140 DYC-1 DYC-1 (DYB-1 binding and Capon related) Phos 99.38
PF08416131 PTB: Phosphotyrosine-binding domain; InterPro: IPR 99.28
cd01271124 Fe65_C Fe65 C-terminal Phosphotyrosine-binding (PT 99.27
cd01215139 Dab Disabled (Dab) Phosphotyrosine-binding domain. 99.12
cd01269129 PLX Pollux (PLX) Phosphotyrosine-binding (PTB) dom 99.03
cd01209160 SHC SHC phosphotyrosine-binding (PTB) domain. SHC 98.77
KOG3535|consensus 557 98.65
cd01208156 X11 X11 Phosphotyrosine-binding (PTB) domain. X11 98.63
cd01214133 CG8312 CG8312 Phosphotyrosine-binding (PTB) domain 98.62
cd01217158 CG12581 CG12581 Phosphotyrosine-binding (PTB) doma 98.56
PF08416131 PTB: Phosphotyrosine-binding domain; InterPro: IPR 98.47
PF14719182 PID_2: Phosphotyrosine interaction domain (PTB/PID 98.43
cd01213138 tensin Tensin Phosphotyrosine-binding (PTB) domain 98.42
KOG1930|consensus483 98.41
KOG3536|consensus321 98.35
PF10480200 ICAP-1_inte_bdg: Beta-1 integrin binding protein; 98.2
KOG3605|consensus 829 97.54
KOG3697|consensus 345 97.25
KOG4448|consensus 374 97.15
cd01210127 EPS8 Epidermal growth factor receptor kinase subst 97.13
KOG3535|consensus 557 96.86
cd01210127 EPS8 Epidermal growth factor receptor kinase subst 96.08
PF10480200 ICAP-1_inte_bdg: Beta-1 integrin binding protein; 95.56
cd01217158 CG12581 CG12581 Phosphotyrosine-binding (PTB) doma 95.48
cd0090099 PH-like Pleckstrin homology-like domain. Pleckstri 95.42
cd0090099 PH-like Pleckstrin homology-like domain. Pleckstri 95.4
KOG1930|consensus483 93.8
KOG3775|consensus482 93.19
KOG4458|consensus78 91.6
KOG3557|consensus 721 91.3
PF02174100 IRS: PTB domain (IRS-1 type); InterPro: IPR002404 90.19
KOG3697|consensus345 89.77
cd00824104 PTBI IRS-like phosphotyrosine-binding domain. IRS- 81.63
>cd01271 Fe65_C Fe65 C-terminal Phosphotyrosine-binding (PTB) domain Back     alignment and domain information 
Probab=100.00  E-value=2.1e-51  Score=331.07  Aligned_cols=117  Identities=53%  Similarity=0.918  Sum_probs=112.5

Q ss_pred             ceeEEEEeeeeeEecCCchhhHHHHHHHHHHhcCCCCCceeeEEEEcCCeEEEEecCCCcCceeeeeEEEEEEEeeecCC
Q psy3532         124 KKILRAQYLGSIQVSKPGGMDILNNAIDTLVSTVPQHLWQDVNIAVAPSMITIHSTDEETGGTLMAECRVRFLSFLGIGH  203 (242)
Q Consensus       124 ~~~f~vkyLGsv~V~~~~G~dVln~Ai~~i~~~~~~~~w~pv~l~Vs~~~i~i~~~~~~~~~e~l~ec~vr~iSF~gvgk  203 (242)
                      +|+|+++|||+|||++|+||||||+||++|++++++++|.||+++|+|++|+|++.+++  +++++|||||||||||+||
T Consensus         1 ~~~f~~~yLG~~~V~~p~Gmdvln~AI~~l~~~~~~~~w~~V~vsvaps~v~v~~~~~~--~~~l~ecrVr~lSF~GvgK   78 (124)
T cd01271           1 VKVFRVQYLGMLPVDKPTGMEILNSAIDNLMSSSNKEDWLSVNVNVAPSTITVISEKNE--EEVLVECRVRYLSFLGIGK   78 (124)
T ss_pred             CcEEEEEEeccEeecCCccHHHHHHHHHHHHhcCCcccCceEEEEeCCceEEEEccCcc--ceeeeeeeEEEeccccCCC
Confidence            47899999999999999999999999999999999999999999999999999987753  3899999999999999999


Q ss_pred             CCceEEEEEeCCCCceEEEEEEcCCCchHHHHHHHHHhC
Q psy3532         204 NVKQCAFIMHTAQDLFIAHVFVTEPSSGALCKTIEAACK  242 (242)
Q Consensus       204 d~k~FafI~~~~~~~f~CHVF~ce~~A~~lseaV~aAc~  242 (242)
                      |.|+||||||+++++|+||||||||+|++|||||||||+
T Consensus        79 d~k~fafI~~~~~~~f~ChVF~ce~~A~~ls~av~aAc~  117 (124)
T cd01271          79 DVHTCAFIMDTGNQRFECHVFWCEPNAGNVSKAVEAACK  117 (124)
T ss_pred             CccEEEEEEecCCCcEEEEEEEecCChHHHHHHHHHHHH
Confidence            999999999999999999999999999999999999996

Fe65 C-terminal Phosphotyrosine-binding (PTB) domain. Fe65 is an amyloid beta A4 precursor (APP) protein-binding. It contains an N-terminal WW domain followed by two PTB domains. The C-terminal PTB domain is responsible for APP binding. PTB domains have a PH-like fold and are found in various eukaryotic signaling molecules. They were initially identified based upon their ability to recognize phosphorylated tyrosine residues In contrast to SH2 domains, which recognize phosphotyrosine and adjacent carboxy-terminal residues, PTB-domain binding specificity is conferred by residues amino-terminal to the phosphotyrosine. More recent studies have found that some types of PTB domains can bind to peptides which are not tyrosine phosphorylated or lack tyrosine residues altogether.
>cd01216 Fe65 Fe65 Phosphotyrosine-binding (PTB) domain, phosphotyrosine-interaction (PI) domain Back     alignment and domain information
>cd01272 FE65_N Fe65 Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01268 Numb Numb Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01212 JIP JNK-interacting protein (JIP) Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01267 CED6_AIDA1b Phosphotyrosine-binding (PTB) domain, phosphotyrosine-interaction (PI) domain Back     alignment and domain information
>cd01274 AIDA-1b AIDA-1b Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>smart00462 PTB Phosphotyrosine-binding domain, phosphotyrosine-interaction (PI) domain Back     alignment and domain information
>cd01273 CED-6 CED-6 Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>PF00640 PID: Phosphotyrosine interaction domain (PTB/PID) A page on PI domains Back     alignment and domain information
>cd00934 PTB Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01270 DYC-1 DYC-1 (DYB-1 binding and Capon related) Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01215 Dab Disabled (Dab) Phosphotyrosine-binding domain Back     alignment and domain information
>cd01211 GAPCenA GAPCenA Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01216 Fe65 Fe65 Phosphotyrosine-binding (PTB) domain, phosphotyrosine-interaction (PI) domain Back     alignment and domain information
>cd01214 CG8312 CG8312 Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>KOG3775|consensus Back     alignment and domain information
>KOG3536|consensus Back     alignment and domain information
>cd01209 SHC SHC phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>KOG3537|consensus Back     alignment and domain information
>cd01208 X11 X11 Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01268 Numb Numb Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01211 GAPCenA GAPCenA Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>PF14719 PID_2: Phosphotyrosine interaction domain (PTB/PID) Back     alignment and domain information
>cd01213 tensin Tensin Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01267 CED6_AIDA1b Phosphotyrosine-binding (PTB) domain, phosphotyrosine-interaction (PI) domain Back     alignment and domain information
>cd01272 FE65_N Fe65 Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd00934 PTB Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>smart00462 PTB Phosphotyrosine-binding domain, phosphotyrosine-interaction (PI) domain Back     alignment and domain information
>cd01274 AIDA-1b AIDA-1b Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01269 PLX Pollux (PLX) Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>PF00640 PID: Phosphotyrosine interaction domain (PTB/PID) A page on PI domains Back     alignment and domain information
>cd01273 CED-6 CED-6 Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01212 JIP JNK-interacting protein (JIP) Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>KOG3537|consensus Back     alignment and domain information
>cd01270 DYC-1 DYC-1 (DYB-1 binding and Capon related) Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>PF08416 PTB: Phosphotyrosine-binding domain; InterPro: IPR013625 The phosphotyrosine-binding domain (PTB, also phosphotyrosine-interaction or PI domain) of tensin tends to be found at the C terminus of a protein Back     alignment and domain information
>cd01271 Fe65_C Fe65 C-terminal Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01215 Dab Disabled (Dab) Phosphotyrosine-binding domain Back     alignment and domain information
>cd01269 PLX Pollux (PLX) Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01209 SHC SHC phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>KOG3535|consensus Back     alignment and domain information
>cd01208 X11 X11 Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01214 CG8312 CG8312 Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01217 CG12581 CG12581 Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>PF08416 PTB: Phosphotyrosine-binding domain; InterPro: IPR013625 The phosphotyrosine-binding domain (PTB, also phosphotyrosine-interaction or PI domain) of tensin tends to be found at the C terminus of a protein Back     alignment and domain information
>PF14719 PID_2: Phosphotyrosine interaction domain (PTB/PID) Back     alignment and domain information
>cd01213 tensin Tensin Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>KOG1930|consensus Back     alignment and domain information
>KOG3536|consensus Back     alignment and domain information
>PF10480 ICAP-1_inte_bdg: Beta-1 integrin binding protein; InterPro: IPR019517 ICAP-1 is a serine/threonine-rich protein that binds to the cytoplasmic domains of beta-1 integrins in a highly specific manner, binding to a NPXY sequence motif on the beta-1 integrin Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>KOG3697|consensus Back     alignment and domain information
>KOG4448|consensus Back     alignment and domain information
>cd01210 EPS8 Epidermal growth factor receptor kinase substrate (EPS8) Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>KOG3535|consensus Back     alignment and domain information
>cd01210 EPS8 Epidermal growth factor receptor kinase substrate (EPS8) Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>PF10480 ICAP-1_inte_bdg: Beta-1 integrin binding protein; InterPro: IPR019517 ICAP-1 is a serine/threonine-rich protein that binds to the cytoplasmic domains of beta-1 integrins in a highly specific manner, binding to a NPXY sequence motif on the beta-1 integrin Back     alignment and domain information
>cd01217 CG12581 CG12581 Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd00900 PH-like Pleckstrin homology-like domain Back     alignment and domain information
>cd00900 PH-like Pleckstrin homology-like domain Back     alignment and domain information
>KOG1930|consensus Back     alignment and domain information
>KOG3775|consensus Back     alignment and domain information
>KOG4458|consensus Back     alignment and domain information
>KOG3557|consensus Back     alignment and domain information
>PF02174 IRS: PTB domain (IRS-1 type); InterPro: IPR002404 Insulin receptor substrate-1 proteins contain both a pleckstrin homology domain IPR001849 from INTERPRO and a phosphotyrosine binding (PTB) domain Back     alignment and domain information
>KOG3697|consensus Back     alignment and domain information
>cd00824 PTBI IRS-like phosphotyrosine-binding domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query242
2ysz_A185 Solution Structure Of The Chimera Of The C-Terminal 4e-24
1wgu_A136 Solution Structure Of The C-Terminal Phosphotyrosin 4e-24
2yt0_A176 Solution Structure Of The Chimera Of The C-Terminal 4e-24
2yt1_A185 Solution Structure Of The Chimera Of The C-Terminal 5e-24
3d8d_A148 Crystal Structure Of The Human Fe65-Ptb1 Domain Len 4e-22
3dxc_A140 Crystal Structure Of The Intracellular Domain Of Hu 2e-20
2dyq_A144 Crystal Structure Of The C-terminal Phophotyrosine 1e-11
>pdb|2YSZ|A Chain A, Solution Structure Of The Chimera Of The C-Terminal Pid Domain Of Fe65l And The C-Terminal Tail Peptide Of App Length = 185 Back     alignment and structure 
Iteration: 1

 Score =  108 bits (269), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 54/127 (42%), Positives = 78/127 (61%), Gaps = 2/127 (1%)
Query: 115 SFPTPMEEPKKILRAQYLGSIQVSKPGGMDILNNAIDTLVSTVPQHLWQDVNIAVAPSMI 174
           S PTP  E  +  R QYLG + V +P GMD LN+AI+ L+++  +  W  VN+ VA + +
Sbjct: 6   SGPTPKTELVQKFRVQYLGMLPVDRPVGMDTLNSAIENLMTSSSKEDWPSVNMNVADATV 65
Query: 175 TIHSTDEETGGTLMAECRVRFLSFLGIGHNVKQCAFIMHTAQDLFIAHVFVTEPSSGALC 234
           T+ S   E    ++ ECRVRFLSF+G+G +V   AFIM T    F  HVF  EP++  + 
Sbjct: 66  TVISEKNEE--EVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAANVS 123
Query: 235 KTIEAAC 241
           + ++AAC
Sbjct: 124 EAVQAAC 130
>pdb|1WGU|A Chain A, Solution Structure Of The C-Terminal Phosphotyrosine Interaction Domain Of Apbb2 From Mouse Length = 136 Back     alignment and structure
>pdb|2YT0|A Chain A, Solution Structure Of The Chimera Of The C-Terminal Tail Peptide Of App And The C-Terminal Pid Domain Of Fe65l Length = 176 Back     alignment and structure
>pdb|2YT1|A Chain A, Solution Structure Of The Chimera Of The C-Terminal Tail Peptide Of App And The C-Terminal Pid Domain Of Fe65l Length = 185 Back     alignment and structure
>pdb|3D8D|A Chain A, Crystal Structure Of The Human Fe65-Ptb1 Domain Length = 148 Back     alignment and structure
>pdb|3DXC|A Chain A, Crystal Structure Of The Intracellular Domain Of Human App In Complex With Fe65-Ptb2 Length = 140 Back     alignment and structure
>pdb|2DYQ|A Chain A, Crystal Structure Of The C-terminal Phophotyrosine Interaction Domain Of Human Apbb3 Length = 144 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query242
1wgu_A136 APBB2, amyloid beta (A4) precursor protein-bindin, 2e-50
1wgu_A136 APBB2, amyloid beta (A4) precursor protein-bindin, 2e-09
2dyq_A144 Amyloid beta A4 precursor protein-binding family 3 1e-48
2dyq_A144 Amyloid beta A4 precursor protein-binding family 3 8e-10
2yt0_A176 Amyloid beta A4 protein and amyloid beta A4 precur 4e-48
2yt0_A176 Amyloid beta A4 protein and amyloid beta A4 precur 6e-10
2ysz_A185 Amyloid beta A4 precursor protein-binding family B 7e-47
2ysz_A185 Amyloid beta A4 precursor protein-binding family B 7e-09
3dxe_A140 Amyloid beta A4 protein-binding family B member 1; 5e-44
3dxe_A140 Amyloid beta A4 protein-binding family B member 1; 2e-09
3d8d_A148 Amyloid beta A4 precursor protein-binding family 1 1e-39
3f0w_A168 NUMB-R, NUMB-like protein; PH domain-like, PID dom 4e-17
3f0w_A168 NUMB-R, NUMB-like protein; PH domain-like, PID dom 2e-12
2ej8_A160 DCC-interacting protein 13 alpha; structural genom 2e-16
2ej8_A160 DCC-interacting protein 13 alpha; structural genom 9e-12
2ela_A175 Adapter protein containing PH domain, PTB domain a 2e-15
2ela_A175 Adapter protein containing PH domain, PTB domain a 1e-10
3so6_A137 LDL receptor adaptor protein; PTB, endocytic adapt 2e-15
3so6_A137 LDL receptor adaptor protein; PTB, endocytic adapt 5e-14
1ntv_A152 Disabled homolog 1; beta-sandwich, signaling prote 5e-14
1ntv_A152 Disabled homolog 1; beta-sandwich, signaling prote 7e-11
1p3r_A160 Disabled homolog 2; PTB, signaling protein; 2.10A 4e-13
1p3r_A160 Disabled homolog 2; PTB, signaling protein; 2.10A 2e-12
4dbb_A162 Amyloid beta A4 precursor protein-binding family 1 5e-11
4dbb_A162 Amyloid beta A4 precursor protein-binding family 1 5e-07
1n3h_A207 SHC transforming protein; free protein, beta sandw 3e-07
2cy5_A140 Epidermal growth factor receptor pathway substrate 2e-05
1aqc_A172 X11; PTB domain; 2.30A {Homo sapiens} SCOP: b.55.1 6e-04
>1wgu_A APBB2, amyloid beta (A4) precursor protein-bindin, family B, member 2; phosphotyrosine-interaction domain, amyloid disease, structural genomics; NMR {Mus musculus} SCOP: b.55.1.2 PDB: 2roz_B Length = 136 Back     alignment and structure
 Score =  160 bits (405), Expect = 2e-50
 Identities = 53/129 (41%), Positives = 78/129 (60%), Gaps = 2/129 (1%)

Query: 113 PQSFPTPMEEPKKILRAQYLGSIQVSKPGGMDILNNAIDTLVSTVPQHLWQDVNIAVAPS 172
             S PTP  E  +  R QYLG + V +P GMD LN+AI+ L+++  +  W  VN+ VA +
Sbjct: 4   GSSGPTPKTELVQKFRVQYLGMLPVDRPVGMDTLNSAIENLMTSSSKEDWPSVNMNVADA 63

Query: 173 MITIHSTDEETGGTLMAECRVRFLSFLGIGHNVKQCAFIMHTAQDLFIAHVFVTEPSSGA 232
            +T+    E+    ++ ECRVRFLSF+G+G +V   AFIM T    F  HVF  EP++  
Sbjct: 64  TVTV--ISEKNEEEVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAAN 121

Query: 233 LCKTIEAAC 241
           + + ++AAC
Sbjct: 122 VSEAVQAAC 130
>1wgu_A APBB2, amyloid beta (A4) precursor protein-bindin, family B, member 2; phosphotyrosine-interaction domain, amyloid disease, structural genomics; NMR {Mus musculus} SCOP: b.55.1.2 PDB: 2roz_B Length = 136 Back     alignment and structure
>2dyq_A Amyloid beta A4 precursor protein-binding family 3; phosphotyrosine-interaction domain (PTB/PID alzheimer'S disease, structural genomics, NPPSFA; 3.10A {Homo sapiens} Length = 144 Back     alignment and structure
>2dyq_A Amyloid beta A4 precursor protein-binding family 3; phosphotyrosine-interaction domain (PTB/PID alzheimer'S disease, structural genomics, NPPSFA; 3.10A {Homo sapiens} Length = 144 Back     alignment and structure
>2yt0_A Amyloid beta A4 protein and amyloid beta A4 precursor protein-binding family B member...; chimera, Fe65L, PID domain, amyloid precursor protein; NMR {Mus musculus} PDB: 2yt1_A Length = 176 Back     alignment and structure
>2yt0_A Amyloid beta A4 protein and amyloid beta A4 precursor protein-binding family B member...; chimera, Fe65L, PID domain, amyloid precursor protein; NMR {Mus musculus} PDB: 2yt1_A Length = 176 Back     alignment and structure
>2ysz_A Amyloid beta A4 precursor protein-binding family B member 2 and amyloid beta A4 protein...; chimera, Fe65L, PID domain, amyloid precursor protein; NMR {Mus musculus} Length = 185 Back     alignment and structure
>2ysz_A Amyloid beta A4 precursor protein-binding family B member 2 and amyloid beta A4 protein...; chimera, Fe65L, PID domain, amyloid precursor protein; NMR {Mus musculus} Length = 185 Back     alignment and structure
>3dxe_A Amyloid beta A4 protein-binding family B member 1; alzheimer'S disease, APP, AICD, Fe65, PTB domain, alternative splicing, polymorphism, alzheimer disease, apoptosis; 2.00A {Homo sapiens} PDB: 3dxd_A 3dxc_A Length = 140 Back     alignment and structure
>3dxe_A Amyloid beta A4 protein-binding family B member 1; alzheimer'S disease, APP, AICD, Fe65, PTB domain, alternative splicing, polymorphism, alzheimer disease, apoptosis; 2.00A {Homo sapiens} PDB: 3dxd_A 3dxc_A Length = 140 Back     alignment and structure
>3d8d_A Amyloid beta A4 precursor protein-binding family 1; alpha-beta structure, phosphotyrosine binding domain; 2.20A {Homo sapiens} PDB: 3d8e_A 3d8f_A Length = 148 Back     alignment and structure
>3f0w_A NUMB-R, NUMB-like protein; PH domain-like, PID domain, phosphoprotein, signaling protei structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} PDB: 1wj1_A 2nmb_A* 1ddm_A Length = 168 Back     alignment and structure
>3f0w_A NUMB-R, NUMB-like protein; PH domain-like, PID domain, phosphoprotein, signaling protei structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} PDB: 1wj1_A 2nmb_A* 1ddm_A Length = 168 Back     alignment and structure
>2ej8_A DCC-interacting protein 13 alpha; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.84A {Homo sapiens} Length = 160 Back     alignment and structure
>2ej8_A DCC-interacting protein 13 alpha; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.84A {Homo sapiens} Length = 160 Back     alignment and structure
>2ela_A Adapter protein containing PH domain, PTB domain and leucine zipper motif 1; APPL, cell cycle; 2.00A {Homo sapiens} Length = 175 Back     alignment and structure
>2ela_A Adapter protein containing PH domain, PTB domain and leucine zipper motif 1; APPL, cell cycle; 2.00A {Homo sapiens} Length = 175 Back     alignment and structure
>3so6_A LDL receptor adaptor protein; PTB, endocytic adaptor, autosomal reces hypercholesterolemia, ARH, cholesterol; 1.37A {Rattus norvegicus} Length = 137 Back     alignment and structure
>3so6_A LDL receptor adaptor protein; PTB, endocytic adaptor, autosomal reces hypercholesterolemia, ARH, cholesterol; 1.37A {Rattus norvegicus} Length = 137 Back     alignment and structure
>1ntv_A Disabled homolog 1; beta-sandwich, signaling protein; 1.50A {Mus musculus} SCOP: b.55.1.2 PDB: 1nu2_A* 1oqn_A* Length = 152 Back     alignment and structure
>1ntv_A Disabled homolog 1; beta-sandwich, signaling protein; 1.50A {Mus musculus} SCOP: b.55.1.2 PDB: 1nu2_A* 1oqn_A* Length = 152 Back     alignment and structure
>1p3r_A Disabled homolog 2; PTB, signaling protein; 2.10A {Mus musculus} SCOP: b.55.1.2 PDB: 1m7e_A Length = 160 Back     alignment and structure
>1p3r_A Disabled homolog 2; PTB, signaling protein; 2.10A {Mus musculus} SCOP: b.55.1.2 PDB: 1m7e_A Length = 160 Back     alignment and structure
>4dbb_A Amyloid beta A4 precursor protein-binding family 1; X11S/mints, PTB domain, chimera protein, protein transport; HET: IPA GOL; 1.90A {Rattus norvegicus} Length = 162 Back     alignment and structure
>4dbb_A Amyloid beta A4 precursor protein-binding family 1; X11S/mints, PTB domain, chimera protein, protein transport; HET: IPA GOL; 1.90A {Rattus norvegicus} Length = 162 Back     alignment and structure
>1n3h_A SHC transforming protein; free protein, beta sandwich, signaling protein; NMR {Homo sapiens} SCOP: b.55.1.2 PDB: 1oy2_A 2l1c_A* 1shc_A* Length = 207 Back     alignment and structure
>2cy5_A Epidermal growth factor receptor pathway substrate 8-like protein 1; structural genomics, signal transduction, phosphorylation, PTB domain, NPPSFA; 1.90A {Mus musculus} SCOP: b.55.1.2 PDB: 2cy4_A Length = 140 Back     alignment and structure
>1aqc_A X11; PTB domain; 2.30A {Homo sapiens} SCOP: b.55.1.2 PDB: 1x11_A* Length = 172 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query242
2dyq_A144 Amyloid beta A4 precursor protein-binding family 3 100.0
1wgu_A136 APBB2, amyloid beta (A4) precursor protein-bindin, 100.0
3dxe_A140 Amyloid beta A4 protein-binding family B member 1; 100.0
2yt0_A176 Amyloid beta A4 protein and amyloid beta A4 precur 100.0
2ysz_A185 Amyloid beta A4 precursor protein-binding family B 100.0
3d8d_A148 Amyloid beta A4 precursor protein-binding family 1 99.95
3so6_A137 LDL receptor adaptor protein; PTB, endocytic adapt 99.95
2ej8_A160 DCC-interacting protein 13 alpha; structural genom 99.95
3f0w_A168 NUMB-R, NUMB-like protein; PH domain-like, PID dom 99.95
2ela_A175 Adapter protein containing PH domain, PTB domain a 99.95
3d8d_A148 Amyloid beta A4 precursor protein-binding family 1 99.94
4dbb_A162 Amyloid beta A4 precursor protein-binding family 1 99.93
1n3h_A207 SHC transforming protein; free protein, beta sandw 99.92
1aqc_A172 X11; PTB domain; 2.30A {Homo sapiens} SCOP: b.55.1 99.9
1ntv_A152 Disabled homolog 1; beta-sandwich, signaling prote 99.9
1p3r_A160 Disabled homolog 2; PTB, signaling protein; 2.10A 99.9
3suz_A 388 Amyloid beta A4 precursor protein-binding family 2 99.84
1wvh_A134 Tensin, tensin1; beta sandwich, cell adhesion; 1.5 99.82
3hqc_A157 Tensin-like C1 domain-containing phosphatase; TENC 99.78
2ej8_A160 DCC-interacting protein 13 alpha; structural genom 99.62
2ela_A175 Adapter protein containing PH domain, PTB domain a 99.6
3so6_A137 LDL receptor adaptor protein; PTB, endocytic adapt 99.58
3f0w_A168 NUMB-R, NUMB-like protein; PH domain-like, PID dom 99.52
2dyq_A144 Amyloid beta A4 precursor protein-binding family 3 99.4
1aqc_A172 X11; PTB domain; 2.30A {Homo sapiens} SCOP: b.55.1 99.37
3dxe_A140 Amyloid beta A4 protein-binding family B member 1; 99.37
1wgu_A136 APBB2, amyloid beta (A4) precursor protein-bindin, 99.31
2ysz_A185 Amyloid beta A4 precursor protein-binding family B 99.28
2yt0_A176 Amyloid beta A4 protein and amyloid beta A4 precur 99.27
4dbb_A162 Amyloid beta A4 precursor protein-binding family 1 99.26
1p3r_A160 Disabled homolog 2; PTB, signaling protein; 2.10A 99.16
1ntv_A152 Disabled homolog 1; beta-sandwich, signaling prote 99.14
1n3h_A207 SHC transforming protein; free protein, beta sandw 99.12
1wvh_A134 Tensin, tensin1; beta sandwich, cell adhesion; 1.5 98.72
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 98.62
4dx8_A154 Integrin beta-1-binding protein 1; protein-protien 98.55
3hqc_A157 Tensin-like C1 domain-containing phosphatase; TENC 98.36
2cy5_A140 Epidermal growth factor receptor pathway substrate 97.88
2cy5_A140 Epidermal growth factor receptor pathway substrate 97.29
4dx8_A154 Integrin beta-1-binding protein 1; protein-protien 97.09
>2dyq_A Amyloid beta A4 precursor protein-binding family 3; phosphotyrosine-interaction domain (PTB/PID alzheimer'S disease, structural genomics, NPPSFA; 3.10A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=8.6e-51  Score=335.74  Aligned_cols=128  Identities=28%  Similarity=0.535  Sum_probs=111.8

Q ss_pred             CCCCCCCccceeEEEEeeeeeEecCCchhhHHHHHHHHHHhcCCCCCceeeEEEEcCCeEEEEecCC--CcCceeeeeEE
Q psy3532         115 SFPTPMEEPKKILRAQYLGSIQVSKPGGMDILNNAIDTLVSTVPQHLWQDVNIAVAPSMITIHSTDE--ETGGTLMAECR  192 (242)
Q Consensus       115 ~fp~p~~e~~~~f~vkyLGsv~V~~~~G~dVln~Ai~~i~~~~~~~~w~pv~l~Vs~~~i~i~~~~~--~~~~e~l~ec~  192 (242)
                      |||++..+++++|++||||++||++|+||||||+||++|++++++++|+||.|+|||++|+|++.+.  ..+++++++||
T Consensus         6 ~~~~~~~~~~~~f~~kyLGsv~V~~~~G~dVln~Ai~~l~~~~~~~~w~~v~l~Vs~~~i~v~~~~~~~~~~~~~l~~c~   85 (144)
T 2dyq_A            6 SGLDAVSQAAQKYEALYMGTLPVTKAMGMDVLNEAIGTLTARGDRNAWVPTMLSVSDSLMTAHPIQAEASTEEEPLWQCP   85 (144)
T ss_dssp             ---------CCCCEEEEEEEEEESSSCCHHHHHHHHHHHHCCCSSCCCEEEEEEECSSEEEEEECC------CCCSSEEE
T ss_pred             hHHHHHHhhhhEEEEEEeccEEecCccCHHHHHHHHHHHHhcCCcccCcceEEEEeccceEEeccccccccccceeeece
Confidence            8899999999999999999999999999999999999999988889999999999999999998641  12248999999


Q ss_pred             EEEEEeeecCCCCceEEEEEeCCCCceEEEEEEcCCCchHHHHHHHHHhC
Q psy3532         193 VRFLSFLGIGHNVKQCAFIMHTAQDLFIAHVFVTEPSSGALCKTIEAACK  242 (242)
Q Consensus       193 vr~iSF~gvgkd~k~FafI~~~~~~~f~CHVF~ce~~A~~lseaV~aAc~  242 (242)
                      ||+|||||+|||+|+||||||+++++|+||||||||+|++||||||+|||
T Consensus        86 vr~ISFcgvgkd~r~FaFI~~~~~~~f~CHVF~ce~~A~~ls~aV~~Ac~  135 (144)
T 2dyq_A           86 VRLVTFIGVGRDPHTFGLIADLGRQSFQCAAFWCQPHAGGLSEAVQAACM  135 (144)
T ss_dssp             GGGEEEEEECSSTTEEEEEEECSSSCEEEEEEECSSCTHHHHHHHHHHHH
T ss_pred             EEEEeeeecCCCCcEEEEEEeCCCCcEEEEEEecCCchHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999996
>1wgu_A APBB2, amyloid beta (A4) precursor protein-bindin, family B, member 2; phosphotyrosine-interaction domain, amyloid disease, structural genomics; NMR {Mus musculus} SCOP: b.55.1.2 PDB: 2roz_B Back     alignment and structure
>3dxe_A Amyloid beta A4 protein-binding family B member 1; alzheimer'S disease, APP, AICD, Fe65, PTB domain, alternative splicing, polymorphism, alzheimer disease, apoptosis; 2.00A {Homo sapiens} SCOP: b.55.1.0 PDB: 3dxd_A 3dxc_A Back     alignment and structure
>2yt0_A Amyloid beta A4 protein and amyloid beta A4 precursor protein-binding family B member...; chimera, Fe65L, PID domain, amyloid precursor protein; NMR {Mus musculus} PDB: 2yt1_A Back     alignment and structure
>2ysz_A Amyloid beta A4 precursor protein-binding family B member 2 and amyloid beta A4 protein...; chimera, Fe65L, PID domain, amyloid precursor protein; NMR {Mus musculus} Back     alignment and structure
>3d8d_A Amyloid beta A4 precursor protein-binding family 1; alpha-beta structure, phosphotyrosine binding domain; 2.20A {Homo sapiens} PDB: 3d8e_A 3d8f_A Back     alignment and structure
>3so6_A LDL receptor adaptor protein; PTB, endocytic adaptor, autosomal reces hypercholesterolemia, ARH, cholesterol; 1.37A {Rattus norvegicus} Back     alignment and structure
>2ej8_A DCC-interacting protein 13 alpha; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.84A {Homo sapiens} Back     alignment and structure
>3f0w_A NUMB-R, NUMB-like protein; PH domain-like, PID domain, phosphoprotein, signaling protei structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} PDB: 1wj1_A 2nmb_A* 1ddm_A Back     alignment and structure
>2ela_A Adapter protein containing PH domain, PTB domain and leucine zipper motif 1; APPL, cell cycle; 2.00A {Homo sapiens} Back     alignment and structure
>3d8d_A Amyloid beta A4 precursor protein-binding family 1; alpha-beta structure, phosphotyrosine binding domain; 2.20A {Homo sapiens} PDB: 3d8e_A 3d8f_A Back     alignment and structure
>4dbb_A Amyloid beta A4 precursor protein-binding family 1; X11S/mints, PTB domain, chimera protein, protein transport; HET: IPA GOL; 1.90A {Rattus norvegicus} Back     alignment and structure
>1n3h_A SHC transforming protein; free protein, beta sandwich, signaling protein; NMR {Homo sapiens} SCOP: b.55.1.2 PDB: 1oy2_A 2l1c_A* 1shc_A* Back     alignment and structure
>1aqc_A X11; PTB domain; 2.30A {Homo sapiens} SCOP: b.55.1.2 PDB: 1x11_A* Back     alignment and structure
>1ntv_A Disabled homolog 1; beta-sandwich, signaling protein; 1.50A {Mus musculus} SCOP: b.55.1.2 PDB: 1nu2_A* 1oqn_A* Back     alignment and structure
>1p3r_A Disabled homolog 2; PTB, signaling protein; 2.10A {Mus musculus} SCOP: b.55.1.2 PDB: 1m7e_A Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>1wvh_A Tensin, tensin1; beta sandwich, cell adhesion; 1.50A {Gallus gallus} SCOP: b.55.1.2 PDB: 2gjy_A Back     alignment and structure
>3hqc_A Tensin-like C1 domain-containing phosphatase; TENC1, phosphotyrosine binding domain, PTB, TNS2, KIAA1075, struct genomics, PSI-2; 1.80A {Homo sapiens} SCOP: b.55.1.2 PDB: 2loz_A 2dkq_A Back     alignment and structure
>2ej8_A DCC-interacting protein 13 alpha; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.84A {Homo sapiens} Back     alignment and structure
>2ela_A Adapter protein containing PH domain, PTB domain and leucine zipper motif 1; APPL, cell cycle; 2.00A {Homo sapiens} Back     alignment and structure
>3so6_A LDL receptor adaptor protein; PTB, endocytic adaptor, autosomal reces hypercholesterolemia, ARH, cholesterol; 1.37A {Rattus norvegicus} Back     alignment and structure
>3f0w_A NUMB-R, NUMB-like protein; PH domain-like, PID domain, phosphoprotein, signaling protei structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} PDB: 1wj1_A 2nmb_A* 1ddm_A Back     alignment and structure
>2dyq_A Amyloid beta A4 precursor protein-binding family 3; phosphotyrosine-interaction domain (PTB/PID alzheimer'S disease, structural genomics, NPPSFA; 3.10A {Homo sapiens} Back     alignment and structure
>1aqc_A X11; PTB domain; 2.30A {Homo sapiens} SCOP: b.55.1.2 PDB: 1x11_A* Back     alignment and structure
>3dxe_A Amyloid beta A4 protein-binding family B member 1; alzheimer'S disease, APP, AICD, Fe65, PTB domain, alternative splicing, polymorphism, alzheimer disease, apoptosis; 2.00A {Homo sapiens} SCOP: b.55.1.0 PDB: 3dxd_A 3dxc_A Back     alignment and structure
>1wgu_A APBB2, amyloid beta (A4) precursor protein-bindin, family B, member 2; phosphotyrosine-interaction domain, amyloid disease, structural genomics; NMR {Mus musculus} SCOP: b.55.1.2 PDB: 2roz_B Back     alignment and structure
>2ysz_A Amyloid beta A4 precursor protein-binding family B member 2 and amyloid beta A4 protein...; chimera, Fe65L, PID domain, amyloid precursor protein; NMR {Mus musculus} Back     alignment and structure
>2yt0_A Amyloid beta A4 protein and amyloid beta A4 precursor protein-binding family B member...; chimera, Fe65L, PID domain, amyloid precursor protein; NMR {Mus musculus} PDB: 2yt1_A Back     alignment and structure
>4dbb_A Amyloid beta A4 precursor protein-binding family 1; X11S/mints, PTB domain, chimera protein, protein transport; HET: IPA GOL; 1.90A {Rattus norvegicus} Back     alignment and structure
>1p3r_A Disabled homolog 2; PTB, signaling protein; 2.10A {Mus musculus} SCOP: b.55.1.2 PDB: 1m7e_A Back     alignment and structure
>1ntv_A Disabled homolog 1; beta-sandwich, signaling protein; 1.50A {Mus musculus} SCOP: b.55.1.2 PDB: 1nu2_A* 1oqn_A* Back     alignment and structure
>1n3h_A SHC transforming protein; free protein, beta sandwich, signaling protein; NMR {Homo sapiens} SCOP: b.55.1.2 PDB: 1oy2_A 2l1c_A* 1shc_A* Back     alignment and structure
>1wvh_A Tensin, tensin1; beta sandwich, cell adhesion; 1.50A {Gallus gallus} SCOP: b.55.1.2 PDB: 2gjy_A Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>4dx8_A Integrin beta-1-binding protein 1; protein-protien complex, PTB domain, nudix fold, protein-Pro interaction, membrane, nucleus, protein binding; 2.54A {Homo sapiens} PDB: 4dx9_A Back     alignment and structure
>3hqc_A Tensin-like C1 domain-containing phosphatase; TENC1, phosphotyrosine binding domain, PTB, TNS2, KIAA1075, struct genomics, PSI-2; 1.80A {Homo sapiens} SCOP: b.55.1.2 PDB: 2loz_A 2dkq_A Back     alignment and structure
>2cy5_A Epidermal growth factor receptor pathway substrate 8-like protein 1; structural genomics, signal transduction, phosphorylation, PTB domain, NPPSFA; 1.90A {Mus musculus} SCOP: b.55.1.2 PDB: 2cy4_A Back     alignment and structure
>2cy5_A Epidermal growth factor receptor pathway substrate 8-like protein 1; structural genomics, signal transduction, phosphorylation, PTB domain, NPPSFA; 1.90A {Mus musculus} SCOP: b.55.1.2 PDB: 2cy4_A Back     alignment and structure
>4dx8_A Integrin beta-1-binding protein 1; protein-protien complex, PTB domain, nudix fold, protein-Pro interaction, membrane, nucleus, protein binding; 2.54A {Homo sapiens} PDB: 4dx9_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 242
d1wgua_136 b.55.1.2 (A:) Amyloid beta A4 precursor protein-bi 5e-31
d1wgua_136 b.55.1.2 (A:) Amyloid beta A4 precursor protein-bi 3e-11
d1p3ra_148 b.55.1.2 (A:) Disabled homolog 2 (Dab2) {Mouse (Mu 1e-17
d1p3ra_148 b.55.1.2 (A:) Disabled homolog 2 (Dab2) {Mouse (Mu 5e-16
d1ddma_135 b.55.1.2 (A:) Numb {Fruit fly (Drosophila melanoga 8e-17
d1ddma_135 b.55.1.2 (A:) Numb {Fruit fly (Drosophila melanoga 3e-15
d1wj1a_156 b.55.1.2 (A:) Numb {Mouse (Mus musculus) [TaxId: 1 5e-16
d1wj1a_156 b.55.1.2 (A:) Numb {Mouse (Mus musculus) [TaxId: 1 1e-15
d2cy5a1129 b.55.1.2 (A:31-159) EPS8-like protein 1, EPS8L1 {M 6e-16
d2cy5a1129 b.55.1.2 (A:31-159) EPS8-like protein 1, EPS8L1 {M 6e-15
d1ntva_152 b.55.1.2 (A:) Disabled homolog 1 (Dab1) {Mouse (Mu 1e-15
d1ntva_152 b.55.1.2 (A:) Disabled homolog 1 (Dab1) {Mouse (Mu 4e-11
d2dkqa1147 b.55.1.2 (A:8-154) Tensin {Human (Homo sapiens) [T 2e-13
d2dkqa1147 b.55.1.2 (A:8-154) Tensin {Human (Homo sapiens) [T 2e-05
d1wvha1133 b.55.1.2 (A:1606-1738) Tensin {Chicken (Gallus gal 7e-11
d1wvha1133 b.55.1.2 (A:1606-1738) Tensin {Chicken (Gallus gal 0.003
d1oy2a_191 b.55.1.2 (A:) Shc adaptor protein {Human (Homo sap 1e-10
d1oy2a_191 b.55.1.2 (A:) Shc adaptor protein {Human (Homo sap 6e-09
d1aqca_166 b.55.1.2 (A:) X11 {Human (Homo sapiens) [TaxId: 96 1e-09
d1aqca_166 b.55.1.2 (A:) X11 {Human (Homo sapiens) [TaxId: 96 3e-06
>d1wgua_ b.55.1.2 (A:) Amyloid beta A4 precursor protein-binding family B member 2, Apbb2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure

class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Phosphotyrosine-binding domain (PTB)
domain: Amyloid beta A4 precursor protein-binding family B member 2, Apbb2
species: Mouse (Mus musculus) [TaxId: 10090]

 Score =  109 bits (273), Expect = 5e-31
 Identities = 53/129 (41%), Positives = 78/129 (60%), Gaps = 2/129 (1%)

Query: 113 PQSFPTPMEEPKKILRAQYLGSIQVSKPGGMDILNNAIDTLVSTVPQHLWQDVNIAVAPS 172
             S PTP  E  +  R QYLG + V +P GMD LN+AI+ L+++  +  W  VN+ VA +
Sbjct: 4   GSSGPTPKTELVQKFRVQYLGMLPVDRPVGMDTLNSAIENLMTSSSKEDWPSVNMNVADA 63

Query: 173 MITIHSTDEETGGTLMAECRVRFLSFLGIGHNVKQCAFIMHTAQDLFIAHVFVTEPSSGA 232
            +T+    E+    ++ ECRVRFLSF+G+G +V   AFIM T    F  HVF  EP++  
Sbjct: 64  TVTVI--SEKNEEEVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAAN 121

Query: 233 LCKTIEAAC 241
           + + ++AAC
Sbjct: 122 VSEAVQAAC 130
>d1wgua_ b.55.1.2 (A:) Amyloid beta A4 precursor protein-binding family B member 2, Apbb2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure
>d1p3ra_ b.55.1.2 (A:) Disabled homolog 2 (Dab2) {Mouse (Mus musculus) [TaxId: 10090]} Length = 148 Back     information, alignment and structure
>d1p3ra_ b.55.1.2 (A:) Disabled homolog 2 (Dab2) {Mouse (Mus musculus) [TaxId: 10090]} Length = 148 Back     information, alignment and structure
>d1ddma_ b.55.1.2 (A:) Numb {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 135 Back     information, alignment and structure
>d1ddma_ b.55.1.2 (A:) Numb {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 135 Back     information, alignment and structure
>d1wj1a_ b.55.1.2 (A:) Numb {Mouse (Mus musculus) [TaxId: 10090]} Length = 156 Back     information, alignment and structure
>d1wj1a_ b.55.1.2 (A:) Numb {Mouse (Mus musculus) [TaxId: 10090]} Length = 156 Back     information, alignment and structure
>d2cy5a1 b.55.1.2 (A:31-159) EPS8-like protein 1, EPS8L1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 129 Back     information, alignment and structure
>d2cy5a1 b.55.1.2 (A:31-159) EPS8-like protein 1, EPS8L1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 129 Back     information, alignment and structure
>d1ntva_ b.55.1.2 (A:) Disabled homolog 1 (Dab1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 152 Back     information, alignment and structure
>d1ntva_ b.55.1.2 (A:) Disabled homolog 1 (Dab1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 152 Back     information, alignment and structure
>d2dkqa1 b.55.1.2 (A:8-154) Tensin {Human (Homo sapiens) [TaxId: 9606]} Length = 147 Back     information, alignment and structure
>d2dkqa1 b.55.1.2 (A:8-154) Tensin {Human (Homo sapiens) [TaxId: 9606]} Length = 147 Back     information, alignment and structure
>d1wvha1 b.55.1.2 (A:1606-1738) Tensin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 133 Back     information, alignment and structure
>d1wvha1 b.55.1.2 (A:1606-1738) Tensin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 133 Back     information, alignment and structure
>d1oy2a_ b.55.1.2 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Back     information, alignment and structure
>d1oy2a_ b.55.1.2 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Back     information, alignment and structure
>d1aqca_ b.55.1.2 (A:) X11 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1aqca_ b.55.1.2 (A:) X11 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query242
d1wgua_136 Amyloid beta A4 precursor protein-binding family B 100.0
d2cy5a1129 EPS8-like protein 1, EPS8L1 {Mouse (Mus musculus) 99.96
d1wj1a_156 Numb {Mouse (Mus musculus) [TaxId: 10090]} 99.95
d1p3ra_148 Disabled homolog 2 (Dab2) {Mouse (Mus musculus) [T 99.95
d1ddma_135 Numb {Fruit fly (Drosophila melanogaster) [TaxId: 99.94
d1ntva_152 Disabled homolog 1 (Dab1) {Mouse (Mus musculus) [T 99.94
d2dkqa1147 Tensin {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1aqca_166 X11 {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1wvha1133 Tensin {Chicken (Gallus gallus) [TaxId: 9031]} 99.9
d1oy2a_191 Shc adaptor protein {Human (Homo sapiens) [TaxId: 99.9
d2cy5a1129 EPS8-like protein 1, EPS8L1 {Mouse (Mus musculus) 99.53
d1ddma_135 Numb {Fruit fly (Drosophila melanogaster) [TaxId: 99.49
d1wj1a_156 Numb {Mouse (Mus musculus) [TaxId: 10090]} 99.47
d1wgua_136 Amyloid beta A4 precursor protein-binding family B 99.47
d1p3ra_148 Disabled homolog 2 (Dab2) {Mouse (Mus musculus) [T 99.42
d1aqca_166 X11 {Human (Homo sapiens) [TaxId: 9606]} 99.34
d1ntva_152 Disabled homolog 1 (Dab1) {Mouse (Mus musculus) [T 99.32
d2dkqa1147 Tensin {Human (Homo sapiens) [TaxId: 9606]} 99.08
d1oy2a_191 Shc adaptor protein {Human (Homo sapiens) [TaxId: 99.08
d1wvha1133 Tensin {Chicken (Gallus gallus) [TaxId: 9031]} 99.04
d1mixa292 Talin {Chicken (Gallus gallus) [TaxId: 9031]} 94.59
d1mixa292 Talin {Chicken (Gallus gallus) [TaxId: 9031]} 91.95
d1j0wa_99 Downstream of tyrosine kinase 5, Dok-5 {Human (Hom 84.98
d1wgqa_109 FYVE, RhoGEF and PH domain containing protein 6, F 82.7
>d1wgua_ b.55.1.2 (A:) Amyloid beta A4 precursor protein-binding family B member 2, Apbb2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Phosphotyrosine-binding domain (PTB)
domain: Amyloid beta A4 precursor protein-binding family B member 2, Apbb2
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=2e-35  Score=238.26  Aligned_cols=126  Identities=43%  Similarity=0.763  Sum_probs=118.2

Q ss_pred             CCCCCCCccceeEEEEeeeeeEecCCchhhHHHHHHHHHHhcCCCCCceeeEEEEcCCeEEEEecCCCcCceeeeeEEEE
Q psy3532         115 SFPTPMEEPKKILRAQYLGSIQVSKPGGMDILNNAIDTLVSTVPQHLWQDVNIAVAPSMITIHSTDEETGGTLMAECRVR  194 (242)
Q Consensus       115 ~fp~p~~e~~~~f~vkyLGsv~V~~~~G~dVln~Ai~~i~~~~~~~~w~pv~l~Vs~~~i~i~~~~~~~~~e~l~ec~vr  194 (242)
                      +.|+|++++.+.|+|+|||+++|.+++|++++++||++|+....+.+|++|.|.|++.||+|++..+.  +.++.+++|+
T Consensus         6 ~~P~~~~~~~~~f~vkYLGs~~V~~~~G~~~v~~Ai~~l~~~~~~~~~~~v~l~Vs~~gi~v~~~~~~--~~~~~~~~i~   83 (136)
T d1wgua_           6 SGPTPKTELVQKFRVQYLGMLPVDRPVGMDTLNSAIENLMTSSSKEDWPSVNMNVADATVTVISEKNE--EEVLVECRVR   83 (136)
T ss_dssp             CCCCSCCCCCCCEEEEEEEEEECSCSSCSHHHHHHHHHHHHSSCTTTSCEEEEEEETTEEEEECSSCS--SCEEEEEETT
T ss_pred             CCCCCCCCcccEEEEEEEEEEEcCCCCchHHHHHHHHHHHhhccCCCCcEEEEEEEcCEEEEEecccc--ceeeEEEEee
Confidence            67999999999999999999999999999999999999998777788999999999999999986543  3688999999


Q ss_pred             EEEeeecCCCCceEEEEEeCCCCceEEEEEEcCCCchHHHHHHHHHhC
Q psy3532         195 FLSFLGIGHNVKQCAFIMHTAQDLFIAHVFVTEPSSGALCKTIEAACK  242 (242)
Q Consensus       195 ~iSF~gvgkd~k~FafI~~~~~~~f~CHVF~ce~~A~~lseaV~aAc~  242 (242)
                      +||||++++|.++||||++...++|.||||+|+++|..|++||++||.
T Consensus        84 ~Isfc~~~~~~~~FafI~~~~~~~~~CHvF~c~~~A~~i~~ai~~Ac~  131 (136)
T d1wgua_          84 FLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAANVSEAVQAACS  131 (136)
T ss_dssp             TEEEEEECSSTTCEEEEEECSSSCEEEEEEECSSCTHHHHHHHHHHHC
T ss_pred             EEEEEEecCCCcEEEEEEeCCCCcEEEEEEEecccHHHHHHHHHHHHc
Confidence            999999999999999999888899999999999999999999999994
>d2cy5a1 b.55.1.2 (A:31-159) EPS8-like protein 1, EPS8L1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wj1a_ b.55.1.2 (A:) Numb {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p3ra_ b.55.1.2 (A:) Disabled homolog 2 (Dab2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ddma_ b.55.1.2 (A:) Numb {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ntva_ b.55.1.2 (A:) Disabled homolog 1 (Dab1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dkqa1 b.55.1.2 (A:8-154) Tensin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aqca_ b.55.1.2 (A:) X11 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wvha1 b.55.1.2 (A:1606-1738) Tensin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1oy2a_ b.55.1.2 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cy5a1 b.55.1.2 (A:31-159) EPS8-like protein 1, EPS8L1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ddma_ b.55.1.2 (A:) Numb {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wj1a_ b.55.1.2 (A:) Numb {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgua_ b.55.1.2 (A:) Amyloid beta A4 precursor protein-binding family B member 2, Apbb2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p3ra_ b.55.1.2 (A:) Disabled homolog 2 (Dab2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1aqca_ b.55.1.2 (A:) X11 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ntva_ b.55.1.2 (A:) Disabled homolog 1 (Dab1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dkqa1 b.55.1.2 (A:8-154) Tensin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy2a_ b.55.1.2 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wvha1 b.55.1.2 (A:1606-1738) Tensin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1mixa2 b.55.1.5 (A:309-400) Talin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1mixa2 b.55.1.5 (A:309-400) Talin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1j0wa_ b.55.1.2 (A:) Downstream of tyrosine kinase 5, Dok-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure