Psyllid ID: psy4072

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-
KRRLSLCVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDYVSSEKNQFLDENCTCFVRDGKTYCKRDYVRLFGTKCEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDDHEGMDKSSNGENNNNNTNINNNLHNLNNEGSNSGKIQLYLL
cccccccccccccccccccEEEcccccccccccccccccccccccccEEEEccEEEccccccccccccccccccEEEEcccccccHHHHHHHHHHccccccccccccccEEEEccccccccccccccccccccccccEEEEccEEEccccHHccccccccccccccccccccccccccccccccccccccc
ccccccEccccccccccEEEEEcccccccHHHccHHHHHHHHHHccEEEEEccccccHHHEEEEEcccccccccEEEEEcccEEEHHHHHHHHccccccccccccccHHHHHHHcccEccccEEEEEEcccccccccEEccccccEEHHHHHHHHHccccccccccccccccccccccccccccccEEEcc
krrlslcvgcggqihdqyILRVAPDLEWHAACLRCAEchqfldenctcfvrdgktyckrdyvsseknqfldenctcfvrdgktyckrdyVRLFGtkcekcnlnfkreDFVMRAKNKiyhvqcfccvvcgkqlvpgdefalredglfckddhegmdkssngennnnntniNNNLhnlnnegsnsgkiqlyll
krrlslcvgcggqihdqYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDYvsseknqfldenctcfVRDGKTYCKRDYVRlfgtkcekcnlnfKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDDHEGmdkssngennnnNTNINNNLhnlnnegsnsgkiqlyll
KRRLSLCVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDYVSSEKNQFLDENCTCFVRDGKTYCKRDYVRLFGTKCEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDDHEGMDKssngennnnntninnnlhnlnnegsnsGKIQLYLL
***LSLCVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDYVSSEKNQFLDENCTCFVRDGKTYCKRDYVRLFGTKCEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFC********************************************
**RLSLCVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDYVSSEKNQFLDENCTCFVRDGKTYCKRDYVRLFGTKCEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDDH****************************************
********GCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDYVSSEKNQFLDENCTCFVRDGKTYCKRDYVRLFGTKCEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDDHEGMDKSSNGENNNNNTNINNNLHNLNNEGSNSGKIQLYLL
**RLSLCVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDYVSSEKNQFLDENCTCFVRDGKTYCKRDYVRLFGTKCEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDDHEGMDKS*****************NLNNEGSNSGKIQLYLL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KRRLSLCVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDYVSSEKNQFLDENCTCFVRDGKTYCKRDYVRLFGTKCEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDDHEGMDKSSxxxxxxxxxxxxxxxxxxxxxGSNSGKIQLYLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query191 2.2.26 [Sep-21-2011]
P53405 349 Insulin gene enhancer pro yes N/A 0.706 0.386 0.588 7e-56
P61374 349 Insulin gene enhancer pro yes N/A 0.706 0.386 0.588 1e-55
P61372 349 Insulin gene enhancer pro yes N/A 0.706 0.386 0.588 1e-55
P61373 349 Insulin gene enhancer pro N/A N/A 0.706 0.386 0.588 1e-55
P61371 349 Insulin gene enhancer pro yes N/A 0.706 0.386 0.588 1e-55
P50211 349 Insulin gene enhancer pro yes N/A 0.706 0.386 0.588 3e-55
P53409 363 Insulin gene enhancer pro N/A N/A 0.764 0.402 0.528 8e-50
P53407 358 Insulin gene enhancer pro no N/A 0.748 0.399 0.520 2e-48
P50212 340 Insulin gene enhancer pro N/A N/A 0.764 0.429 0.514 3e-48
Q96A47 359 Insulin gene enhancer pro no N/A 0.785 0.417 0.491 7e-48
>sp|P53405|ISL1_DANRE Insulin gene enhancer protein isl-1 OS=Danio rerio GN=isl1 PE=2 SV=1 Back     alignment and function desciption
 Score =  216 bits (550), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 96/163 (58%), Positives = 120/163 (73%), Gaps = 28/163 (17%)

Query: 1   KRRLSLCVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRD 60
           KR +SLCVGCG QIHDQYILRV+PDLEWHAACL+CAEC                      
Sbjct: 11  KRLISLCVGCGNQIHDQYILRVSPDLEWHAACLKCAEC---------------------- 48

Query: 61  YVSSEKNQFLDENCTCFVRDGKTYCKRDYVRLFGTKCEKCNLNFKREDFVMRAKNKIYHV 120
                 NQ+LDE+CTCFVRDGKTYCKRDY+RL+G KC KCN+ F + DFVMRA++K+YH+
Sbjct: 49  ------NQYLDESCTCFVRDGKTYCKRDYIRLYGIKCAKCNIGFSKNDFVMRARSKVYHI 102

Query: 121 QCFCCVVCGKQLVPGDEFALREDGLFCKDDHEGMDKSSNGENN 163
           +CF CV C +QL+PGDEFALREDGLFC+ DH+ +++++ G  +
Sbjct: 103 ECFRCVACSRQLIPGDEFALREDGLFCRADHDVVERATMGAGD 145
Binds to one of the cis-acting domain of the insulin gene enhancer. May be involved in subtype specialization of primary motoneurons.
Danio rerio (taxid: 7955)
>sp|P61374|ISL1_RAT Insulin gene enhancer protein ISL-1 OS=Rattus norvegicus GN=Isl1 PE=2 SV=1 Back     alignment and function description
>sp|P61372|ISL1_MOUSE Insulin gene enhancer protein ISL-1 OS=Mus musculus GN=Isl1 PE=1 SV=1 Back     alignment and function description
>sp|P61373|ISL1_MESAU Insulin gene enhancer protein ISL-1 OS=Mesocricetus auratus GN=ISL1 PE=2 SV=1 Back     alignment and function description
>sp|P61371|ISL1_HUMAN Insulin gene enhancer protein ISL-1 OS=Homo sapiens GN=ISL1 PE=1 SV=1 Back     alignment and function description
>sp|P50211|ISL1_CHICK Insulin gene enhancer protein ISL-1 OS=Gallus gallus GN=ISL1 PE=2 SV=1 Back     alignment and function description
>sp|P53409|ISL3_ONCTS Insulin gene enhancer protein ISL-3 OS=Oncorhynchus tschawytscha GN=isl3 PE=2 SV=1 Back     alignment and function description
>sp|P53407|ISL2B_DANRE Insulin gene enhancer protein isl-2b OS=Danio rerio GN=isl2b PE=2 SV=1 Back     alignment and function description
>sp|P50212|ISL2B_ONCTS Insulin gene enhancer protein ISL-2B (Fragment) OS=Oncorhynchus tschawytscha GN=isl2b PE=2 SV=1 Back     alignment and function description
>sp|Q96A47|ISL2_HUMAN Insulin gene enhancer protein ISL-2 OS=Homo sapiens GN=ISL2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query191
242009361 433 LIM/homeobox protein Lhx9, putative [Ped 0.816 0.360 0.681 4e-59
156398319 329 predicted protein [Nematostella vectensi 0.795 0.462 0.579 3e-56
308097158 349 ISL1 transcription factor [Notophthalmus 0.691 0.378 0.606 1e-54
327262855 349 PREDICTED: insulin gene enhancer protein 0.706 0.386 0.595 2e-54
209737368 356 Insulin gene enhancer protein isl-1 [Sal 0.706 0.379 0.595 3e-54
18858905 349 insulin gene enhancer protein isl-1 [Dan 0.706 0.386 0.588 4e-54
443690540 432 hypothetical protein CAPTEDRAFT_219057 [ 0.842 0.372 0.539 4e-54
6980082 419 LIM-homeodomain transcription factor isl 0.816 0.372 0.548 5e-54
431908581 383 Insulin protein enhancer protein ISL-1 [ 0.706 0.352 0.588 6e-54
345304657 382 PREDICTED: insulin gene enhancer protein 0.706 0.353 0.588 6e-54
>gi|242009361|ref|XP_002425456.1| LIM/homeobox protein Lhx9, putative [Pediculus humanus corporis] gi|212509292|gb|EEB12718.1| LIM/homeobox protein Lhx9, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  232 bits (592), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 137/185 (74%), Gaps = 29/185 (15%)

Query: 1   KRRLSLCVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRD 60
           KRRLSLCVGCG QIHDQYILRVAPDLEWHAACL+CAECHQFLD                 
Sbjct: 5   KRRLSLCVGCGAQIHDQYILRVAPDLEWHAACLKCAECHQFLD----------------- 47

Query: 61  YVSSEKNQFLDENCTCFVRDGKTYCKRDYVRLFGTKCEKCNLNFKREDFVMRAKNKIYHV 120
                      ENCTCFVRDGKTYCKRDYVRLFGTKC+KC  +F + DFVMRAK KIYHV
Sbjct: 48  -----------ENCTCFVRDGKTYCKRDYVRLFGTKCDKCGQSFSKNDFVMRAKTKIYHV 96

Query: 121 QCFCCVVCGKQLVPGDEFALREDGLFCKDDHEGMDKSSNGE-NNNNNTNINNNLHNLNNE 179
            CF C  C +QLVPGDEFALREDGLFCK+DHE +DKS  GE NNNN    NNN ++++NE
Sbjct: 97  DCFRCTACERQLVPGDEFALREDGLFCKEDHEVLDKSCTGEHNNNNTNVNNNNSNSVHNE 156

Query: 180 GSNSG 184
           GSNSG
Sbjct: 157 GSNSG 161

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|156398319|ref|XP_001638136.1| predicted protein [Nematostella vectensis] gi|156225254|gb|EDO46073.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|308097158|gb|ADO14133.1| ISL1 transcription factor [Notophthalmus viridescens] Back     alignment and taxonomy information
>gi|327262855|ref|XP_003216239.1| PREDICTED: insulin gene enhancer protein ISL-1-like [Anolis carolinensis] Back     alignment and taxonomy information
>gi|209737368|gb|ACI69553.1| Insulin gene enhancer protein isl-1 [Salmo salar] Back     alignment and taxonomy information
>gi|18858905|ref|NP_571037.1| insulin gene enhancer protein isl-1 [Danio rerio] gi|1708559|sp|P53405.1|ISL1_DANRE RecName: Full=Insulin gene enhancer protein isl-1; Short=Islet-1 gi|497898|dbj|BAA04670.1| insulin gene enhancer binding protein [Danio rerio] gi|38173895|gb|AAH60892.1| Isl1 protein [Danio rerio] Back     alignment and taxonomy information
>gi|443690540|gb|ELT92649.1| hypothetical protein CAPTEDRAFT_219057 [Capitella teleta] Back     alignment and taxonomy information
>gi|6980082|gb|AAF34717.1|AF226616_1 LIM-homeodomain transcription factor islet [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|431908581|gb|ELK12174.1| Insulin protein enhancer protein ISL-1 [Pteropus alecto] Back     alignment and taxonomy information
>gi|345304657|ref|XP_001508080.2| PREDICTED: insulin gene enhancer protein ISL-1-like [Ornithorhynchus anatinus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query191
ZFIN|ZDB-GENE-980526-112 349 isl1 "islet1" [Danio rerio (ta 0.486 0.266 0.677 2.4e-37
UNIPROTKB|A6H796 349 ISL1 "ISL1 protein" [Bos tauru 0.486 0.266 0.666 8e-37
UNIPROTKB|F1PP21 360 ISL1 "Uncharacterized protein" 0.486 0.258 0.666 8e-37
UNIPROTKB|D6RBJ1 326 ISL1 "Insulin gene enhancer pr 0.486 0.285 0.666 8e-37
UNIPROTKB|P61371 349 ISL1 "Insulin gene enhancer pr 0.486 0.266 0.666 8e-37
UNIPROTKB|F1SMF7 361 ISL1 "Uncharacterized protein" 0.486 0.257 0.666 8e-37
MGI|MGI:101791 349 Isl1 "ISL1 transcription facto 0.486 0.266 0.666 8e-37
RGD|61957 349 Isl1 "ISL LIM homeobox 1" [Rat 0.486 0.266 0.666 8e-37
UNIPROTKB|P50211 349 ISL1 "Insulin gene enhancer pr 0.486 0.266 0.666 2.1e-36
FB|FBgn0003896 534 tup "tailup" [Drosophila melan 0.481 0.172 0.688 5.1e-35
ZFIN|ZDB-GENE-980526-112 isl1 "islet1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 401 (146.2 bits), Expect = 2.4e-37, P = 2.4e-37
 Identities = 63/93 (67%), Positives = 82/93 (88%)

Query:    64 SEKNQFLDENCTCFVRDGKTYCKRDYVRLFGTKCEKCNLNFKREDFVMRAKNKIYHVQCF 123
             +E NQ+LDE+CTCFVRDGKTYCKRDY+RL+G KC KCN+ F + DFVMRA++K+YH++CF
Sbjct:    46 AECNQYLDESCTCFVRDGKTYCKRDYIRLYGIKCAKCNIGFSKNDFVMRARSKVYHIECF 105

Query:   124 CCVVCGKQLVPGDEFALREDGLFCKDDHEGMDK 156
              CV C +QL+PGDEFALREDGLFC+ DH+ +++
Sbjct:   106 RCVACSRQLIPGDEFALREDGLFCRADHDVVER 138
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=IEA;IDA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
GO:0048936 "peripheral nervous system neuron axonogenesis" evidence=IMP
GO:0031017 "exocrine pancreas development" evidence=IMP
GO:0048665 "neuron fate specification" evidence=IGI;IMP
GO:0021522 "spinal cord motor neuron differentiation" evidence=IGI
GO:0046872 "metal ion binding" evidence=IEA
GO:0007275 "multicellular organismal development" evidence=IEA
GO:0055011 "atrial cardiac muscle cell differentiation" evidence=IMP
GO:0055012 "ventricular cardiac muscle cell differentiation" evidence=IMP
UNIPROTKB|A6H796 ISL1 "ISL1 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PP21 ISL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|D6RBJ1 ISL1 "Insulin gene enhancer protein ISL-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P61371 ISL1 "Insulin gene enhancer protein ISL-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SMF7 ISL1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:101791 Isl1 "ISL1 transcription factor, LIM/homeodomain" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|61957 Isl1 "ISL LIM homeobox 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P50211 ISL1 "Insulin gene enhancer protein ISL-1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0003896 tup "tailup" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P53405ISL1_DANRENo assigned EC number0.58890.70680.3868yesN/A
P61374ISL1_RATNo assigned EC number0.58890.70680.3868yesN/A
P61371ISL1_HUMANNo assigned EC number0.58890.70680.3868yesN/A
P61372ISL1_MOUSENo assigned EC number0.58890.70680.3868yesN/A
P50211ISL1_CHICKNo assigned EC number0.58890.70680.3868yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
cd0936655 cd09366, LIM1_Isl, The first LIM domain of Isl, a 4e-32
cd0937455 cd09374, LIM2_Isl, The second LIM domain of Isl, a 3e-25
cd0947155 cd09471, LIM2_Isl2, The second LIM domain of Isl2 1e-16
cd0936954 cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of L 2e-14
cd0937354 cd09373, LIM1_AWH, The first LIM domain of Arrowhe 1e-13
cd0946964 cd09469, LIM1_Lhx2, The first LIM domain of Lhx2 1e-13
pfam0041258 pfam00412, LIM, LIM domain 9e-13
cd0937759 cd09377, LIM2_Lhx2_Lhx9, The second LIM domain of 1e-12
cd0947054 cd09470, LIM1_Lhx9, The first LIM domain of Lhx9 1e-11
cd0937855 cd09378, LIM2_Lmx1a_Lmx1b, The second LIM domain o 2e-11
cd0938755 cd09387, LIM2_LMO4, The second LIM domain of LMO4 4e-11
cd0937955 cd09379, LIM2_AWH, The second LIM domain of Arrowh 7e-11
cd0937656 cd09376, LIM2_Lhx3_Lhx4, The second LIM domain of 8e-11
cd0937556 cd09375, LIM2_Lhx1_Lhx5, The second LIM domain of 1e-10
cd0937153 cd09371, LIM1_Lmx1b, The first LIM domain of Lmx1b 2e-10
cd0947257 cd09472, LIM2_Lhx3b, The second LIM domain of Lhx3 2e-10
cd0947559 cd09475, LIM2_Lhx9, The second LIM domain of Lhx9 7e-10
cd0937052 cd09370, LIM1_Lmx1a, The first LIM domain of Lmx1a 2e-09
cd0947356 cd09473, LIM2_Lhx4, The second LIM domain of Lhx4 2e-09
smart0013254 smart00132, LIM, Zinc-binding domain present in Li 4e-09
cd0947459 cd09474, LIM2_Lhx2, The second LIM domain of Lhx2 4e-09
cd0946656 cd09466, LIM1_Lhx3a, The first LIM domain of Lhx3a 5e-09
cd0946852 cd09468, LIM1_Lhx4, The first LIM domain of Lhx4 6e-09
cd0836853 cd08368, LIM, LIM is a small protein-protein inter 8e-09
smart0013254 smart00132, LIM, Zinc-binding domain present in Li 1e-08
cd0936852 cd09368, LIM1_Lhx3_Lhx4, The first LIM domain of L 1e-08
cd0938355 cd09383, LIM2_Lhx7_Lhx8, The second LIM domain of 1e-08
cd0938156 cd09381, LIM1_Lhx7_Lhx8, The first LIM domain of L 2e-08
cd0936752 cd09367, LIM1_Lhx1_Lhx5, The first LIM domain of L 3e-08
pfam0041258 pfam00412, LIM, LIM domain 5e-08
cd0836853 cd08368, LIM, LIM is a small protein-protein inter 6e-08
cd0938655 cd09386, LIM1_LMO4, The first LIM domain of LMO4 ( 1e-07
cd0946755 cd09467, LIM1_Lhx3b, The first LIM domain of Lhx3b 2e-07
cd0938054 cd09380, LIM1_Lhx6, The first LIM domain of Lhx6 3e-07
cd0938255 cd09382, LIM2_Lhx6, The second LIM domain of Lhx6 4e-07
cd0936453 cd09364, LIM1_LIMK, The first LIM domain of LIMK ( 1e-06
cd0946274 cd09462, LIM1_LIMK1, The first LIM domain of LIMK1 1e-06
cd0946353 cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 5e-06
cd0932952 cd09329, LIM3_abLIM, The third LIM domain of actin 8e-06
cd0938955 cd09389, LIM2_LMO1_LMO3, The second LIM domain of 1e-05
cd0939055 cd09390, LIM2_dLMO, The second LIM domain of dLMO 1e-05
cd0938556 cd09385, LIM2_LMO2, The second LIM domain of LMO2 2e-05
cd0941458 cd09414, LIM1_LIMPETin, The first LIM domain of pr 9e-05
cd0938855 cd09388, LIM1_LMO1_LMO3, The first LIM domain of L 2e-04
cd0938456 cd09384, LIM1_LMO2, The first LIM domain of LMO2 ( 2e-04
cd0935460 cd09354, LIM2_LPP, The second LIM domain of lipoma 2e-04
cd0932752 cd09327, LIM1_abLIM, The first LIM domain of actin 3e-04
cd0934058 cd09340, LIM1_Testin_like, The first LIM domain of 3e-04
cd0934987 cd09349, LIM1_Zyxin, The first LIM domain of Zyxin 4e-04
cd0932856 cd09328, LIM2_abLIM, The second LIM domain on acti 0.001
cd0933653 cd09336, LIM1_Paxillin_like, The first LIM domain 0.002
cd0935853 cd09358, LIM_Mical_like, The LIM domain of Mical ( 0.003
cd0933853 cd09338, LIM3_Paxillin_like, The third LIM domain 0.003
cd0937253 cd09372, LIM2_FBLP-1, The second LIM domain of the 0.003
>gnl|CDD|188752 cd09366, LIM1_Isl, The first LIM domain of Isl, a member of LHX protein family Back     alignment and domain information 
 Score =  109 bits (275), Expect = 4e-32
 Identities = 50/55 (90%), Positives = 53/55 (96%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          CVGCGG+IHDQYILRVAPDLEWHAACL+CAEC Q+LDE CTCFVRDGKTYCKRDY
Sbjct: 1  CVGCGGKIHDQYILRVAPDLEWHAACLKCAECGQYLDETCTCFVRDGKTYCKRDY 55

The first LIM domain of Isl: Isl is a member of LHX protein family, which features two tandem N-terminal LIM domains and a C-terminal DNA binding homeodomain. Isl1 and Isl2 are the two conserved members of this family. Proteins in this group are found in the nucleus and act as transcription factors or cofactors. LHX proteins are critical for the development of specialized cells in multiple tissue types, including the nervous system, skeletal muscle, the heart, the kidneys, and endocrine organs, such as the pituitary gland and the pancreas. Isl-1 is one of the LHX proteins isolated originally by virtue of its ability to bind DNA sequences from the 5'-flanking region of the rat insulin gene in pancreatic insulin-producing cells. Mice deficient in Isl-1 fail to form the dorsal exocrine pancreas and islet cells fail to differentiate. On the other hand, Isl-1 takes part in the pituitary development by activating the gonadotropin-releasing hormone receptor gene together with LHX3 and steroidogenic factor 1. Mouse Is l2 is expressed in the retinal ganglion cells and the developing spinal cord where it plays a role in motor neuron development. Same as Isl1, Isl2 may also be able to bind to the insulin gene enhancer to promote gene activation. All LIM domains are 50-60 amino acids in size and share two characteristic zinc finger motifs. The two zinc fingers contain eight conserved residues, mostly cysteines and histidines, which coordinately bond to two zinc atoms. LIM domains function as adaptors or scaffolds to support the assembly of multimeric protein complexes. Length = 55
>gnl|CDD|188760 cd09374, LIM2_Isl, The second LIM domain of Isl, a member of LHX protein family Back     alignment and domain information
>gnl|CDD|188855 cd09471, LIM2_Isl2, The second LIM domain of Isl2 Back     alignment and domain information
>gnl|CDD|188755 cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of Lhx2 and Lhx9 family Back     alignment and domain information
>gnl|CDD|188759 cd09373, LIM1_AWH, The first LIM domain of Arrowhead (AWH) Back     alignment and domain information
>gnl|CDD|188853 cd09469, LIM1_Lhx2, The first LIM domain of Lhx2 Back     alignment and domain information
>gnl|CDD|215907 pfam00412, LIM, LIM domain Back     alignment and domain information
>gnl|CDD|188763 cd09377, LIM2_Lhx2_Lhx9, The second LIM domain of Lhx2 and Lhx9 family Back     alignment and domain information
>gnl|CDD|188854 cd09470, LIM1_Lhx9, The first LIM domain of Lhx9 Back     alignment and domain information
>gnl|CDD|188764 cd09378, LIM2_Lmx1a_Lmx1b, The second LIM domain of Lmx1a and Lmx1b Back     alignment and domain information
>gnl|CDD|188773 cd09387, LIM2_LMO4, The second LIM domain of LMO4 (LIM domain only protein 4) Back     alignment and domain information
>gnl|CDD|188765 cd09379, LIM2_AWH, The second LIM domain of Arrowhead (AWH) Back     alignment and domain information
>gnl|CDD|188762 cd09376, LIM2_Lhx3_Lhx4, The second LIM domain of Lhx3-Lhx4 family Back     alignment and domain information
>gnl|CDD|188761 cd09375, LIM2_Lhx1_Lhx5, The second LIM domain of Lhx1 (also known as Lim1) and Lhx5 Back     alignment and domain information
>gnl|CDD|188757 cd09371, LIM1_Lmx1b, The first LIM domain of Lmx1b Back     alignment and domain information
>gnl|CDD|188856 cd09472, LIM2_Lhx3b, The second LIM domain of Lhx3b Back     alignment and domain information
>gnl|CDD|188859 cd09475, LIM2_Lhx9, The second LIM domain of Lhx9 Back     alignment and domain information
>gnl|CDD|188756 cd09370, LIM1_Lmx1a, The first LIM domain of Lmx1a Back     alignment and domain information
>gnl|CDD|188857 cd09473, LIM2_Lhx4, The second LIM domain of Lhx4 Back     alignment and domain information
>gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>gnl|CDD|188858 cd09474, LIM2_Lhx2, The second LIM domain of Lhx2 Back     alignment and domain information
>gnl|CDD|188850 cd09466, LIM1_Lhx3a, The first LIM domain of Lhx3a Back     alignment and domain information
>gnl|CDD|188852 cd09468, LIM1_Lhx4, The first LIM domain of Lhx4 Back     alignment and domain information
>gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers Back     alignment and domain information
>gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>gnl|CDD|188754 cd09368, LIM1_Lhx3_Lhx4, The first LIM domain of Lhx3 and Lhx4 family Back     alignment and domain information
>gnl|CDD|188769 cd09383, LIM2_Lhx7_Lhx8, The second LIM domain of Lhx7 and Lhx8 Back     alignment and domain information
>gnl|CDD|188767 cd09381, LIM1_Lhx7_Lhx8, The first LIM domain of Lhx7 and Lhx8 Back     alignment and domain information
>gnl|CDD|188753 cd09367, LIM1_Lhx1_Lhx5, The first LIM domain of Lhx1 (also known as Lim1) and Lhx5 Back     alignment and domain information
>gnl|CDD|215907 pfam00412, LIM, LIM domain Back     alignment and domain information
>gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers Back     alignment and domain information
>gnl|CDD|188772 cd09386, LIM1_LMO4, The first LIM domain of LMO4 (LIM domain only protein 4) Back     alignment and domain information
>gnl|CDD|188851 cd09467, LIM1_Lhx3b, The first LIM domain of Lhx3b Back     alignment and domain information
>gnl|CDD|188766 cd09380, LIM1_Lhx6, The first LIM domain of Lhx6 Back     alignment and domain information
>gnl|CDD|188768 cd09382, LIM2_Lhx6, The second LIM domain of Lhx6 Back     alignment and domain information
>gnl|CDD|188750 cd09364, LIM1_LIMK, The first LIM domain of LIMK (LIM domain Kinase ) Back     alignment and domain information
>gnl|CDD|188846 cd09462, LIM1_LIMK1, The first LIM domain of LIMK1 (LIM domain Kinase 1) Back     alignment and domain information
>gnl|CDD|188847 cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 (LIM domain Kinase 2) Back     alignment and domain information
>gnl|CDD|188715 cd09329, LIM3_abLIM, The third LIM domain of actin binding LIM (abLIM) proteins Back     alignment and domain information
>gnl|CDD|188775 cd09389, LIM2_LMO1_LMO3, The second LIM domain of LMO1 and LMO3 (LIM domain only protein 1 and 3) Back     alignment and domain information
>gnl|CDD|188776 cd09390, LIM2_dLMO, The second LIM domain of dLMO (Beaderx) Back     alignment and domain information
>gnl|CDD|188771 cd09385, LIM2_LMO2, The second LIM domain of LMO2 (LIM domain only protein 2) Back     alignment and domain information
>gnl|CDD|188798 cd09414, LIM1_LIMPETin, The first LIM domain of protein LIMPETin Back     alignment and domain information
>gnl|CDD|188774 cd09388, LIM1_LMO1_LMO3, The first LIM domain of LMO1 and LMO3 (LIM domain only protein 1 and 3) Back     alignment and domain information
>gnl|CDD|188770 cd09384, LIM1_LMO2, The first LIM domain of LMO2 (LIM domain only protein 2) Back     alignment and domain information
>gnl|CDD|188740 cd09354, LIM2_LPP, The second LIM domain of lipoma preferred partner (LPP) Back     alignment and domain information
>gnl|CDD|188713 cd09327, LIM1_abLIM, The first LIM domain of actin binding LIM (abLIM) proteins Back     alignment and domain information
>gnl|CDD|188726 cd09340, LIM1_Testin_like, The first LIM domain of Testin-like family Back     alignment and domain information
>gnl|CDD|188735 cd09349, LIM1_Zyxin, The first LIM domain of Zyxin Back     alignment and domain information
>gnl|CDD|188714 cd09328, LIM2_abLIM, The second LIM domain on actin binding LIM (abLIM) proteins Back     alignment and domain information
>gnl|CDD|188722 cd09336, LIM1_Paxillin_like, The first LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188744 cd09358, LIM_Mical_like, The LIM domain of Mical (molecule interacting with CasL) like family Back     alignment and domain information
>gnl|CDD|188724 cd09338, LIM3_Paxillin_like, The third LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188758 cd09372, LIM2_FBLP-1, The second LIM domain of the filamin-binding LIM protein-1 (FBLP-1) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 191
KOG1701|consensus468 99.95
KOG4577|consensus 383 99.89
KOG1044|consensus 670 99.87
KOG2272|consensus332 99.84
KOG2272|consensus332 99.84
KOG1701|consensus468 99.84
KOG1703|consensus479 99.73
KOG1703|consensus479 99.73
KOG1044|consensus 670 99.55
PF0041258 LIM: LIM domain; InterPro: IPR001781 Zinc finger ( 99.54
PF0041258 LIM: LIM domain; InterPro: IPR001781 Zinc finger ( 99.48
KOG1700|consensus200 99.37
smart0013239 LIM Zinc-binding domain present in Lin-11, Isl-1, 98.82
smart0013239 LIM Zinc-binding domain present in Lin-11, Isl-1, 98.7
KOG4577|consensus 383 98.58
KOG1702|consensus 264 98.11
KOG0490|consensus235 97.83
KOG1700|consensus200 97.6
KOG1702|consensus264 97.42
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 90.6
PF0839437 Arc_trans_TRASH: Archaeal TRASH domain; InterPro: 88.2
PF0839437 Arc_trans_TRASH: Archaeal TRASH domain; InterPro: 86.1
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 85.82
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 82.66
KOG0490|consensus 235 80.96
PF09943101 DUF2175: Uncharacterized protein conserved in arch 80.54
>KOG1701|consensus Back     alignment and domain information 
Probab=99.95  E-value=8.6e-29  Score=201.88  Aligned_cols=155  Identities=24%  Similarity=0.512  Sum_probs=128.9

Q ss_pred             CCCcccccccccccceeEeecCCCcccccCccccccccccCCCceEEeeCCeecccchhhccc-----ccc---------
Q psy4072           3 RLSLCVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDYVSSE-----KNQ---------   68 (191)
Q Consensus         3 ~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~g~~yc~~c~~~~~-----~~~---------   68 (191)
                      .+.+|++|+|.|.++.....||++.||..||+|..|++.|.+. .||.+||++||+.||....     +.+         
T Consensus       273 ~~~iC~~C~K~V~g~~~ac~Am~~~fHv~CFtC~~C~r~L~Gq-~FY~v~~k~~CE~cyq~tlekC~~Cg~~I~d~iLrA  351 (468)
T KOG1701|consen  273 YFGICAFCHKTVSGQGLAVEAMDQLFHVQCFTCRTCRRQLAGQ-SFYQVDGKPYCEGCYQDTLEKCNKCGEPIMDRILRA  351 (468)
T ss_pred             hhhhhhhcCCcccCcchHHHHhhhhhcccceehHhhhhhhccc-cccccCCcccchHHHHHHHHHHhhhhhHHHHHHHHh
Confidence            3568999999999988877899999999999999999999999 9999999999999997532     221         


Q ss_pred             ---eecccc--------------ceeeeCCeecchhhhhhhhhhhhhhcCCCccCCC-----eEEEecCccccccccccc
Q psy4072          69 ---FLDENC--------------TCFVRDGKTYCKRDYVRLFGTKCEKCNLNFKRED-----FVMRAKNKIYHVQCFCCV  126 (191)
Q Consensus        69 ---~~~~~c--------------~~~~~~~~~~C~~c~~~~~~~~C~~C~~~I~~~~-----~~~~~~~~~~H~~Cf~C~  126 (191)
                         ..+-.|              .....++.+||.+||++.||++|+.|+++|++.|     ..|+++++.||.+|++|.
T Consensus       352 ~GkayHp~CF~Cv~C~r~ldgipFtvd~~n~v~Cv~dfh~kfAPrCs~C~~PI~P~~G~~etvRvvamdr~fHv~CY~CE  431 (468)
T KOG1701|consen  352 LGKAYHPGCFTCVVCARCLDGIPFTVDSQNNVYCVPDFHKKFAPRCSVCGNPILPRDGKDETVRVVAMDRDFHVNCYKCE  431 (468)
T ss_pred             cccccCCCceEEEEeccccCCccccccCCCceeeehhhhhhcCcchhhccCCccCCCCCcceEEEEEccccccccceehh
Confidence               111111              1236778999999999999999999999998643     346789999999999999


Q ss_pred             cCCCCCCC---CCceeeeCCccCCccccccccCCC
Q psy4072         127 VCGKQLVP---GDEFALREDGLFCKDDHEGMDKSS  158 (191)
Q Consensus       127 ~C~~~l~~---~~~~~~~~~~~~C~~c~~~~~~~~  158 (191)
                      .|+..|+.   +...+-.++.++|+.|+.++.+..
T Consensus       432 DCg~~LS~e~e~qgCyPld~HllCk~Ch~~Rl~~~  466 (468)
T KOG1701|consen  432 DCGLLLSSEEEGQGCYPLDGHLLCKTCHLKRLQAG  466 (468)
T ss_pred             hcCccccccCCCCcceeccCceeechhhhhhhccc
Confidence            99999982   445788899999999988776543

>KOG4577|consensus Back     alignment and domain information
>KOG1044|consensus Back     alignment and domain information
>KOG2272|consensus Back     alignment and domain information
>KOG2272|consensus Back     alignment and domain information
>KOG1701|consensus Back     alignment and domain information
>KOG1703|consensus Back     alignment and domain information
>KOG1703|consensus Back     alignment and domain information
>KOG1044|consensus Back     alignment and domain information
>PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1700|consensus Back     alignment and domain information
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG1700|consensus Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PF08394 Arc_trans_TRASH: Archaeal TRASH domain; InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators Back     alignment and domain information
>PF08394 Arc_trans_TRASH: Archaeal TRASH domain; InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>PF09943 DUF2175: Uncharacterized protein conserved in archaea (DUF2175); InterPro: IPR018686 This family of various hypothetical archaeal proteins has no known function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
2rgt_A169 Crystal Structure Of Lhx3 Lim Domains 1 And 2 With 2e-21
2jtn_A182 Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Compl 2e-21
3mmk_A169 The Structural Basis For Partial Redundancy In A Cl 9e-21
2dfy_X195 Crystal Structure Of A Cyclized Protein Fusion Of L 3e-19
1rut_X188 Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 L 3e-19
2xjy_A131 Crystal Structure Of The Lmo2:ldb1-Lid Complex, P21 4e-11
2l6y_B96 Haddock Model Of Gata1nf:lmo2lim2-Ldb1lid Length = 1e-06
2lxd_A125 Backbone 1h, 13c, And 15n Chemical Shift Assignment 1e-06
2l4z_A123 Nmr Structure Of Fusion Of Ctip (641-685) To Lmo4-L 4e-06
1m3v_A122 Flin4: Fusion Of The Lim Binding Domain Of Ldb1 And 2e-05
1v6g_A81 Solution Structure Of The Lim Domain Of The Human A 1e-04
>pdb|2RGT|A Chain A, Crystal Structure Of Lhx3 Lim Domains 1 And 2 With The Binding Domain Of Isl1 Length = 169 Back     alignment and structure 
Iteration: 1

 Score = 98.6 bits (244), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 74/150 (49%), Gaps = 32/150 (21%)
Query: 4   LSLCVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDYVS 63
           + +C GC   I D++IL+ A D  WH+ CL+C++CH  L E C                 
Sbjct: 6   IPMCAGCDQHILDRFILK-ALDRHWHSKCLKCSDCHVPLAERC----------------- 47
Query: 64  SEKNQFLDENCTCFVRDGKTYCKRDYVRLFGTKCEKCNLNFKREDFVMRAKNKIYHVQCF 123
                        F R    YCK D+ + FGTKC  C L       V RA++ +YH+ CF
Sbjct: 48  -------------FSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCF 94
Query: 124 CCVVCGKQLVPGDEFALREDG-LFCKDDHE 152
            CVVC +QL  GDEF L ED  L CK D+E
Sbjct: 95  ACVVCKRQLATGDEFYLMEDSRLVCKADYE 124
>pdb|2JTN|A Chain A, Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Complex Length = 182 Back     alignment and structure
>pdb|3MMK|A Chain A, The Structural Basis For Partial Redundancy In A Class Of Transcription Factors, The Lim-Homeodomain Proteins, In Neural Cell Type Specification Length = 169 Back     alignment and structure
>pdb|2DFY|X Chain X, Crystal Structure Of A Cyclized Protein Fusion Of Lmo4 Lim Domains 1 And 2 With The Lim Interacting Domain Of Ldb1 Length = 195 Back     alignment and structure
>pdb|1RUT|X Chain X, Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 Lid Domain Length = 188 Back     alignment and structure
>pdb|2XJY|A Chain A, Crystal Structure Of The Lmo2:ldb1-Lid Complex, P21 Crystal Form Length = 131 Back     alignment and structure
>pdb|2L6Y|B Chain B, Haddock Model Of Gata1nf:lmo2lim2-Ldb1lid Length = 96 Back     alignment and structure
>pdb|2LXD|A Chain A, Backbone 1h, 13c, And 15n Chemical Shift Assignments For Lmo2(Lim2)- Ldb1(Lid) Length = 125 Back     alignment and structure
>pdb|2L4Z|A Chain A, Nmr Structure Of Fusion Of Ctip (641-685) To Lmo4-Lim1 (18-82) Length = 123 Back     alignment and structure
>pdb|1M3V|A Chain A, Flin4: Fusion Of The Lim Binding Domain Of Ldb1 And The N- Terminal Lim Domain Of Lmo4 Length = 122 Back     alignment and structure
>pdb|1V6G|A Chain A, Solution Structure Of The Lim Domain Of The Human Actin Binding Lim Protein 2 Length = 81 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 1e-39
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 1e-10
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 5e-39
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 7e-39
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 5e-11
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 1e-33
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 2e-06
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 4e-25
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 2e-10
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 8e-25
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 1e-23
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 3e-20
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 1e-09
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 8e-20
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 2e-17
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 3e-04
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 1e-16
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 2e-06
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 2e-16
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 4e-07
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 1e-15
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 7e-06
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 4e-15
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 7e-06
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 4e-05
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 1e-14
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 6e-05
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 1e-13
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 4e-05
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 3e-13
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 2e-12
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 4e-07
2cuq_A80 Four and A half LIM domains 3; structural genomics 6e-12
2cuq_A80 Four and A half LIM domains 3; structural genomics 6e-05
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 7e-12
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 2e-07
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 4e-11
3f6q_B72 LIM and senescent cell antigen-like-containing dom 4e-11
3f6q_B72 LIM and senescent cell antigen-like-containing dom 6e-04
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 9e-11
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 7e-05
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 4e-10
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 1e-04
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 8e-10
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 3e-06
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 2e-09
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 3e-06
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 6e-09
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 8e-06
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 6e-09
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 2e-07
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 1e-08
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 5e-08
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 1e-07
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 1e-06
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 2e-07
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 2e-05
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 3e-07
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 8e-06
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 3e-07
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 7e-05
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 2e-06
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 9e-05
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 5e-06
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 5e-05
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 6e-06
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 9e-05
2co8_A82 NEDD9 interacting protein with calponin homology a 6e-06
2co8_A82 NEDD9 interacting protein with calponin homology a 2e-04
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 7e-06
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 1e-05
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 2e-05
2cor_A79 Pinch protein; LIM domain, particularly interestin 1e-05
2cor_A79 Pinch protein; LIM domain, particularly interestin 5e-04
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 3e-04
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
 Score =  132 bits (333), Expect = 1e-39
 Identities = 57/153 (37%), Positives = 74/153 (48%), Gaps = 32/153 (20%)

Query: 1   KRRLSLCVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRD 60
              + +C GC   I D++IL+ A D  WH+ CL+C++CH  L E                
Sbjct: 57  TPEIPMCAGCDQHILDRFILK-ALDRHWHSKCLKCSDCHVPLAE---------------- 99

Query: 61  YVSSEKNQFLDENCTCFVRDGKTYCKRDYVRLFGTKCEKCNLNFKREDFVMRAKNKIYHV 120
                          CF R    YCK D+ + FGTKC  C L       V RA++ +YH+
Sbjct: 100 --------------RCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHL 145

Query: 121 QCFCCVVCGKQLVPGDEFALREDG-LFCKDDHE 152
            CF CVVC +QL  GDEF L ED  L CK D+E
Sbjct: 146 HCFACVVCKRQLATGDEFYLMEDSRLVCKADYE 178
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 73 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Length = 65 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query191
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 99.97
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 99.97
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 99.96
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 99.96
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 99.95
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 99.95
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 99.93
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 99.87
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 99.83
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 99.8
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 99.8
2cuq_A80 Four and A half LIM domains 3; structural genomics 99.77
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 99.76
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 99.75
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 99.74
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 99.74
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 99.7
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 99.69
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 99.66
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 99.65
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.64
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 99.64
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 99.64
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 99.64
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 99.64
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 99.63
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 99.62
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 99.61
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.61
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 99.6
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.6
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 99.6
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 99.59
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 99.59
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 99.59
2cuq_A80 Four and A half LIM domains 3; structural genomics 99.59
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.58
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 99.57
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 99.57
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 99.57
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 99.57
3f6q_B72 LIM and senescent cell antigen-like-containing dom 99.56
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 99.56
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 99.56
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 99.56
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 99.56
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 99.55
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 99.54
2cor_A79 Pinch protein; LIM domain, particularly interestin 99.54
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 99.54
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 99.54
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 99.54
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 99.53
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 99.53
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 99.53
3f6q_B72 LIM and senescent cell antigen-like-containing dom 99.52
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 99.52
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 99.52
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 99.52
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 99.51
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 99.5
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 99.5
2co8_A82 NEDD9 interacting protein with calponin homology a 99.49
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 99.49
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 99.49
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 99.48
2cor_A79 Pinch protein; LIM domain, particularly interestin 99.48
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 99.47
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 99.47
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 99.47
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 99.46
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 99.46
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 99.45
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 99.45
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 99.42
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 99.41
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 99.4
2co8_A82 NEDD9 interacting protein with calponin homology a 99.4
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 99.34
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 99.27
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 99.25
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 99.25
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 99.25
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 99.16
1zfo_A31 LAsp-1; LIM domain, zinc-finger, metal-binding pro 97.93
1zfo_A31 LAsp-1; LIM domain, zinc-finger, metal-binding pro 97.55
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 81.02
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Back     alignment and structure
Probab=99.97  E-value=6.2e-32  Score=194.20  Aligned_cols=126  Identities=37%  Similarity=0.814  Sum_probs=112.2

Q ss_pred             CCcccccccccccceeEeecCCCcccccCccccccccccCC-CceEEeeCCeecccchhhcccccceeccccceeeeCCe
Q psy4072           4 LSLCVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDE-NCTCFVRDGKTYCKRDYVSSEKNQFLDENCTCFVRDGK   82 (191)
Q Consensus         4 ~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~-~~~~~~~~g~~yc~~c~~~~~~~~~~~~~c~~~~~~~~   82 (191)
                      .++|++|+++|.+++++ .++|+.||++||+|..|+++|.. ...|                            ++++|+
T Consensus         2 ~~~C~~C~~~I~~~~~~-~a~~~~wH~~CF~C~~C~~~L~~~~~~~----------------------------~~~~g~   52 (131)
T 2xjy_A            2 LLTCGGCQQNIGDRYFL-KAIDQYWHEDCLSCDLCGCRLGEVGRRL----------------------------YYKLGR   52 (131)
T ss_dssp             CCBBTTTCCBCCSSEEE-EETTEEEETTTCBCTTTCCBCSSTTCCE----------------------------EEETTE
T ss_pred             cccCcCCCCEeCCcEEE-EECCCcccHHHcccCcCCCccccCCCeE----------------------------EEECCE
Confidence            57899999999998766 48999999999999999999974 2134                            459999


Q ss_pred             ecchhhhhhhhhh--hhhhcCCCccCCCeEEEecCccccccccccccCCCCCCCCCceeeeCCccCCccccccccCCC
Q psy4072          83 TYCKRDYVRLFGT--KCEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDDHEGMDKSS  158 (191)
Q Consensus        83 ~~C~~c~~~~~~~--~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~c~~~~~~~~  158 (191)
                      |||+.||.+++++  +|.+|+++|.+.|.++.+.++.||++||+|..|+++|..+..|+..++++||..||.++++++
T Consensus        53 ~yC~~~y~~~~~~~~~C~~C~~~I~~~e~~~~a~~~~~H~~CF~C~~C~~~L~~g~~f~~~~~~~~C~~c~~~~~~~~  130 (131)
T 2xjy_A           53 KLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKIN  130 (131)
T ss_dssp             EECHHHHHHHHCCCEECTTTCCEECTTSEEEEETTEEEEGGGCBCTTTCCBCCTTCEEEEETTEEEEGGGHHHHHHHH
T ss_pred             EeecCchhhhCCCccChhhcCCccCccceeEeeCCceECccCcccCCCCCCCCCCCEEEEECCEEEcHHHHHHHhhcc
Confidence            9999999999998  999999999987788999999999999999999999965778999999999999999887653
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
>1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 Back     alignment and structure
>1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 191
d1rutx331 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus 1e-05
d1b8ta449 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) pr 1e-05
d1b8ta449 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) pr 2e-05
d1x3ha135 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [ 1e-04
d1rutx130 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus m 4e-04
d1j2oa130 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus m 0.003
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Length = 31 Back     information, alignment and structure

class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: LIM domain
domain: LIM only 4 (Lmo4)
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 38.5 bits (90), Expect = 1e-05
 Identities = 10/27 (37%), Positives = 16/27 (59%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCF 123
           C  C  +    + VMRA+  +YH++CF
Sbjct: 5   CSACGQSIPASELVMRAQGNVYHLKCF 31
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 49 Back     information, alignment and structure
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 49 Back     information, alignment and structure
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Length = 30 Back     information, alignment and structure
>d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Length = 30 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query191
d1x3ha135 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 99.1
d1x63a137 Four and a half LIM domains protein 1, FHL-1 {Huma 98.86
d1x3ha135 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 98.76
d1g47a235 Pinch (particularly interesting new Cys-His) prote 98.76
d2dara245 PDZ and LIM domain protein 5, Enigma {Human (Homo 98.75
d2cuqa235 Four and a half LIM domains 3, FHL3 {Human (Homo s 98.69
d2dloa135 Thyroid receptor interacting protein 6, TRIP6 {Hum 98.55
d1u5sb131 Pinch (particularly interesting new Cys-His) prote 98.54
d1j2oa130 Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 98.48
d1g47a235 Pinch (particularly interesting new Cys-His) prote 98.47
d1rutx130 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 98.44
d2dara245 PDZ and LIM domain protein 5, Enigma {Human (Homo 98.38
d2dj7a236 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 98.36
d2dj7a131 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 98.29
d2d8za232 Four and a half LIM domains protein 2, FHL2 {Human 98.25
d2d8za232 Four and a half LIM domains protein 2, FHL2 {Human 98.25
d1x63a137 Four and a half LIM domains protein 1, FHL-1 {Huma 98.24
d1v6ga141 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 98.23
d2d8xa226 Pinch (particularly interesting new Cys-His) prote 98.22
d1ibia231 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 98.21
d1b8ta449 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 98.19
d1u5sb131 Pinch (particularly interesting new Cys-His) prote 98.16
d1rutx331 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 98.14
d2dloa135 Thyroid receptor interacting protein 6, TRIP6 {Hum 98.13
d1zfoa_30 LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} 98.12
d2d8xa226 Pinch (particularly interesting new Cys-His) prote 98.09
d2cuqa132 Four and a half LIM domains 3, FHL3 {Human (Homo s 98.07
d2d8ya242 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 98.07
d2cuqa132 Four and a half LIM domains 3, FHL3 {Human (Homo s 98.04
d2cu8a130 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 98.03
d1x3ha232 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 98.03
d2cuqa235 Four and a half LIM domains 3, FHL3 {Human (Homo s 98.01
d1x4ka227 Four and a half LIM domains protein 2, FHL2 {Human 97.94
d2d8za126 Four and a half LIM domains protein 2, FHL2 {Human 97.92
d1imla248 Cysteine-rich (intestinal) protein, CRP, CRIP {Rat 97.92
d1rutx130 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 97.91
d1x4la129 Four and a half LIM domains protein 2, FHL2 {Human 97.89
d1b8ta449 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 97.88
d1wyha227 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.87
d1x4ka227 Four and a half LIM domains protein 2, FHL2 {Human 97.85
d2d8za126 Four and a half LIM domains protein 2, FHL2 {Human 97.83
d1u5sb235 Pinch (particularly interesting new Cys-His) prote 97.82
d1b8ta343 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 97.8
d2d8ya242 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 97.79
d2d8ya135 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 97.78
d1wyha227 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.77
d1j2oa130 Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 97.76
d2cu8a130 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 97.74
d2co8a236 Nedd9 interacting protein with calponin homology, 97.73
d2cura226 Four and a half LIM domains protein 1, FHL-1 {Huma 97.73
d1u5sb235 Pinch (particularly interesting new Cys-His) prote 97.69
d1x68a129 Four and a half LIM domains protein 5, FHL-5 {Huma 97.69
d1x3ha232 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 97.69
d1imla248 Cysteine-rich (intestinal) protein, CRP, CRIP {Rat 97.68
d1zfoa_30 LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} 97.68
d2cura226 Four and a half LIM domains protein 1, FHL-1 {Huma 97.68
d2cupa327 Four and a half LIM domains protein 1, FHL-1 {Huma 97.67
d1x4ka132 Four and a half LIM domains protein 2, FHL2 {Human 97.64
d1wyha132 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.63
d1b8ta265 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 97.62
d2cu8a233 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 97.58
d1rutx331 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 97.58
d1b8ta265 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 97.57
d1x6aa134 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 97.55
d2dj7a236 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 97.55
d2dj7a131 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 97.55
d1b8ta343 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 97.54
d2d8ya135 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 97.51
d1x4ka132 Four and a half LIM domains protein 2, FHL2 {Human 97.51
d1ibia231 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.5
d1ibia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.48
d1wyha132 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.48
d1x4la129 Four and a half LIM domains protein 2, FHL2 {Human 97.47
d2dara132 PDZ and LIM domain protein 5, Enigma {Human (Homo 97.44
d1x62a235 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 97.44
d1a7ia232 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.41
d1x68a129 Four and a half LIM domains protein 5, FHL-5 {Huma 97.35
d1x64a145 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 97.34
d2dara132 PDZ and LIM domain protein 5, Enigma {Human (Homo 97.33
d2cupa327 Four and a half LIM domains protein 1, FHL-1 {Huma 97.33
d2co8a236 Nedd9 interacting protein with calponin homology, 97.28
d1x62a235 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 97.27
d1x61a232 Thyroid receptor interacting protein 6, TRIP6 {Hum 97.26
d2cu8a233 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 97.26
d1ibia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.25
d2cura131 Four and a half LIM domains protein 1, FHL-1 {Huma 97.2
d1x64a145 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 97.17
d1x61a127 Thyroid receptor interacting protein 6, TRIP6 {Hum 97.09
d2cura131 Four and a half LIM domains protein 1, FHL-1 {Huma 97.09
d2dloa233 Thyroid receptor interacting protein 6, TRIP6 {Hum 96.97
d1wiga132 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 96.77
d1v6ga141 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 96.71
d2dloa233 Thyroid receptor interacting protein 6, TRIP6 {Hum 96.7
d1a7ia232 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 96.7
d1x6aa234 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 96.67
d1a7ia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 96.6
d1b8ta135 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 96.57
d1wiga132 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 96.53
d1x64a231 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 96.41
d1g47a135 Pinch (particularly interesting new Cys-His) prote 96.36
d1x61a232 Thyroid receptor interacting protein 6, TRIP6 {Hum 96.2
d1x63a232 Four and a half LIM domains protein 1, FHL-1 {Huma 96.08
d1g47a135 Pinch (particularly interesting new Cys-His) prote 95.86
d1x6aa134 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 95.84
d1a7ia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 95.58
d1rutx433 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 95.56
d1wiga241 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 95.53
d1b8ta135 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 95.48
d1x61a127 Thyroid receptor interacting protein 6, TRIP6 {Hum 95.47
d1x63a232 Four and a half LIM domains protein 1, FHL-1 {Huma 95.43
d2cupa231 Four and a half LIM domains protein 1, FHL-1 {Huma 95.39
d1rutx433 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 95.31
d2cora131 Pinch (particularly interesting new Cys-His) prote 95.24
d1x62a131 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 95.21
d1x64a231 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 94.92
d1x6aa234 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 94.67
d2cora131 Pinch (particularly interesting new Cys-His) prote 93.35
d2cupa231 Four and a half LIM domains protein 1, FHL-1 {Huma 92.93
d1v6ga240 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 92.9
d2cora235 Pinch (particularly interesting new Cys-His) prote 92.74
d1wiga241 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 91.29
d1rutx234 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 91.28
d2d8xa132 Pinch (particularly interesting new Cys-His) prote 87.52
d2cora235 Pinch (particularly interesting new Cys-His) prote 87.15
d2d8xa132 Pinch (particularly interesting new Cys-His) prote 85.64
d1x68a234 Four and a half LIM domains protein 5, FHL-5 {Huma 84.65
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 80.65
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: LIM domain
domain: Leupaxin
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.10  E-value=3.2e-12  Score=68.14  Aligned_cols=35  Identities=29%  Similarity=0.790  Sum_probs=31.9

Q ss_pred             hhhhhhhhhhhhhcCCCccCCCeEEEecCcccccccc
Q psy4072          87 RDYVRLFGTKCEKCNLNFKREDFVMRAKNKIYHVQCF  123 (191)
Q Consensus        87 ~c~~~~~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf  123 (191)
                      +||.++|+++|.+|+++|.  +.+|+|+++.||++||
T Consensus         1 ~DY~~~fapkC~~C~~~I~--g~~v~Al~~~wHpeCF   35 (35)
T d1x3ha1           1 KDFLAMFSPKCGGCNRPVL--ENYLSAMDTVWHPECF   35 (35)
T ss_dssp             CCCCCCCSCBCTTTCCBCC--SSCEEETTEEECTTTC
T ss_pred             CcHHHHhChhhhhcCCccc--chheeecCCccCcccC
Confidence            3788999999999999998  4589999999999998
>d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ga2 g.39.1.3 (A:42-81) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx2 g.39.1.3 (X:49-82) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x68a2 g.39.1.3 (A:37-70) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure