Psyllid ID: psy4190
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 90 | ||||||
| 322791203 | 797 | hypothetical protein SINV_13859 [Solenop | 0.577 | 0.065 | 0.807 | 4e-21 | |
| 332024411 | 1148 | MOG interacting and ectopic P-granules p | 0.577 | 0.045 | 0.807 | 5e-21 | |
| 307181772 | 1110 | MOG interacting and ectopic P-granules p | 0.577 | 0.046 | 0.807 | 5e-21 | |
| 242022406 | 1177 | conserved hypothetical protein [Pediculu | 0.577 | 0.044 | 0.807 | 1e-20 | |
| 345494979 | 1080 | PREDICTED: hypothetical protein LOC10012 | 0.577 | 0.048 | 0.788 | 2e-20 | |
| 345494973 | 1029 | PREDICTED: hypothetical protein LOC10012 | 0.577 | 0.050 | 0.788 | 2e-20 | |
| 345494977 | 1034 | PREDICTED: hypothetical protein LOC10012 | 0.577 | 0.050 | 0.788 | 2e-20 | |
| 307200554 | 1026 | MOG interacting and ectopic P-granules p | 0.577 | 0.050 | 0.788 | 3e-20 | |
| 345494975 | 1086 | PREDICTED: hypothetical protein LOC10012 | 0.577 | 0.047 | 0.788 | 5e-20 | |
| 383864390 | 1125 | PREDICTED: uncharacterized protein LOC10 | 0.577 | 0.046 | 0.769 | 5e-20 |
| >gi|322791203|gb|EFZ15739.1| hypothetical protein SINV_13859 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
Score = 105 bits (261), Expect = 4e-21, Method: Composition-based stats.
Identities = 42/52 (80%), Positives = 48/52 (92%)
Query: 1 MYHMEAEHNVRGRLEKAPAFHQCPSCLFEDNQKGKLTRHLLSCAKKYRPERN 52
+YHMEAEHN RGRLE+ PAFHQCP+C FEDNQKGKLTRH+L+C KK+RPERN
Sbjct: 665 LYHMEAEHNTRGRLERGPAFHQCPNCPFEDNQKGKLTRHILACTKKFRPERN 716
|
Source: Solenopsis invicta Species: Solenopsis invicta Genus: Solenopsis Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|332024411|gb|EGI64609.1| MOG interacting and ectopic P-granules protein 1 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307181772|gb|EFN69224.1| MOG interacting and ectopic P-granules protein 1 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|242022406|ref|XP_002431631.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212516939|gb|EEB18893.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|345494979|ref|XP_001605066.2| PREDICTED: hypothetical protein LOC100121453 isoform 1 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|345494973|ref|XP_003427409.1| PREDICTED: hypothetical protein LOC100121453 isoform 2 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|345494977|ref|XP_003427411.1| PREDICTED: hypothetical protein LOC100121453 isoform 4 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|307200554|gb|EFN80706.1| MOG interacting and ectopic P-granules protein 1 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|345494975|ref|XP_003427410.1| PREDICTED: hypothetical protein LOC100121453 isoform 3 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|383864390|ref|XP_003707662.1| PREDICTED: uncharacterized protein LOC100877073 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 90 | ||||||
| FB|FBgn0035357 | 1152 | MEP-1 [Drosophila melanogaster | 0.577 | 0.045 | 0.615 | 2.2e-12 |
| FB|FBgn0035357 MEP-1 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 179 (68.1 bits), Expect = 2.2e-12, P = 2.2e-12
Identities = 32/52 (61%), Positives = 38/52 (73%)
Query: 1 MYHMEAEHNVRGRLEKAPAFHQCPSCLFEDNQKGKLTRHLLSCAKKYRPERN 52
+YHMEA HN++ RL K +HQCP+C FEDN K KL RH CAKK+RPE N
Sbjct: 726 VYHMEAVHNIKARLIKPLPYHQCPNCGFEDNGKAKLARHQPVCAKKFRPELN 777
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.322 0.135 0.428 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 90 90 0.00091 102 3 11 22 0.46 29
29 0.39 31
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 1
No. of states in DFA: 564 (60 KB)
Total size of DFA: 119 KB (2077 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00
No. of threads or processors used: 24
Search cpu time: 10.78u 0.07s 10.85t Elapsed: 00:00:11
Total cpu time: 10.78u 0.07s 10.85t Elapsed: 00:00:11
Start: Thu Aug 15 13:57:15 2013 End: Thu Aug 15 13:57:26 2013
|
|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
No hit with e-value below 0.005
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 90 | |||
| PF13909 | 24 | zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W | 96.86 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 95.65 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 94.4 | |
| smart00355 | 26 | ZnF_C2H2 zinc finger. | 91.39 | |
| PHA00732 | 79 | hypothetical protein | 87.96 | |
| PHA00616 | 44 | hypothetical protein | 85.71 | |
| PF05253 | 27 | zf-U11-48K: U11-48K-like CHHC zinc finger; InterPr | 84.05 |
| >PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A | Back alignment and domain information |
|---|
Probab=96.86 E-value=0.00043 Score=34.95 Aligned_cols=21 Identities=38% Similarity=0.868 Sum_probs=17.0
Q ss_pred CCCCCCccccccchhhhhhHHH
Q psy4190 21 HQCPSCLFEDNQKGKLTRHLLS 42 (90)
Q Consensus 21 HQCP~CPFEDN~KgKLtRH~is 42 (90)
|+|+.|+|..+ +..|.+|+..
T Consensus 1 y~C~~C~y~t~-~~~l~~H~~~ 21 (24)
T PF13909_consen 1 YKCPHCSYSTS-KSNLKRHLKR 21 (24)
T ss_dssp EE-SSSS-EES-HHHHHHHHHH
T ss_pred CCCCCCCCcCC-HHHHHHHHHh
Confidence 68999999999 9999999853
|
|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >smart00355 ZnF_C2H2 zinc finger | Back alignment and domain information |
|---|
| >PHA00732 hypothetical protein | Back alignment and domain information |
|---|
| >PHA00616 hypothetical protein | Back alignment and domain information |
|---|
| >PF05253 zf-U11-48K: U11-48K-like CHHC zinc finger; InterPro: IPR022776 This zinc binding domain [] has four conserved zinc chelating residues in a CHHC pattern | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 90 | |||
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 95.65 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 94.75 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 93.91 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 93.78 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 93.47 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 93.34 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 93.1 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 92.84 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 92.39 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 92.25 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 92.21 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 92.11 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 91.89 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 91.87 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 91.75 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 91.73 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 91.66 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 91.19 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 91.17 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 91.15 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 91.14 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 91.06 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 90.87 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 90.86 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 90.74 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 90.74 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 90.72 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 90.69 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 90.61 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 90.43 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 90.41 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 90.36 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 90.29 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 90.27 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 90.23 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 90.17 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 89.9 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 89.9 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 89.87 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 89.35 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 89.77 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 89.76 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 89.73 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 89.7 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 89.7 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 89.64 | |
| 2vy4_A | 37 | U11/U12 small nuclear ribonucleoprotein 48 kDa pro | 89.63 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 89.18 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 89.57 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 89.57 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 89.53 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 89.35 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 89.32 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 89.3 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 89.24 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 89.15 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 89.08 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 89.02 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 88.99 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 88.97 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 88.95 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 88.94 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 88.47 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 88.75 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 88.74 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 88.7 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 88.65 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 88.64 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 88.61 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 88.37 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 88.34 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 88.31 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 88.29 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 88.26 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 88.21 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 88.18 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 88.16 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 88.16 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 88.13 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 88.12 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 88.1 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 88.07 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 88.06 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 88.03 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 87.98 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 87.97 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 87.91 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 87.9 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 87.9 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 87.9 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 87.85 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 87.81 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 87.73 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 87.73 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 87.73 | |
| 2kfq_A | 32 | FP1; protein, de novo protein; NMR {Synthetic} | 87.62 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 87.59 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 87.48 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 87.42 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 87.37 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 87.36 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 87.3 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 87.25 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 87.21 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 87.21 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 87.17 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 87.14 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 87.1 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 87.09 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 87.08 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 87.05 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 87.03 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 86.99 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 86.97 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 86.97 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 86.94 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 86.94 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 86.93 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 86.87 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 86.86 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 86.69 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 86.62 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 86.56 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 86.55 | |
| 1sp2_A | 31 | SP1F2; zinc finger, transcription activation; NMR | 86.55 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 86.53 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 86.53 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 86.5 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 86.41 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 86.39 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 86.3 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 86.22 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 86.2 | |
| 1yui_A | 54 | GAGA-factor; complex (DNA-binding protein/DNA), ch | 86.07 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 86.02 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 86.02 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 85.96 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 85.94 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 85.78 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 85.71 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 85.67 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 85.65 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 85.43 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 85.36 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 85.32 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 84.97 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 84.87 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 84.81 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 84.78 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 84.65 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 84.64 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 84.5 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 84.42 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 84.32 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 84.29 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 84.24 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 84.22 | |
| 1zfd_A | 32 | SWI5; DNA binding motif, zinc finger DNA binding d | 84.22 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 84.21 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 84.13 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 83.8 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 83.5 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 83.43 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 83.16 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 83.15 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 83.08 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 83.07 | |
| 1zw8_A | 64 | Zinc-responsive transcriptional regulator ZAP1; in | 82.97 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 82.83 | |
| 3iuf_A | 48 | Zinc finger protein UBI-D4; structural genomics co | 82.56 | |
| 2ab3_A | 29 | ZNF29; zinc finger protein, beta BETA alpha, RREII | 82.52 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 82.26 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 82.09 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 82.07 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 82.07 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 81.77 | |
| 2epp_A | 66 | POZ-, at HOOK-, and zinc finger-containing protein | 81.57 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 81.22 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 81.04 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 80.69 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 80.4 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 80.06 |
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
Probab=95.65 E-value=0.0029 Score=37.15 Aligned_cols=38 Identities=21% Similarity=0.413 Sum_probs=31.4
Q ss_pred CCCCCCCCccccccchhhhhhHHHhhhhccCCccCCCC
Q psy4190 19 AFHQCPSCLFEDNQKGKLTRHLLSCAKKYRPERNQVRK 56 (90)
Q Consensus 19 ~~HQCP~CPFEDN~KgKLtRH~isCaKKF~pe~Nl~Pp 56 (90)
..|+|+.|...-..+..|.+|+..|.+.+.......+.
T Consensus 64 ~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~ 101 (110)
T 2csh_A 64 KPYECNICAKRFMWRDSFHRHVTSCTKSYEAAKAEQNT 101 (110)
T ss_dssp CCEECSSSCCEESCHHHHHHHHHHHHHHHHHHHCTTCC
T ss_pred CCeeCCCCcchhcCHHHHHHHHHHccccccchhhcccc
Confidence 35899999999999999999999999998765444443
|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2vy4_A U11/U12 small nuclear ribonucleoprotein 48 kDa protein; splicing, mRNA processing, alternative splicing, transcription, nucleus, spliceosome; NMR {Homo sapiens} SCOP: g.37.1.7 PDB: 2vy5_A | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2kfq_A FP1; protein, de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 90 | |||
| d2vy4a1 | 35 | U11/U12 small nuclear ribonucleoprotein 48 kDa pro | 93.73 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 91.73 | |
| d1x5wa2 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 91.71 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 88.66 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 88.31 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 85.39 | |
| d1bboa2 | 29 | Enhancer binding protein {Human (Homo sapiens) [Ta | 84.93 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 84.64 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 84.37 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 80.92 | |
| d2ct1a1 | 28 | Transcriptional repressor CTCF {Human (Homo sapien | 80.76 |
| >d2vy4a1 g.37.1.7 (A:53-87) U11/U12 small nuclear ribonucleoprotein 48 kDa protein, U11-48K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: beta-beta-alpha zinc fingers superfamily: beta-beta-alpha zinc fingers family: CHHC finger domain: U11/U12 small nuclear ribonucleoprotein 48 kDa protein, U11-48K species: Human (Homo sapiens) [TaxId: 9606]
Probab=93.73 E-value=0.015 Score=32.62 Aligned_cols=20 Identities=35% Similarity=0.873 Sum_probs=17.8
Q ss_pred CCcccccc---chhhhhhHHHhh
Q psy4190 25 SCLFEDNQ---KGKLTRHLLSCA 44 (90)
Q Consensus 25 ~CPFEDN~---KgKLtRH~isCa 44 (90)
-|||.+|- |+.|++|+.+|-
T Consensus 5 ~CPyD~nH~mPksSL~kH~asCr 27 (35)
T d2vy4a1 5 ICPYDSNHHMPKSSLAKHMASCR 27 (35)
T ss_dssp ECTTTSSCEECGGGHHHHHHHHH
T ss_pred eCCCcccCcCcHHHHHHHHHHhh
Confidence 49999994 899999999995
|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|