Psyllid ID: psy4297


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------7
MECLVANVENIKFDIEIALENQHDILPSPFPGMDKSMTAVCEFYVRGECNKDTMCPLRPGLATPVLGAS
ccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccc
ccEEEEcccccEEEHHHHHHHHcccccccccccccccHHHHHHHHcccccccccccccccccccccccc
MECLVANVENIKFDIEIALEnqhdilpspfpgmdksmTAVCEFYVrgecnkdtmcplrpglatpvlgas
MECLVANVENIKFDIEIALENQHDILPSPFPGMDKSMTAVCEFYVRGEcnkdtmcplrpglatpvlgas
MECLVANVENIKFDIEIALENQHDILPSPFPGMDKSMTAVCEFYVRGECNKDTMCPLRPGLATPVLGAS
**CLVANVENIKFDIEIALENQHDILPSPFPGMDKSMTAVCEFYVRGECNKDTMCPLRPG*********
*ECLVANVENIKFDIEIALENQHDILPSPFPGMDKSMTAVCEFYVRGECNKDTMCPLRPGLATPVLG**
MECLVANVENIKFDIEIALENQHDILPSPFPGMDKSMTAVCEFYVRGECNKDTMCPLRPGLATPVLGAS
*ECLVANVENIKFDIEIALENQHDILPSPFPGMDKSMTAVCEFYVRGECNKDTMCPLRPGLATPVLG**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MECLVANVENIKFDIEIALENQHDILPSPFPGMDKSMTAVCEFYVRGECNKDTMCPLRPGLATPVLGAS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query69 2.2.26 [Sep-21-2011]
Q5FVR7 243 Cleavage and polyadenylat yes N/A 0.840 0.238 0.551 5e-13
Q8BQZ5 211 Cleavage and polyadenylat yes N/A 0.840 0.274 0.551 6e-13
O19137 243 Cleavage and polyadenylat yes N/A 0.840 0.238 0.551 8e-13
O95639 269 Cleavage and polyadenylat no N/A 0.840 0.215 0.551 8e-13
Q66KE3 269 Cleavage and polyadenylat yes N/A 0.840 0.215 0.534 3e-12
Q6DJP7 269 Cleavage and polyadenylat N/A N/A 0.840 0.215 0.517 9e-12
A6NMK7 179 Putative cleavage and pol no N/A 0.840 0.324 0.413 9e-07
>sp|Q5FVR7|CPSF4_RAT Cleavage and polyadenylation specificity factor subunit 4 OS=Rattus norvegicus GN=Cpsf4 PE=2 SV=1 Back     alignment and function desciption
 Score = 72.8 bits (177), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 43/58 (74%)

Query: 1  MECLVANVENIKFDIEIALENQHDILPSPFPGMDKSMTAVCEFYVRGECNKDTMCPLR 58
          M+ ++A+V++IKFD+EIA+E Q    P PFPGMDKS  AVCEF+++  C K  MCP R
Sbjct: 1  MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFR 58




Component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. CPSF4 binds RNA polymers with a preference for poly(U).
Rattus norvegicus (taxid: 10116)
>sp|Q8BQZ5|CPSF4_MOUSE Cleavage and polyadenylation specificity factor subunit 4 OS=Mus musculus GN=Cpsf4 PE=2 SV=1 Back     alignment and function description
>sp|O19137|CPSF4_BOVIN Cleavage and polyadenylation specificity factor subunit 4 OS=Bos taurus GN=CPSF4 PE=2 SV=1 Back     alignment and function description
>sp|O95639|CPSF4_HUMAN Cleavage and polyadenylation specificity factor subunit 4 OS=Homo sapiens GN=CPSF4 PE=1 SV=1 Back     alignment and function description
>sp|Q66KE3|CPSF4_XENTR Cleavage and polyadenylation specificity factor subunit 4 OS=Xenopus tropicalis GN=cpsf4 PE=2 SV=1 Back     alignment and function description
>sp|Q6DJP7|CPSF4_XENLA Cleavage and polyadenylation specificity factor subunit 4 OS=Xenopus laevis GN=cpsf4 PE=2 SV=1 Back     alignment and function description
>sp|A6NMK7|CPS4L_HUMAN Putative cleavage and polyadenylation specificity factor subunit 4-like protein OS=Homo sapiens GN=CPSF4L PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query69
332028091 290 Cleavage and polyadenylation specificity 0.840 0.2 0.620 1e-14
307183125 287 Cleavage and polyadenylation specificity 0.840 0.202 0.637 2e-14
340719465 286 PREDICTED: cleavage and polyadenylation 0.840 0.202 0.655 2e-14
66517749 286 PREDICTED: cleavage and polyadenylation 0.840 0.202 0.655 2e-14
345488132 297 PREDICTED: cleavage and polyadenylation 0.840 0.195 0.620 4e-14
383862768 286 PREDICTED: cleavage and polyadenylation 0.840 0.202 0.637 4e-14
307200583 285 Cleavage and polyadenylation specificity 0.840 0.203 0.620 1e-13
239792848148 ACYPI007246 [Acyrthosiphon pisum] 0.840 0.391 0.586 1e-12
270002662 258 hypothetical protein TcasGA2_TC005002 [T 0.840 0.224 0.610 1e-12
193624968 280 PREDICTED: cleavage and polyadenylation 0.840 0.207 0.586 1e-12
>gi|332028091|gb|EGI68142.1| Cleavage and polyadenylation specificity factor subunit 4 [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score = 84.0 bits (206), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 46/58 (79%)

Query: 1  MECLVANVENIKFDIEIALENQHDILPSPFPGMDKSMTAVCEFYVRGECNKDTMCPLR 58
          MEC+VANVE+++FDIE+AL+ Q+  LP PF GMDKS+ AVC+FY +G CNK   CP R
Sbjct: 1  MECIVANVEHMRFDIEVALDEQYGALPLPFTGMDKSIAAVCQFYPKGSCNKGASCPFR 58




Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307183125|gb|EFN70042.1| Cleavage and polyadenylation specificity factor subunit 4 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|340719465|ref|XP_003398174.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 4-like [Bombus terrestris] gi|350410464|ref|XP_003489048.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 4-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|66517749|ref|XP_396082.2| PREDICTED: cleavage and polyadenylation specificity factor subunit 4 [Apis mellifera] gi|380029307|ref|XP_003698318.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 4-like [Apis florea] Back     alignment and taxonomy information
>gi|345488132|ref|XP_001604679.2| PREDICTED: cleavage and polyadenylation specificity factor subunit 4-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383862768|ref|XP_003706855.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 4-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307200583|gb|EFN80724.1| Cleavage and polyadenylation specificity factor subunit 4 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|239792848|dbj|BAH72717.1| ACYPI007246 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|270002662|gb|EEZ99109.1| hypothetical protein TcasGA2_TC005002 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|193624968|ref|XP_001945316.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 4-like [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query69
UNIPROTKB|D4A905 243 Cpsf4 "Cleavage and polyadenyl 0.840 0.238 0.551 6.2e-14
UNIPROTKB|E1BV31 243 CPSF4 "Uncharacterized protein 0.840 0.238 0.551 1e-13
UNIPROTKB|O19137 243 CPSF4 "Cleavage and polyadenyl 0.840 0.238 0.551 1e-13
UNIPROTKB|E2RBK7 212 CPSF4 "Uncharacterized protein 0.840 0.273 0.551 1e-13
UNIPROTKB|J9P398 269 CPSF4 "Uncharacterized protein 0.840 0.215 0.551 1e-13
UNIPROTKB|C9JEV9 211 CPSF4 "Cleavage and polyadenyl 0.840 0.274 0.551 1e-13
UNIPROTKB|O95639 269 CPSF4 "Cleavage and polyadenyl 0.840 0.215 0.551 1e-13
UNIPROTKB|F1REX3 269 LOC100518830 "Uncharacterized 0.840 0.215 0.551 1e-13
MGI|MGI:1861602 211 Cpsf4 "cleavage and polyadenyl 0.840 0.274 0.551 1e-13
RGD|620440 243 Cpsf4 "cleavage and polyadenyl 0.840 0.238 0.551 1e-13
UNIPROTKB|D4A905 Cpsf4 "Cleavage and polyadenylation-specificity factor subunit 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 180 (68.4 bits), Expect = 6.2e-14, P = 6.2e-14
 Identities = 32/58 (55%), Positives = 44/58 (75%)

Query:     1 MECLVANVENIKFDIEIALENQHDILPSPFPGMDKSMTAVCEFYVRGECNKDTMCPLR 58
             M+ ++A+V++IKFD+ IA+E Q    P PFPGMDKS TAVCEF+++  C K +MCP R
Sbjct:     1 MQEIIASVDHIKFDLAIAVEQQLGAQPLPFPGMDKSGTAVCEFFLKAACGKGSMCPFR 58




GO:0003676 "nucleic acid binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
UNIPROTKB|E1BV31 CPSF4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|O19137 CPSF4 "Cleavage and polyadenylation specificity factor subunit 4" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RBK7 CPSF4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P398 CPSF4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|C9JEV9 CPSF4 "Cleavage and polyadenylation-specificity factor subunit 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O95639 CPSF4 "Cleavage and polyadenylation specificity factor subunit 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1REX3 LOC100518830 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1861602 Cpsf4 "cleavage and polyadenylation specific factor 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620440 Cpsf4 "cleavage and polyadenylation specific factor 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O19137CPSF4_BOVINNo assigned EC number0.55170.84050.2386yesN/A
Q8BQZ5CPSF4_MOUSENo assigned EC number0.55170.84050.2748yesN/A
Q5FVR7CPSF4_RATNo assigned EC number0.55170.84050.2386yesN/A
Q66KE3CPSF4_XENTRNo assigned EC number0.53440.84050.2156yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 69
KOG1040|consensus 325 98.9
KOG0153|consensus 377 98.48
smart0035627 ZnF_C3H1 zinc finger. 98.17
PF0064227 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si 97.76
PF1460819 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type 97.24
KOG1040|consensus 325 96.11
PF1065023 zf-C3H1: Putative zinc-finger domain; InterPro: IP 94.49
KOG1763|consensus 343 94.15
KOG1677|consensus 332 93.69
KOG2202|consensus260 92.36
KOG2494|consensus 331 91.51
COG5084 285 YTH1 Cleavage and polyadenylation specificity fact 90.52
KOG4791|consensus 667 88.97
KOG2185|consensus 486 87.32
COG5084 285 YTH1 Cleavage and polyadenylation specificity fact 81.35
KOG4791|consensus 667 80.11
>KOG1040|consensus Back     alignment and domain information
Probab=98.90  E-value=1.1e-09  Score=83.41  Aligned_cols=67  Identities=24%  Similarity=0.383  Sum_probs=62.6

Q ss_pred             CcccccccCCcchhHHHHHHhhcCCCCCCCCCCCcccccccccccc--ccCCCCCCCCCCCCC---CCcccc
Q psy4297           1 MECLVANVENIKFDIEIALENQHDILPSPFPGMDKSMTAVCEFYVR--GECNKDTMCPLRPGL---ATPVLG   67 (69)
Q Consensus         1 M~~~ia~v~~~~Fd~E~~le~Q~G~~~lPF~gmDks~a~vC~ff~~--G~C~kG~~CPfRH~~---gek~Vv   67 (69)
                      |+....+.+...|++|..+++|.|+-+.||+++|+++.++|.|+.+  -.|.+|+.||.+|..   ++++||
T Consensus         8 ~~~p~~~~~~~~~~~e~~~~~e~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v   79 (325)
T KOG1040|consen    8 TELPMLDDDSLKTDFEKSLDREPGASLAPFRVRDESGRATCEFNESREKPCERGPICPKSHNDVSDSRGKVV   79 (325)
T ss_pred             cccCcccccccccccchhhhhcccccccccccccccccchhcccccCCCCccCCCCCccccCCccccCCcee
Confidence            6788899999999999999999999999999999999999999988  789999999999999   778776



>KOG0153|consensus Back     alignment and domain information
>smart00356 ZnF_C3H1 zinc finger Back     alignment and domain information
>PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14608 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type Back     alignment and domain information
>KOG1040|consensus Back     alignment and domain information
>PF10650 zf-C3H1: Putative zinc-finger domain; InterPro: IPR019607 This domain is conserved in fungi and might be a zinc-finger domain as it contains three conserved Cs and an H in the C-x8-C-x5-C-x3-H conformation typical of a zinc-finger Back     alignment and domain information
>KOG1763|consensus Back     alignment and domain information
>KOG1677|consensus Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>KOG2494|consensus Back     alignment and domain information
>COG5084 YTH1 Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins [General function prediction only] Back     alignment and domain information
>KOG4791|consensus Back     alignment and domain information
>KOG2185|consensus Back     alignment and domain information
>COG5084 YTH1 Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins [General function prediction only] Back     alignment and domain information
>KOG4791|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query69
3u1l_A 240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 98.27
3d2q_A70 Muscleblind-like protein 1; tandem zinc finger dom 98.12
2rhk_C72 Cleavage and polyadenylation specificity factor su 98.08
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 98.05
2e5s_A98 Otthump00000018578; ZF-CCCHX2 domain, muscleblind- 97.78
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 97.77
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 97.47
2rhk_C72 Cleavage and polyadenylation specificity factor su 97.45
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 97.42
3d2q_A70 Muscleblind-like protein 1; tandem zinc finger dom 97.4
3d2n_A83 Muscleblind-like protein 1; tandem zinc finger dom 97.31
2rpp_A89 Muscleblind-like protein 2; zinc finger domain, C3 97.23
2e5s_A98 Otthump00000018578; ZF-CCCHX2 domain, muscleblind- 97.21
3d2n_A83 Muscleblind-like protein 1; tandem zinc finger dom 96.97
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 96.63
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 96.25
2rpp_A89 Muscleblind-like protein 2; zinc finger domain, C3 95.89
2fc6_A50 Nuclear, target of EGR1, member 1; structure genom 95.68
2d9m_A69 Zinc finger CCCH-type domain containing protein 7A 93.03
2lhn_A80 Nuclear polyadenylated RNA-binding protein NAB2; n 84.91
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
Probab=98.27  E-value=1.7e-07  Score=66.79  Aligned_cols=29  Identities=17%  Similarity=0.465  Sum_probs=25.6

Q ss_pred             ccccccccccccccCCCCCCCCCCCCCCC
Q psy4297          35 KSMTAVCEFYVRGECNKDTMCPLRPGLAT   63 (69)
Q Consensus        35 ks~a~vC~ff~~G~C~kG~~CPfRH~~ge   63 (69)
                      ++.+.+|.||.||.|.+|..|||+|...+
T Consensus        67 ~~~~~~C~ffakG~C~~G~~C~y~H~lPt   95 (240)
T 3u1l_A           67 DGQLFFCLFFAKGMCCLGPKCEYLHHIPD   95 (240)
T ss_dssp             TTCCSBCHHHHTTCCSCGGGCSSBBSCCC
T ss_pred             CCCCeEcCccccCCCCCCCCCCccCCCCC
Confidence            45678999999999999999999998654



>3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A Back     alignment and structure
>2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Back     alignment and structure
>2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A Back     alignment and structure
>3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} Back     alignment and structure
>2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} Back     alignment and structure
>2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Back     alignment and structure
>2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} Back     alignment and structure
>2fc6_A Nuclear, target of EGR1, member 1; structure genomics, ZF-CCCH domain, member 1(nuclear), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.66.1.1 Back     alignment and structure
>2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lhn_A Nuclear polyadenylated RNA-binding protein NAB2; nuclear protein; NMR {Saccharomyces cerevisiae S288C} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query69
d2cqea229 Zinc finger CCCH domain-containing protein C19orf7 98.07
d1m9oa_40 Tristetraproline (ttp, tis11, nup475) {Mouse (Mus 96.63
d1rgoa136 Butyrate response factor 2 (Tis11D) {Human (Homo s 96.21
d1rgoa234 Butyrate response factor 2 (Tis11D) {Human (Homo s 94.37
d2fc6a137 Target of EGR1 protein 1, TOE1 {Human (Homo sapien 93.1
>d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: CCCH zinc finger
superfamily: CCCH zinc finger
family: CCCH zinc finger
domain: Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.07  E-value=7e-07  Score=45.99  Aligned_cols=23  Identities=35%  Similarity=0.998  Sum_probs=21.4

Q ss_pred             cccccccccccCCCCCCCCCCCC
Q psy4297          38 TAVCEFYVRGECNKDTMCPLRPG   60 (69)
Q Consensus        38 a~vC~ff~~G~C~kG~~CPfRH~   60 (69)
                      ..+|.|+++|.|+||..|||-|.
T Consensus         6 kelCKfYvqGyCtrgenC~ymH~   28 (29)
T d2cqea2           6 RELCKFYITGFCARAENCPYMHG   28 (29)
T ss_dssp             CSBCTTTTTTCCSCSTTCSSBSS
T ss_pred             hhhhhhheeeeecCCcCcccccC
Confidence            47899999999999999999985



>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fc6a1 g.66.1.1 (A:8-44) Target of EGR1 protein 1, TOE1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure