Psyllid ID: psy4297
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 69 | ||||||
| 332028091 | 290 | Cleavage and polyadenylation specificity | 0.840 | 0.2 | 0.620 | 1e-14 | |
| 307183125 | 287 | Cleavage and polyadenylation specificity | 0.840 | 0.202 | 0.637 | 2e-14 | |
| 340719465 | 286 | PREDICTED: cleavage and polyadenylation | 0.840 | 0.202 | 0.655 | 2e-14 | |
| 66517749 | 286 | PREDICTED: cleavage and polyadenylation | 0.840 | 0.202 | 0.655 | 2e-14 | |
| 345488132 | 297 | PREDICTED: cleavage and polyadenylation | 0.840 | 0.195 | 0.620 | 4e-14 | |
| 383862768 | 286 | PREDICTED: cleavage and polyadenylation | 0.840 | 0.202 | 0.637 | 4e-14 | |
| 307200583 | 285 | Cleavage and polyadenylation specificity | 0.840 | 0.203 | 0.620 | 1e-13 | |
| 239792848 | 148 | ACYPI007246 [Acyrthosiphon pisum] | 0.840 | 0.391 | 0.586 | 1e-12 | |
| 270002662 | 258 | hypothetical protein TcasGA2_TC005002 [T | 0.840 | 0.224 | 0.610 | 1e-12 | |
| 193624968 | 280 | PREDICTED: cleavage and polyadenylation | 0.840 | 0.207 | 0.586 | 1e-12 |
| >gi|332028091|gb|EGI68142.1| Cleavage and polyadenylation specificity factor subunit 4 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
Score = 84.0 bits (206), Expect = 1e-14, Method: Compositional matrix adjust.
Identities = 36/58 (62%), Positives = 46/58 (79%)
Query: 1 MECLVANVENIKFDIEIALENQHDILPSPFPGMDKSMTAVCEFYVRGECNKDTMCPLR 58
MEC+VANVE+++FDIE+AL+ Q+ LP PF GMDKS+ AVC+FY +G CNK CP R
Sbjct: 1 MECIVANVEHMRFDIEVALDEQYGALPLPFTGMDKSIAAVCQFYPKGSCNKGASCPFR 58
|
Source: Acromyrmex echinatior Species: Acromyrmex echinatior Genus: Acromyrmex Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|307183125|gb|EFN70042.1| Cleavage and polyadenylation specificity factor subunit 4 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|340719465|ref|XP_003398174.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 4-like [Bombus terrestris] gi|350410464|ref|XP_003489048.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 4-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|66517749|ref|XP_396082.2| PREDICTED: cleavage and polyadenylation specificity factor subunit 4 [Apis mellifera] gi|380029307|ref|XP_003698318.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 4-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|345488132|ref|XP_001604679.2| PREDICTED: cleavage and polyadenylation specificity factor subunit 4-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|383862768|ref|XP_003706855.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 4-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|307200583|gb|EFN80724.1| Cleavage and polyadenylation specificity factor subunit 4 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|239792848|dbj|BAH72717.1| ACYPI007246 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|270002662|gb|EEZ99109.1| hypothetical protein TcasGA2_TC005002 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|193624968|ref|XP_001945316.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 4-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 69 | ||||||
| UNIPROTKB|D4A905 | 243 | Cpsf4 "Cleavage and polyadenyl | 0.840 | 0.238 | 0.551 | 6.2e-14 | |
| UNIPROTKB|E1BV31 | 243 | CPSF4 "Uncharacterized protein | 0.840 | 0.238 | 0.551 | 1e-13 | |
| UNIPROTKB|O19137 | 243 | CPSF4 "Cleavage and polyadenyl | 0.840 | 0.238 | 0.551 | 1e-13 | |
| UNIPROTKB|E2RBK7 | 212 | CPSF4 "Uncharacterized protein | 0.840 | 0.273 | 0.551 | 1e-13 | |
| UNIPROTKB|J9P398 | 269 | CPSF4 "Uncharacterized protein | 0.840 | 0.215 | 0.551 | 1e-13 | |
| UNIPROTKB|C9JEV9 | 211 | CPSF4 "Cleavage and polyadenyl | 0.840 | 0.274 | 0.551 | 1e-13 | |
| UNIPROTKB|O95639 | 269 | CPSF4 "Cleavage and polyadenyl | 0.840 | 0.215 | 0.551 | 1e-13 | |
| UNIPROTKB|F1REX3 | 269 | LOC100518830 "Uncharacterized | 0.840 | 0.215 | 0.551 | 1e-13 | |
| MGI|MGI:1861602 | 211 | Cpsf4 "cleavage and polyadenyl | 0.840 | 0.274 | 0.551 | 1e-13 | |
| RGD|620440 | 243 | Cpsf4 "cleavage and polyadenyl | 0.840 | 0.238 | 0.551 | 1e-13 |
| UNIPROTKB|D4A905 Cpsf4 "Cleavage and polyadenylation-specificity factor subunit 4" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Score = 180 (68.4 bits), Expect = 6.2e-14, P = 6.2e-14
Identities = 32/58 (55%), Positives = 44/58 (75%)
Query: 1 MECLVANVENIKFDIEIALENQHDILPSPFPGMDKSMTAVCEFYVRGECNKDTMCPLR 58
M+ ++A+V++IKFD+ IA+E Q P PFPGMDKS TAVCEF+++ C K +MCP R
Sbjct: 1 MQEIIASVDHIKFDLAIAVEQQLGAQPLPFPGMDKSGTAVCEFFLKAACGKGSMCPFR 58
|
|
| UNIPROTKB|E1BV31 CPSF4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O19137 CPSF4 "Cleavage and polyadenylation specificity factor subunit 4" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RBK7 CPSF4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P398 CPSF4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9JEV9 CPSF4 "Cleavage and polyadenylation-specificity factor subunit 4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O95639 CPSF4 "Cleavage and polyadenylation specificity factor subunit 4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1REX3 LOC100518830 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1861602 Cpsf4 "cleavage and polyadenylation specific factor 4" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|620440 Cpsf4 "cleavage and polyadenylation specific factor 4" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
No hit with e-value below 0.005
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 69 | |||
| KOG1040|consensus | 325 | 98.9 | ||
| KOG0153|consensus | 377 | 98.48 | ||
| smart00356 | 27 | ZnF_C3H1 zinc finger. | 98.17 | |
| PF00642 | 27 | zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si | 97.76 | |
| PF14608 | 19 | zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type | 97.24 | |
| KOG1040|consensus | 325 | 96.11 | ||
| PF10650 | 23 | zf-C3H1: Putative zinc-finger domain; InterPro: IP | 94.49 | |
| KOG1763|consensus | 343 | 94.15 | ||
| KOG1677|consensus | 332 | 93.69 | ||
| KOG2202|consensus | 260 | 92.36 | ||
| KOG2494|consensus | 331 | 91.51 | ||
| COG5084 | 285 | YTH1 Cleavage and polyadenylation specificity fact | 90.52 | |
| KOG4791|consensus | 667 | 88.97 | ||
| KOG2185|consensus | 486 | 87.32 | ||
| COG5084 | 285 | YTH1 Cleavage and polyadenylation specificity fact | 81.35 | |
| KOG4791|consensus | 667 | 80.11 |
| >KOG1040|consensus | Back alignment and domain information |
|---|
Probab=98.90 E-value=1.1e-09 Score=83.41 Aligned_cols=67 Identities=24% Similarity=0.383 Sum_probs=62.6
Q ss_pred CcccccccCCcchhHHHHHHhhcCCCCCCCCCCCcccccccccccc--ccCCCCCCCCCCCCC---CCcccc
Q psy4297 1 MECLVANVENIKFDIEIALENQHDILPSPFPGMDKSMTAVCEFYVR--GECNKDTMCPLRPGL---ATPVLG 67 (69)
Q Consensus 1 M~~~ia~v~~~~Fd~E~~le~Q~G~~~lPF~gmDks~a~vC~ff~~--G~C~kG~~CPfRH~~---gek~Vv 67 (69)
|+....+.+...|++|..+++|.|+-+.||+++|+++.++|.|+.+ -.|.+|+.||.+|.. ++++||
T Consensus 8 ~~~p~~~~~~~~~~~e~~~~~e~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v 79 (325)
T KOG1040|consen 8 TELPMLDDDSLKTDFEKSLDREPGASLAPFRVRDESGRATCEFNESREKPCERGPICPKSHNDVSDSRGKVV 79 (325)
T ss_pred cccCcccccccccccchhhhhcccccccccccccccccchhcccccCCCCccCCCCCccccCCccccCCcee
Confidence 6788899999999999999999999999999999999999999988 789999999999999 778776
|
|
| >KOG0153|consensus | Back alignment and domain information |
|---|
| >smart00356 ZnF_C3H1 zinc finger | Back alignment and domain information |
|---|
| >PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF14608 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type | Back alignment and domain information |
|---|
| >KOG1040|consensus | Back alignment and domain information |
|---|
| >PF10650 zf-C3H1: Putative zinc-finger domain; InterPro: IPR019607 This domain is conserved in fungi and might be a zinc-finger domain as it contains three conserved Cs and an H in the C-x8-C-x5-C-x3-H conformation typical of a zinc-finger | Back alignment and domain information |
|---|
| >KOG1763|consensus | Back alignment and domain information |
|---|
| >KOG1677|consensus | Back alignment and domain information |
|---|
| >KOG2202|consensus | Back alignment and domain information |
|---|
| >KOG2494|consensus | Back alignment and domain information |
|---|
| >COG5084 YTH1 Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4791|consensus | Back alignment and domain information |
|---|
| >KOG2185|consensus | Back alignment and domain information |
|---|
| >COG5084 YTH1 Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4791|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 69 | |||
| 3u1l_A | 240 | PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; | 98.27 | |
| 3d2q_A | 70 | Muscleblind-like protein 1; tandem zinc finger dom | 98.12 | |
| 2rhk_C | 72 | Cleavage and polyadenylation specificity factor su | 98.08 | |
| 2d9n_A | 77 | Cleavage and polyadenylation specificity factor, 3 | 98.05 | |
| 2e5s_A | 98 | Otthump00000018578; ZF-CCCHX2 domain, muscleblind- | 97.78 | |
| 2cqe_A | 98 | KIAA1064 protein; CCCH zinc-finger, structural gen | 97.77 | |
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 97.47 | |
| 2rhk_C | 72 | Cleavage and polyadenylation specificity factor su | 97.45 | |
| 2d9n_A | 77 | Cleavage and polyadenylation specificity factor, 3 | 97.42 | |
| 3d2q_A | 70 | Muscleblind-like protein 1; tandem zinc finger dom | 97.4 | |
| 3d2n_A | 83 | Muscleblind-like protein 1; tandem zinc finger dom | 97.31 | |
| 2rpp_A | 89 | Muscleblind-like protein 2; zinc finger domain, C3 | 97.23 | |
| 2e5s_A | 98 | Otthump00000018578; ZF-CCCHX2 domain, muscleblind- | 97.21 | |
| 3d2n_A | 83 | Muscleblind-like protein 1; tandem zinc finger dom | 96.97 | |
| 2cqe_A | 98 | KIAA1064 protein; CCCH zinc-finger, structural gen | 96.63 | |
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 96.25 | |
| 2rpp_A | 89 | Muscleblind-like protein 2; zinc finger domain, C3 | 95.89 | |
| 2fc6_A | 50 | Nuclear, target of EGR1, member 1; structure genom | 95.68 | |
| 2d9m_A | 69 | Zinc finger CCCH-type domain containing protein 7A | 93.03 | |
| 2lhn_A | 80 | Nuclear polyadenylated RNA-binding protein NAB2; n | 84.91 |
| >3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A | Back alignment and structure |
|---|
Probab=98.27 E-value=1.7e-07 Score=66.79 Aligned_cols=29 Identities=17% Similarity=0.465 Sum_probs=25.6
Q ss_pred ccccccccccccccCCCCCCCCCCCCCCC
Q psy4297 35 KSMTAVCEFYVRGECNKDTMCPLRPGLAT 63 (69)
Q Consensus 35 ks~a~vC~ff~~G~C~kG~~CPfRH~~ge 63 (69)
++.+.+|.||.||.|.+|..|||+|...+
T Consensus 67 ~~~~~~C~ffakG~C~~G~~C~y~H~lPt 95 (240)
T 3u1l_A 67 DGQLFFCLFFAKGMCCLGPKCEYLHHIPD 95 (240)
T ss_dssp TTCCSBCHHHHTTCCSCGGGCSSBBSCCC
T ss_pred CCCCeEcCccccCCCCCCCCCCccCCCCC
Confidence 45678999999999999999999998654
|
| >3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A | Back alignment and structure |
|---|
| >2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 | Back alignment and structure |
|---|
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A | Back alignment and structure |
|---|
| >2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A | Back alignment and structure |
|---|
| >3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 | Back alignment and structure |
|---|
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A | Back alignment and structure |
|---|
| >2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fc6_A Nuclear, target of EGR1, member 1; structure genomics, ZF-CCCH domain, member 1(nuclear), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.66.1.1 | Back alignment and structure |
|---|
| >2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lhn_A Nuclear polyadenylated RNA-binding protein NAB2; nuclear protein; NMR {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 69 | |||
| d2cqea2 | 29 | Zinc finger CCCH domain-containing protein C19orf7 | 98.07 | |
| d1m9oa_ | 40 | Tristetraproline (ttp, tis11, nup475) {Mouse (Mus | 96.63 | |
| d1rgoa1 | 36 | Butyrate response factor 2 (Tis11D) {Human (Homo s | 96.21 | |
| d1rgoa2 | 34 | Butyrate response factor 2 (Tis11D) {Human (Homo s | 94.37 | |
| d2fc6a1 | 37 | Target of EGR1 protein 1, TOE1 {Human (Homo sapien | 93.1 |
| >d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: CCCH zinc finger superfamily: CCCH zinc finger family: CCCH zinc finger domain: Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.07 E-value=7e-07 Score=45.99 Aligned_cols=23 Identities=35% Similarity=0.998 Sum_probs=21.4
Q ss_pred cccccccccccCCCCCCCCCCCC
Q psy4297 38 TAVCEFYVRGECNKDTMCPLRPG 60 (69)
Q Consensus 38 a~vC~ff~~G~C~kG~~CPfRH~ 60 (69)
..+|.|+++|.|+||..|||-|.
T Consensus 6 kelCKfYvqGyCtrgenC~ymH~ 28 (29)
T d2cqea2 6 RELCKFYITGFCARAENCPYMHG 28 (29)
T ss_dssp CSBCTTTTTTCCSCSTTCSSBSS
T ss_pred hhhhhhheeeeecCCcCcccccC
Confidence 47899999999999999999985
|
| >d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fc6a1 g.66.1.1 (A:8-44) Target of EGR1 protein 1, TOE1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|