Psyllid ID: psy4302

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610---
MEEAEKIGLCARPCDGAKPMVCYYHFTLENYATIGPACGNCINGTMDDCFKKGCVTADGVERPILTINRRLPSPSIQVCRGDTIVVDVKNKIVDRVVTIHWHGVYQRHTPHSDGVPLLTQCPIIPETTYRYKFPAMPYGTFFYHSHIGFQKMDGLEGPLVIRRPKKADPNRDQYDTDYPSHTIIITDWLHGMTDAKFPGNTYANFGTRTESFLINGRSVFKSGNGTSNPVPYSKFKVNKGLRHRFRIIGGSCLACPMLFFVEKHRMNLITVDGTPVQPQMFDSITIFPGQYTPVNSAIVLNINLDAAHMGSRRDRLNILRLRKSLNALDSSDCSDTNPNVCWNHVNSLTPATEKATVLKAVPDIRLVFAVDEYHFTRDSLFWNDEDEYHRWFQSSPNVIKTHVTNNISLGILPFPILSQDLPIPKEMECPKDRSVCGKSAEKGGKLCECVEIIKVGLNQVAEIIFIDWIGPTSTFLHPMHLHGTDIYIIEQGIIPVAEDHRAFVGKLQERLAREGPDLATKIRPQPCVKDTVTIPPNGYTVVRVHFNNPGIWIMHCHFIFHTETGMNTVFQVGDRKDFVQTPPEFPTCNNYLPPVDPNEFKNIDWDDEPTLQT
ccccccccccccccccccccEEEEEEEEEHHHHccccccccccEEEEEEEEEEEEccccccccEEEEccccccccEEEEEccEEEEEEEEcccccccEEEEccccccccccccccccccccccccccEEEEEEEcccccccccccccccccccccEEEEEEccccccccccccccccccccEEEEccccccccccccccccccccccccccEEcccccccccccccccccccEEEEEEcccEEEEEEEEcccccccEEEEEcccEEEEEEEccccccEEEEcEEEEcccccccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccEEEcccccEEEEEEccEEcccccccccccccccccccccccccccccccccccccccccEEEEEEccccEEEEEEEccccccccccccccccccccEEEEEcccccccccccccHHHHHHHcccccccccccccccccccEEEcccccEEEEEEEcccccccHHccccHHHHHHcHHEEEEEccccccccccccccccccccccccccccccccccccccccc
ccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEccccccccEEEEEEccEcccccEEEEcccEEEEEEEEccccccEcEEEEcccccccHHHcccEcccEccEccccEEEEEEEccccEEEEEEEccccHHHHccEEEEEEEccccccccccccccccccEEEEEccHHcccHHHHHHHHHHccccccccEEEEEcccccccccccccccccEEEEEccccEEEEEEEEEccccccEEEEEEccEEEEEEEEcEEEcEEEEEEEEEEcccEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccEEccccccccccccccccccEEEEEcccccccccccHHHHHHHcccccccccccccccccccccccccccccEEEEEEcccEEEEEEEccccccccccccEEEccccEEEEEcccccccccccccEEcHHHHHHHHcccccccccccccEEcEEEEcccEEEEEEEEccccEEEEEEEccHHHHHcccEEEEEEcHHHccccccccccccccccccccccccccccccccccccc
meeaekiglcarpcdgakpmvcyyhftlenyatigpacgncingtmddcfkkgcvtadgverpiltinrrlpspsiqvcrgdtivvdVKNKIVDRVVTIHWhgvyqrhtphsdgvplltqcpiipettyrykfpampygtffyhshigfqkmdglegplvirrpkkadpnrdqydtdypshtiIITDwlhgmtdakfpgntyanfgtrtesFLINgrsvfksgngtsnpvpyskfkvnkglRHRFRIIGgsclacpmlFFVEKHRMnlitvdgtpvqpqmfdsitifpgqytpvnsAIVLNINLdaahmgsrrDRLNILRLRKSlnaldssdcsdtnpnvcwnhvnsltpatekatvlkavpdirlVFAVdeyhftrdslfwndedeyhrwfqsspnviKTHVtnnislgilpfpilsqdlpipkemecpkdrsvcgksaekggklcECVEIIKVGLNQVAEIIFIdwigptstflhpmhlhgtdiyiieqgiipvaeDHRAFVGKLQERLAregpdlatkirpqpcvkdtvtippngyTVVRVHFnnpgiwimHCHFifhtetgmntvfqvgdrkdfvqtppefptcnnylppvdpnefknidwddeptlqt
meeaekiglcarpcdgaKPMVCYYHFTLENYATIGPACGNCINGTMDDCFKKGCVTADGverpiltinrrlpspsiqvcrgdtivvdvkNKIVDRVVTIHWHGVYqrhtphsdgvplLTQCPIIPETTYRYKFPAMPYGTFFYHSHIGFQKMDGLEGPLVIRrpkkadpnrdqydtdypSHTIIITDWLHGMTDAKFPGNTYANFGTRTESFLINGRSVFksgngtsnpvpyskFKVNKGLRHRFRIIGGSCLACPMLFFVEKHRMNLITVDGTPVQPQMFDSITIFPGQYTPVNSAIVLNINLDAAHMGSRRDRLNILRLRKSLNAldssdcsdtnpnVCWNHVNSLTPATEKATVLKAVPDIRLVFAVDEYHFTRDSLFWNDEDEYHRWFQSSPNVIKTHVTNNISLGILPFPILSQDLPIPKEMECPKDRSVCGKSAEKGGKLCECVEIIKVGLNQVAEIIFIDWIGPTSTFLHPMHLHGTDIYIIEQGIIPVAEDHRAFVGKLQERLAregpdlatkirpqpcvkdtvtippngyTVVRVHFNNPGIWIMHCHFIFHTETGMNTVFQVGDRKDFVQTPPEFPTCNNYLPPVDPNefknidwddeptlqt
MEEAEKIGLCARPCDGAKPMVCYYHFTLENYATIGPACGNCINGTMDDCFKKGCVTADGVERPILTINRRLPSPSIQVCRGDTIVVDVKNKIVDRVVTIHWHGVYQRHTPHSDGVPLLTQCPIIPETTYRYKFPAMPYGTFFYHSHIGFQKMDGLEGPLVIRRPKKADPNRDQYDTDYPSHTIIITDWLHGMTDAKFPGNTYANFGTRTESFLINGRSVFKSGNGTSNPVPYSKFKVNKGLRHRFRIIGGSCLACPMLFFVEKHRMNLITVDGTPVQPQMFDSITIFPGQYTPVNSAIVLNINLDAAHMGSRRDRLNILRLRKSLNALDSSDCSDTNPNVCWNHVNSLTPATEKATVLKAVPDIRLVFAVDEYHFTRDSLFWNDEDEYHRWFQSSPNVIKTHVTNNISLGILPFPILSQDLPIPKEMECPKDRSVCGKSAEKGGKLCECVEIIKVGLNQVAEIIFIDWIGPTSTFLHPMHLHGTDIYIIEQGIIPVAEDHRAFVGKLQERLAREGPDLATKIRPQPCVKDTVTIPPNGYTVVRVHFNNPGIWIMHCHFIFHTETGMNTVFQVGDRKDFVQTPPEFPTCNNYLPPVDPNEFKNIDWDDEPTLQT
******IGLCARPCDGAKPMVCYYHFTLENYATIGPACGNCINGTMDDCFKKGCVTADGVERPILTINRRLPSPSIQVCRGDTIVVDVKNKIVDRVVTIHWHGVYQRHTPHSDGVPLLTQCPIIPETTYRYKFPAMPYGTFFYHSHIGFQKMDGLEGPLVIR************DTDYPSHTIIITDWLHGMTDAKFPGNTYANFGTRTESFLINGRSVFKSGNGTSNPVPYSKFKVNKGLRHRFRIIGGSCLACPMLFFVEKHRMNLITVDGTPVQPQMFDSITIFPGQYTPVNSAIVLNINLDAAHMGSRRDRLNILRLRKSLNALDSSDCSDTNPNVCWNHVNSLTPATEKATVLKAVPDIRLVFAVDEYHFTRDSLFWNDEDEYHRWFQSSPNVIKTHVTNNISLGILPFPILSQDLPIP***********CG**AEKGGKLCECVEIIKVGLNQVAEIIFIDWIGPTSTFLHPMHLHGTDIYIIEQGIIPVAEDHRAFVGKLQERLAREGPDLATKIRPQPCVKDTVTIPPNGYTVVRVHFNNPGIWIMHCHFIFHTETGMNTVFQVGDRKDFVQTPPEFPTCNNYLPPV******************
******I**CARPCDGAKPMVCYYHFTLENYATIGPACGNCINGTMDDCFKKGCVTADGVERPILTINRRLPSPSIQVCRGDTIVVDVKNKIVDRVVTIHWHGVYQRHTPHSDGVPLLTQCPIIPETTYRYKFPAMPYGTFFYHSHIGFQKMDGLEGPLVIRRPKKADPNRDQYDTDYPSHTIIITDWLHGMTDAKFPGNTY**FGTRTESFLINGRSVFKSGNGTSNPVPYSKFKVNKGLRHRFRIIGGSCLACPMLFFVEKHRMNLITVDGTPVQPQMFDSITIFPGQYTPVNSAIVLNINLDAAHMGSRRDRLNILRLRKSLNALDSSDCSDTNPNVCWNHVNSLTPATEKATVLKAVPDIRLVFAVDEYHFTRDSLFWNDEDEYHRWFQSSPNVIKTHVTNNISLGILPFPILSQDLPIPKEMECPKDRSVCGKSAEKGGKLCECVEIIKVGLNQVAEIIFIDWIGPTSTFLHPMHLHGTDIYIIEQGIIPVAEDHRAFVGKLQERLAREGPDLATKIRPQPCVKDTVTIPPNGYTVVRVHFNNPGIWIMHCHFIFHTETGMNTVFQVGDRKDFVQTPPEFPTCNNYLPPVDPNEFKNIDW********
MEEAEKIGLCARPCDGAKPMVCYYHFTLENYATIGPACGNCINGTMDDCFKKGCVTADGVERPILTINRRLPSPSIQVCRGDTIVVDVKNKIVDRVVTIHWHGVYQRHTPHSDGVPLLTQCPIIPETTYRYKFPAMPYGTFFYHSHIGFQKMDGLEGPLVIRRPKKADPNRDQYDTDYPSHTIIITDWLHGMTDAKFPGNTYANFGTRTESFLINGRSVFKSGNGTSNPVPYSKFKVNKGLRHRFRIIGGSCLACPMLFFVEKHRMNLITVDGTPVQPQMFDSITIFPGQYTPVNSAIVLNINLDAAHMGSRRDRLNILRLRKSLNALDSSDCSDTNPNVCWNHVNSLTPATEKATVLKAVPDIRLVFAVDEYHFTRDSLFWNDEDEYHRWFQSSPNVIKTHVTNNISLGILPFPILSQDLPIPKEMECPKDRSVCGKSAEKGGKLCECVEIIKVGLNQVAEIIFIDWIGPTSTFLHPMHLHGTDIYIIEQGIIPVAEDHRAFVGKLQERLAREGPDLATKIRPQPCVKDTVTIPPNGYTVVRVHFNNPGIWIMHCHFIFHTETGMNTVFQVGDRKDFVQTPPEFPTCNNYLPPVDPNEFKNIDWDDEPTLQT
MEEAEKIGLCARPCDGAKPMVCYYHFTLENYATIGPACGNCINGTMDDCFKKGCVTADGVERPILTINRRLPSPSIQVCRGDTIVVDVKNKIVDRVVTIHWHGVYQRHTPHSDGVPLLTQCPIIPETTYRYKFPAMPYGTFFYHSHIGFQKMDGLEGPLVIRRPKKADPNRDQYDTDYPSHTIIITDWLHGMTDAKFPGNTYANFGTRTESFLINGRSVFKSGNGTSNPVPYSKFKVNKGLRHRFRIIGGSCLACPMLFFVEKHRMNLITVDGTPVQPQMFDSITIFPGQYTPVNSAIVLNINLDAAHMGSRRDRLNILRLRKSLNALDSSDCSDTNPNVCWNHVNSLTPATEKATVLKAVPDIRLVFAVDEYHFTRDSLFWNDEDEYHRWFQSSPNVIKTHVTNNISLGILPFPILSQDLPIPKEMECPKDRSVCGKSAEKGGKLCECVEIIKVGLNQVAEIIFIDWIGPTSTFLHPMHLHGTDIYIIEQGIIPVAEDHRAFVGKLQERLAREGPDLATKIRPQPCVKDTVTIPPNGYTVVRVHFNNPGIWIMHCHFIFHTETGMNTVFQVGDRKDFVQTPPEFPTCNNYLPPVDPN********DE*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEEAEKIGLCARPCDGAKPMVCYYHFTLENYATIGPACGNCINGTMDDCFKKGCVTADGVERPILTINRRLPSPSIQVCRGDTIVVDVKNKIVDRVVTIHWHGVYQRHTPHSDGVPLLTQCPIIPETTYRYKFPAMPYGTFFYHSHIGFQKMDGLEGPLVIRRPKKADPNRDQYDTDYPSHTIIITDWLHGMTDAKFPGNTYANFGTRTESFLINGRSVFKSGNGTSNPVPYSKFKVNKGLRHRFRIIGGSCLACPMLFFVEKHRMNLITVDGTPVQPQMFDSITIFPGQYTPVNSAIVLNINLDAAHMGSRRDRLNILRLRKSLNALDSSDCSDTNPNVCWNHVNSLTPATEKATVLKAVPDIRLVFAVDEYHFTRDSLFWNDEDEYHRWFQSSPNVIKTHVTNNISLGILPFPILSQDLPIPKEMECPKDRSVCGKSAEKGGKLCECVEIIKVGLNQVAEIIFIDWIGPTSTFLHPMHLHGTDIYIIEQGIIPVAEDHRAFVGKLQERLAREGPDLATKIRPQPCVKDTVTIPPNGYTVVRVHFNNPGIWIMHCHFIFHTETGMNTVFQVGDRKDFVQTPPEFPTCNNYLPPVDPNEFKNIDWDDEPTLQT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query613 2.2.26 [Sep-21-2011]
Q02079572 Laccase-3 OS=Thanatephoru N/A N/A 0.378 0.405 0.385 2e-39
Q02081531 Laccase-4 OS=Thanatephoru N/A N/A 0.401 0.463 0.367 2e-39
P37064552 L-ascorbate oxidase OS=Cu N/A N/A 0.783 0.869 0.259 3e-39
P56193576 Laccase-1 OS=Thanatephoru N/A N/A 0.380 0.404 0.382 1e-38
P24792579 L-ascorbate oxidase OS=Cu N/A N/A 0.783 0.829 0.267 8e-38
Q02075599 Laccase-2 OS=Thanatephoru N/A N/A 0.380 0.388 0.369 2e-37
Q12570561 Laccase-1 OS=Botryotinia N/A N/A 0.706 0.771 0.262 2e-37
Q40588578 L-ascorbate oxidase OS=Ni N/A N/A 0.771 0.818 0.247 4e-37
P14133587 L-ascorbate oxidase OS=Cu N/A N/A 0.760 0.793 0.249 3e-36
Q12542520 Laccase-2 OS=Agaricus bis N/A N/A 0.698 0.823 0.268 7e-35
>sp|Q02079|LAC3_THACU Laccase-3 OS=Thanatephorus cucumeris GN=LCC3 PE=2 SV=1 Back     alignment and function desciption
 Score =  164 bits (416), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 94/244 (38%), Positives = 127/244 (52%), Gaps = 12/244 (4%)

Query: 53  GCVTADGVERPILTINRRLPSPSIQVCRGDTIVVDVKNKIVD----RVVTIHWHGVYQRH 108
           G +  DGVER    +N   P P I   +GDT+ V V+NK+ +    R  +IHWHG+ Q  
Sbjct: 31  GKIAPDGVERDATLVNGGYPGPLIFANKGDTLKVKVQNKLTNPDMYRTTSIHWHGLLQHR 90

Query: 109 TPHSDGVPLLTQCPIIPETTYRYKFP-AMPYGTFFYHSHIGFQKMDGLEGPLVIRRPKKA 167
               DG   +TQCPI+P+ +Y Y  P     GT++YHSH+  Q +DGL GPLVI  PK  
Sbjct: 91  NADDDGPAFVTQCPIVPQASYTYTMPLGDQTGTYWYHSHLSSQYVDGLRGPLVIYDPK-- 148

Query: 168 DPNRDQYDTDYPSHTIIITDWLHGMTDAKFP-GNTYANFGTRTESFLINGRSVFKSGNGT 226
           DP+R  YD D     +II DW H  + A    GN       + +S  ING+  F   N  
Sbjct: 149 DPHRRLYDIDDEKTVLIIGDWYHTSSKAILATGNITLQ---QPDSATINGKGRFDPDNTP 205

Query: 227 SNPVPYSKFKVNKGLRHRFRIIGGSCLACPMLFFVEKHRMNLITVDGTPVQPQMFDSITI 286
           +NP      KV +G R+R R+I  S +A      ++ H+M +I  DG   +P   DS  I
Sbjct: 206 ANPNTLYTLKVKRGKRYRLRVINSSAIAS-FRMSIQGHKMTVIAADGVSTKPYQVDSFDI 264

Query: 287 FPGQ 290
             GQ
Sbjct: 265 LAGQ 268
Lignin degradation and detoxification of lignin-derived products.
Thanatephorus cucumeris (taxid: 107832)
EC: 1EC: .EC: 1EC: 0EC: .EC: 3EC: .EC: 2
>sp|Q02081|LAC4_THACU Laccase-4 OS=Thanatephorus cucumeris GN=LCC4 PE=1 SV=1 Back     alignment and function description
>sp|P37064|ASO_CUCPM L-ascorbate oxidase OS=Cucurbita pepo var. melopepo PE=1 SV=1 Back     alignment and function description
>sp|P56193|LAC1_THACU Laccase-1 OS=Thanatephorus cucumeris GN=LCC1 PE=1 SV=1 Back     alignment and function description
>sp|P24792|ASO_CUCMA L-ascorbate oxidase OS=Cucurbita maxima GN=AAO PE=1 SV=2 Back     alignment and function description
>sp|Q02075|LAC2_THACU Laccase-2 OS=Thanatephorus cucumeris GN=LCC2 PE=2 SV=1 Back     alignment and function description
>sp|Q12570|LAC1_BOTFU Laccase-1 OS=Botryotinia fuckeliana GN=lcc1 PE=2 SV=3 Back     alignment and function description
>sp|Q40588|ASO_TOBAC L-ascorbate oxidase OS=Nicotiana tabacum GN=AAO PE=2 SV=1 Back     alignment and function description
>sp|P14133|ASO_CUCSA L-ascorbate oxidase OS=Cucumis sativus PE=1 SV=1 Back     alignment and function description
>sp|Q12542|LAC2_AGABI Laccase-2 OS=Agaricus bisporus GN=lcc2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query613
261086617647 laccase 6 [Reticulitermes flavipes] 0.929 0.880 0.360 1e-110
261086631647 laccase 19 [Reticulitermes flavipes] 0.929 0.880 0.360 1e-110
261086625647 laccase 14 [Reticulitermes flavipes] 0.929 0.880 0.358 1e-109
261086619647 laccase 7 [Reticulitermes flavipes] 0.929 0.880 0.358 1e-109
261086627647 laccase 15 [Reticulitermes flavipes] 0.929 0.880 0.358 1e-109
261086621647 laccase 12 [Reticulitermes flavipes] 0.929 0.880 0.358 1e-109
383850590669 PREDICTED: laccase-4-like [Megachile rot 0.941 0.862 0.365 1e-105
170029212667 multicopper oxidase [Culex quinquefascia 0.951 0.874 0.338 1e-102
221330000 784 laccase 2, isoform E [Drosophila melanog 0.926 0.724 0.362 1e-102
261086629619 laccase 17 [Reticulitermes flavipes] 0.884 0.875 0.353 1e-101
>gi|261086617|gb|ACX54558.1| laccase 6 [Reticulitermes flavipes] Back     alignment and taxonomy information
 Score =  406 bits (1044), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 224/622 (36%), Positives = 324/622 (52%), Gaps = 52/622 (8%)

Query: 10  CARPCDGAK-PMVCYYHFTLENYATIGPACGNC-INGTMDDCFKKGCVTADGVERPILTI 67
           CAR C+G + P +CYY +T+ENY T+  AC NC +N T   C+   C+TADG ER IL++
Sbjct: 45  CARICNGTEAPKICYYQWTIENYVTLSEACDNCPLNVTA--CYNAQCITADGYERSILSV 102

Query: 68  NRRLPSPSIQVCRGDTIVVDVKNKIVDRVVTIHWHGVYQRHTPHSDGVPLLTQCPIIPET 127
           NR+LP PSI+VC  D ++VD+ N +  R  +IHWHGV+Q+ + + DGVP++TQC I    
Sbjct: 103 NRKLPGPSIEVCLRDRVIVDITNNMAGRTTSIHWHGVFQKGSQYMDGVPMVTQCTIHEGD 162

Query: 128 TYRYKFPAMPYGTFFYHSHIGFQKMDGLEGPLVIRRPKKADPNRDQYDTDYPSHTIIITD 187
           T+RY F A   GT F+HSH G QK+DG+ G LV+R PK  DPN   YD D P H I I+D
Sbjct: 163 TFRYDFIANNEGTHFWHSHDGLQKLDGVTGNLVVRVPKNFDPNGQLYDFDLPEHKIFISD 222

Query: 188 WLHGMTDAKFPGNTYANFGTRTESFLINGRSVFKSGNGTSNPVPYSKFKVNKGLRHRFRI 247
           WLH   D  FPG    N G    SFLINGR     G  ++N  PY++  V  G R+R RI
Sbjct: 223 WLHLSADDHFPGLRATNPGQDANSFLINGRGRTLIGTQSTN-TPYAQINVQWGRRYRLRI 281

Query: 248 IGGSCLACPMLFFVEKHRMNLITVDGTPVQPQMFDSITIFPG-------QYTPVNSAIVL 300
           +G  C  CP    ++ H++ +I  DG  V P   DS+ I+ G       + T    +  +
Sbjct: 282 VGSLCTVCPTQLTIDGHKITVIATDGNSVAPARVDSLIIYSGERYDVVLEATNTEGSYWI 341

Query: 301 NINLDAAHMGSRRDRLNILRLRKS----LNAL--------------------DSSDCSDT 336
           ++   A  +GSR  +L +L+   +    L+AL                    +++ CS  
Sbjct: 342 HLKGLATCVGSRVYQLGVLQYENTTTNKLHALTPDPGYDGFPQPASYRVLNPENASCSIG 401

Query: 337 NPNVCWNHVNSLTPATEKATVLKAVPDIRLVFAVDEYHFTRDSLFWNDEDEYHRWFQSSP 396
           +  +C   + +  P      +L  +PDI  +       F   S F      Y R+F S  
Sbjct: 402 STGLCVTQLANSDPVPRD--ILTQLPDINYLLQFGFETFDSRSFF----KAYDRYFVSPF 455

Query: 397 NVIKTHVTNNISLGILPFPILSQDLPIPKEMECPKDRSVCGKSAEKGGKLCECVEIIKVG 456
             + +   NNIS    P P+LSQ   +P ++ CP       +    G   C CV +IK+ 
Sbjct: 456 LELLSSTVNNISFVSPPSPLLSQRGDVPDDILCPTGADGLPQ-CPGGNSYCTCVHVIKIK 514

Query: 457 LNQVAEIIFIDWIGPTSTFLHPMHLHGTDIYIIEQGIIPVAEDHRAFVGKLQERLAREGP 516
           L  + +II  D   P S   HP H+HG   Y++  G     +  +  +  L+  +     
Sbjct: 515 LGALVQIILSDQ-SPKSDLNHPFHIHGHAFYVLGMGQYAAGQTAQDLLNSLKSNV----- 568

Query: 517 DLATKIRPQPCVKDTVTIPPNGYTVVRVHFNNPGIWIMHCHFIFHTETGMNTVFQVGDRK 576
              + + P P +KDTV +P  GY +++    NPG W +HCHF++H  TGM+ V QVG+  
Sbjct: 569 ---SSVSPAPVLKDTVAVPSGGYAIIKFRPKNPGYWFLHCHFLYHVATGMSVVLQVGETS 625

Query: 577 DFVQTPPEFPTCNNYLPPVDPN 598
           D+  TP  FP C ++ PPV+ N
Sbjct: 626 DYPPTPDGFPKCGSFTPPVNTN 647

Source: Reticulitermes flavipes

Species: Reticulitermes flavipes

Genus: Reticulitermes

Family: Rhinotermitidae

Order: Isoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|261086631|gb|ACX54565.1| laccase 19 [Reticulitermes flavipes] Back     alignment and taxonomy information
>gi|261086625|gb|ACX54562.1| laccase 14 [Reticulitermes flavipes] Back     alignment and taxonomy information
>gi|261086619|gb|ACX54559.1| laccase 7 [Reticulitermes flavipes] Back     alignment and taxonomy information
>gi|261086627|gb|ACX54563.1| laccase 15 [Reticulitermes flavipes] Back     alignment and taxonomy information
>gi|261086621|gb|ACX54560.1| laccase 12 [Reticulitermes flavipes] Back     alignment and taxonomy information
>gi|383850590|ref|XP_003700878.1| PREDICTED: laccase-4-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|170029212|ref|XP_001842487.1| multicopper oxidase [Culex quinquefasciatus] gi|167881590|gb|EDS44973.1| multicopper oxidase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|221330000|ref|NP_610170.2| laccase 2, isoform E [Drosophila melanogaster] gi|220902110|gb|AAN16124.2| laccase 2, isoform E [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|261086629|gb|ACX54564.1| laccase 17 [Reticulitermes flavipes] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query613
FB|FBgn0259247784 laccase2 "laccase 2" [Drosophi 0.468 0.366 0.455 1.7e-103
FB|FBgn0032116 959 Mco1 "Multicopper oxidase-1" [ 0.337 0.215 0.449 3.6e-89
FB|FBgn0039387677 MCO3 "multicopper oxidase 3" [ 0.419 0.379 0.335 4.8e-64
FB|FBgn0052557645 CG32557 [Drosophila melanogast 0.417 0.396 0.355 4.2e-63
ASPGD|ASPL0000035520570 lccB [Emericella nidulans (tax 0.357 0.384 0.382 7.7e-46
ASPGD|ASPL0000031202664 lccC [Emericella nidulans (tax 0.430 0.397 0.335 5.9e-43
TAIR|locus:2178973573 AT5G21100 [Arabidopsis thalian 0.809 0.865 0.267 5.6e-40
UNIPROTKB|G4NBF8747 MGG_17429 "Uncharacterized pro 0.399 0.327 0.343 2.7e-39
TAIR|locus:2135242582 AT4G39830 [Arabidopsis thalian 0.370 0.390 0.336 3.3e-39
UNIPROTKB|G5EGX4595 MGCH7_ch7g635 "Laccase-1" [Mag 0.391 0.403 0.347 1.9e-38
FB|FBgn0259247 laccase2 "laccase 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 665 (239.2 bits), Expect = 1.7e-103, Sum P(2) = 1.7e-103
 Identities = 133/292 (45%), Positives = 171/292 (58%)

Query:    10 CARPC-DGAKPMVCYYHFTLENYATIGPACGNCI-NGTMDDCFKKGCVTADGVERPILTI 67
             CAR C +G  P +CYYHFTLE Y  +G AC  C  N T        CV ADGVER ILT 
Sbjct:   180 CARACREGEPPRICYYHFTLEYYTVLGAACQVCTPNATNTVWSHCQCVLADGVERGILTA 239

Query:    68 NRRLPSPSIQVCRGDTIVVDVKNKIVDRVVTIHWHGVYQRHTPHSDGVPLLTQCPIIPET 127
             NR +P PSIQVC  D +V+DV+N +    VTIHWHG++QR + + DGVP +TQCPI    
Sbjct:   240 NRMIPGPSIQVCENDKVVIDVENHMEGMEVTIHWHGIWQRGSQYYDGVPFVTQCPIQQGN 299

Query:   128 TYRYKFPAMPYGTFFYHSHIGFQKMDGLEGPLVIRRPKKADPNRDQYDTDYPSHTIIITD 187
             T+RY++     GT F+H+H G QK+DGL G +V+R+P   DPN   YD D  +H ++I+D
Sbjct:   300 TFRYQWTGNA-GTHFWHAHTGLQKLDGLYGSVVVRQPPSRDPNSHLYDFDLTTHIMLISD 358

Query:   188 WLHGMTDAKFPGNTYANFGTRTESFLINGRSVFKSGN-GTSNPVPYSKFKVNKGLRHRFR 246
             WLH     ++PG    N G   ES LING+  F+  N G     P   F +  G R+RFR
Sbjct:   359 WLHEDAAERYPGRLAVNTGQDPESMLINGKGQFRDPNTGFMTNTPLEIFTITPGRRYRFR 418

Query:   247 IIGGSCLACPMLFFVEKHRMNLITVDGTPVQPQMFDSITIFPGQ-YTPVNSA 297
             +I      CP    +E H M +I  DG PV P   ++I  F G+ Y  V SA
Sbjct:   419 MINAFASVCPAQVTIEGHGMTVIATDGEPVHPVDVNTIISFSGERYDFVISA 470
GO:0052716 "hydroquinone:oxygen oxidoreductase activity" evidence=ISS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005507 "copper ion binding" evidence=IEA
GO:0040003 "chitin-based cuticle development" evidence=IMP
FB|FBgn0032116 Mco1 "Multicopper oxidase-1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0039387 MCO3 "multicopper oxidase 3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0052557 CG32557 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ASPGD|ASPL0000035520 lccB [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
ASPGD|ASPL0000031202 lccC [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
TAIR|locus:2178973 AT5G21100 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G4NBF8 MGG_17429 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
TAIR|locus:2135242 AT4G39830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G5EGX4 MGCH7_ch7g635 "Laccase-1" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.10.30.691
3rd Layer1.10.3.3LOW CONFIDENCE prediction!
3rd Layer1.10.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query613
PLN02191574 PLN02191, PLN02191, L-ascorbate oxidase 5e-41
TIGR03388541 TIGR03388, ascorbase, L-ascorbate oxidase, plant t 1e-39
PLN02604566 PLN02604, PLN02604, oxidoreductase 9e-36
COG2132451 COG2132, SufI, Putative multicopper oxidases [Seco 1e-35
pfam07732119 pfam07732, Cu-oxidase_3, Multicopper oxidase 1e-35
TIGR03390538 TIGR03390, ascorbOXfungal, L-ascorbate oxidase, fu 5e-27
TIGR03389539 TIGR03389, laccase, laccase, plant 2e-26
pfam07731135 pfam07731, Cu-oxidase_2, Multicopper oxidase 1e-22
TIGR01480587 TIGR01480, copper_res_A, copper-resistance protein 1e-21
PLN02354552 PLN02354, PLN02354, copper ion binding / oxidoredu 8e-19
PLN02835539 PLN02835, PLN02835, oxidoreductase 1e-17
PLN02792536 PLN02792, PLN02792, oxidoreductase 1e-16
TIGR03389539 TIGR03389, laccase, laccase, plant 1e-14
pfam00394146 pfam00394, Cu-oxidase, Multicopper oxidase 1e-14
PLN02168545 PLN02168, PLN02168, copper ion binding / pectinest 2e-13
PLN00044596 PLN00044, PLN00044, multi-copper oxidase-related p 4e-13
PLN02991543 PLN02991, PLN02991, oxidoreductase 9e-13
TIGR03388541 TIGR03388, ascorbase, L-ascorbate oxidase, plant t 1e-09
TIGR03390538 TIGR03390, ascorbOXfungal, L-ascorbate oxidase, fu 7e-09
PLN02604566 PLN02604, PLN02604, oxidoreductase 1e-08
PRK10965523 PRK10965, PRK10965, multicopper oxidase; Provision 2e-06
TIGR01480587 TIGR01480, copper_res_A, copper-resistance protein 8e-05
PRK10965523 PRK10965, PRK10965, multicopper oxidase; Provision 2e-04
>gnl|CDD|177843 PLN02191, PLN02191, L-ascorbate oxidase Back     alignment and domain information 
 Score =  157 bits (397), Expect = 5e-41
 Identities = 137/551 (24%), Positives = 228/551 (41%), Gaps = 76/551 (13%)

Query: 58  DGVERPILTINRRLPSPSIQVCRGDTIVVDVKNKIVDRVVTIHWHGVYQRHTPHSDGVPL 117
           D  E  ++T+N + P P+I    GDTIVV + NK+    + IHWHG+ Q+ +P +DG   
Sbjct: 38  DCKEGAVMTVNGQFPGPTIDAVAGDTIVVHLTNKLTTEGLVIHWHGIRQKGSPWADGAAG 97

Query: 118 LTQCPIIPETTYRYKFPAMPYGTFFYHSHIGFQKMDGLEGPLVIRRPKKADPNRDQYDTD 177
           +TQC I P  T+ YKF     GT FYH H G Q+  GL G L++    K    R +YD +
Sbjct: 98  VTQCAINPGETFTYKFTVEKPGTHFYHGHYGMQRSAGLYGSLIV-DVAKGPKERLRYDGE 156

Query: 178 YPSHTIIITDWLHGMTDAKFPG--NTYANFGTRTESFLINGRSVFKSG------NGTSNP 229
           +    ++++DW H    ++  G  +    +    +S LINGR  F         NGT  P
Sbjct: 157 F---NLLLSDWWHESIPSQELGLSSKPMRWIGEAQSILINGRGQFNCSLAAQFSNGTELP 213

Query: 230 VPYSK---------FKVNKGLRHRFRIIGGSCLACPMLFFVEKHRMNLITVDGTPVQPQM 280
           +   K          +V     +R R+   + LA   L  V+ H++ ++  DG  + P  
Sbjct: 214 MCTFKEGDQCAPQTLRVEPNKTYRIRLASTTALASLNL-AVQGHKLVVVEADGNYITPFT 272

Query: 281 FDSITIFPGQYTPVNSAIVLNINLDAAH-----MGSRRDRLNILRLRKSLNALDS--SDC 333
            D I I+ G+    + +++L  + D +      +G R  + N  +    LN + +  S  
Sbjct: 273 TDDIDIYSGE----SYSVLLTTDQDPSQNYYISVGVRGRKPNTTQALTILNYVTAPASKL 328

Query: 334 SDTNPNVC--WNHVNSLTPATEKATVLKAVPDIRLVFAVDEYHFTRDSLFWNDEDEYHRW 391
             + P V   W+        ++K       P         +Y   +  +  N ++    +
Sbjct: 329 PSSPPPVTPRWDDFERSKNFSKKIFSAMGSPS-----PPKKYR--KRLILLNTQNLIDGY 381

Query: 392 FQSSPNVIKTHVTNNISLGILPFPI-LSQDLPIPKE--------MECPKDRSVCGKSAEK 442
            + + N +         LG + + + L  +   P          M  P   +    +   
Sbjct: 382 TKWAINNVSLVTPATPYLGSVKYNLKLGFNRKSPPRSYRMDYDIMNPPPFPNTTTGNGIY 441

Query: 443 GGKLCECVEIIKVGLNQVAEIIFIDWIGPTSTFLHPMHLHGTDIYIIEQGIIPVAEDHRA 502
                  V++I    N +  ++         + +HP HLHG D +++  G          
Sbjct: 442 VFPFNVTVDVIIQNANVLKGVV---------SEIHPWHLHGHDFWVLGYG---------- 482

Query: 503 FVGKLQERLAREGPDLATKIRPQPCVKDTVTIPPNGYTVVRVHFNNPGIWIMHCHFIFHT 562
             GK      + G D  T     P +++T  + P G+T +R   +NPG+W  HCH   H 
Sbjct: 483 -DGKF-----KPGIDEKTYNLKNPPLRNTAILYPYGWTAIRFVTDNPGVWFFHCHIEPHL 536

Query: 563 ETGMNTVFQVG 573
             GM  VF  G
Sbjct: 537 HMGMGVVFAEG 547

Length = 574
>gnl|CDD|234193 TIGR03388, ascorbase, L-ascorbate oxidase, plant type Back     alignment and domain information
>gnl|CDD|215324 PLN02604, PLN02604, oxidoreductase Back     alignment and domain information
>gnl|CDD|225043 COG2132, SufI, Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|219542 pfam07732, Cu-oxidase_3, Multicopper oxidase Back     alignment and domain information
>gnl|CDD|132431 TIGR03390, ascorbOXfungal, L-ascorbate oxidase, fungal type Back     alignment and domain information
>gnl|CDD|234194 TIGR03389, laccase, laccase, plant Back     alignment and domain information
>gnl|CDD|219541 pfam07731, Cu-oxidase_2, Multicopper oxidase Back     alignment and domain information
>gnl|CDD|233432 TIGR01480, copper_res_A, copper-resistance protein, CopA family Back     alignment and domain information
>gnl|CDD|177987 PLN02354, PLN02354, copper ion binding / oxidoreductase Back     alignment and domain information
>gnl|CDD|178429 PLN02835, PLN02835, oxidoreductase Back     alignment and domain information
>gnl|CDD|178389 PLN02792, PLN02792, oxidoreductase Back     alignment and domain information
>gnl|CDD|234194 TIGR03389, laccase, laccase, plant Back     alignment and domain information
>gnl|CDD|215896 pfam00394, Cu-oxidase, Multicopper oxidase Back     alignment and domain information
>gnl|CDD|215113 PLN02168, PLN02168, copper ion binding / pectinesterase Back     alignment and domain information
>gnl|CDD|165622 PLN00044, PLN00044, multi-copper oxidase-related protein; Provisional Back     alignment and domain information
>gnl|CDD|215536 PLN02991, PLN02991, oxidoreductase Back     alignment and domain information
>gnl|CDD|234193 TIGR03388, ascorbase, L-ascorbate oxidase, plant type Back     alignment and domain information
>gnl|CDD|132431 TIGR03390, ascorbOXfungal, L-ascorbate oxidase, fungal type Back     alignment and domain information
>gnl|CDD|215324 PLN02604, PLN02604, oxidoreductase Back     alignment and domain information
>gnl|CDD|236810 PRK10965, PRK10965, multicopper oxidase; Provisional Back     alignment and domain information
>gnl|CDD|233432 TIGR01480, copper_res_A, copper-resistance protein, CopA family Back     alignment and domain information
>gnl|CDD|236810 PRK10965, PRK10965, multicopper oxidase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 613
PLN02835539 oxidoreductase 100.0
PLN02991543 oxidoreductase 100.0
PLN02354552 copper ion binding / oxidoreductase 100.0
TIGR03389539 laccase laccase, plant. Members of this protein fa 100.0
PLN00044596 multi-copper oxidase-related protein; Provisional 100.0
PLN02191574 L-ascorbate oxidase 100.0
TIGR03388541 ascorbase L-ascorbate oxidase, plant type. Members 100.0
PLN02168545 copper ion binding / pectinesterase 100.0
PLN02792536 oxidoreductase 100.0
PLN02604566 oxidoreductase 100.0
KOG1263|consensus563 100.0
TIGR03390538 ascorbOXfungal L-ascorbate oxidase, fungal type. T 100.0
TIGR01480587 copper_res_A copper-resistance protein, CopA famil 100.0
PRK10965523 multicopper oxidase; Provisional 100.0
PRK10883471 FtsI repressor; Provisional 100.0
COG2132451 SufI Putative multicopper oxidases [Secondary meta 100.0
TIGR02376311 Cu_nitrite_red nitrite reductase, copper-containin 100.0
PF07732117 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR01 100.0
PF07731138 Cu-oxidase_2: Multicopper oxidase; InterPro: IPR01 99.95
PF00394159 Cu-oxidase: Multicopper oxidase; InterPro: IPR0011 99.9
TIGR03095148 rusti_cyanin rusticyanin. Rusticyanin is a blue co 99.79
TIGR01480587 copper_res_A copper-resistance protein, CopA famil 99.59
TIGR02376311 Cu_nitrite_red nitrite reductase, copper-containin 99.41
PRK10965523 multicopper oxidase; Provisional 99.18
PRK10883471 FtsI repressor; Provisional 99.12
PLN02835539 oxidoreductase 99.07
TIGR03096135 nitroso_cyanin nitrosocyanin. Nitrosocyanin, as de 99.07
TIGR03389539 laccase laccase, plant. Members of this protein fa 99.01
COG2132451 SufI Putative multicopper oxidases [Secondary meta 98.89
TIGR03388541 ascorbase L-ascorbate oxidase, plant type. Members 98.85
PLN02168545 copper ion binding / pectinesterase 98.76
PLN02991543 oxidoreductase 98.75
PLN02354552 copper ion binding / oxidoreductase 98.74
PLN02604566 oxidoreductase 98.72
PF07731138 Cu-oxidase_2: Multicopper oxidase; InterPro: IPR01 98.71
PLN02792536 oxidoreductase 98.69
TIGR03390538 ascorbOXfungal L-ascorbate oxidase, fungal type. T 98.66
PLN02191574 L-ascorbate oxidase 98.5
PF07732117 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR01 98.44
PLN00044596 multi-copper oxidase-related protein; Provisional 98.36
TIGR0265699 cyanin_plasto plastocyanin. Members of this family 98.02
PF00394159 Cu-oxidase: Multicopper oxidase; InterPro: IPR0011 97.84
PF0012799 Copper-bind: Copper binding proteins, plastocyanin 97.83
TIGR03095148 rusti_cyanin rusticyanin. Rusticyanin is a blue co 97.82
PRK02710119 plastocyanin; Provisional 97.63
KOG1263|consensus563 97.63
PF13473104 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 97.61
PRK02888635 nitrous-oxide reductase; Validated 97.55
TIGR0265783 amicyanin amicyanin. Members of this family are am 97.35
TIGR0265699 cyanin_plasto plastocyanin. Members of this family 97.15
TIGR03094195 sulfo_cyanin sulfocyanin. Members of this family a 97.12
TIGR02375116 pseudoazurin pseudoazurin. Pseudoazurin, also call 97.12
PF06525196 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Memb 97.08
TIGR03102115 halo_cynanin halocyanin domain. Halocyanins are bl 96.94
COG3794128 PetE Plastocyanin [Energy production and conversio 96.69
TIGR03096135 nitroso_cyanin nitrosocyanin. Nitrosocyanin, as de 96.42
PF0012799 Copper-bind: Copper binding proteins, plastocyanin 95.05
PRK02888635 nitrous-oxide reductase; Validated 94.7
PF13473104 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 94.31
PRK02710119 plastocyanin; Provisional 93.92
TIGR02375116 pseudoazurin pseudoazurin. Pseudoazurin, also call 92.67
PF00116120 COX2: Cytochrome C oxidase subunit II, periplasmic 90.96
COG4454158 Uncharacterized copper-binding protein [Inorganic 88.13
COG4454158 Uncharacterized copper-binding protein [Inorganic 83.95
TIGR0265783 amicyanin amicyanin. Members of this family are am 82.01
TIGR03102115 halo_cynanin halocyanin domain. Halocyanins are bl 81.98
TIGR02695125 azurin azurin. Azurin is a blue copper-binding pro 80.79
PRK10378375 inactive ferrous ion transporter periplasmic prote 80.67
>PLN02835 oxidoreductase Back     alignment and domain information 
Probab=100.00  E-value=1.2e-96  Score=812.47  Aligned_cols=479  Identities=21%  Similarity=0.328  Sum_probs=364.9

Q ss_pred             CceEEEEEEEeEeeecccccccCCCCCccccccceeecCCCeEEeEEEECCCCCCCeEEEecCCEEEEEEEECCCCCcee
Q psy4302          19 PMVCYYHFTLENYATIGPACGNCINGTMDDCFKKGCVTADGVERPILTINRRLPSPSIQVCRGDTIVVDVKNKIVDRVVT   98 (613)
Q Consensus        19 ~~~c~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dG~~~~~~~iNg~~PGP~i~v~~Gd~v~v~v~N~l~~~~~t   98 (613)
                      ..+++|+|+|.+..                      +++||++|.+|+||||+|||+|++++||+|+|+|+|+|+ ++|+
T Consensus        27 ~~~~~y~~~v~~~~----------------------~~~dg~~~~~~~~NG~~PGP~I~~~~GD~v~v~v~N~L~-~~tt   83 (539)
T PLN02835         27 DPYKYYTWTVTYGT----------------------ISPLGVPQQVILINGQFPGPRLDVVTNDNIILNLINKLD-QPFL   83 (539)
T ss_pred             CcEEEEEEEEEEEE----------------------eccCCeEEEEEEECCcCCCCCEEEECCCEEEEEEEeCCC-CCCc
Confidence            47899999999853                      678999999999999999999999999999999999998 8999


Q ss_pred             EEeCCCcccCCCCCCCCCccccccCCCCCeEEEEEee-cCCCceEEeecCcccccCCceeeEEEeCCCCCCCCCCCC-CC
Q psy4302          99 IHWHGVYQRHTPHSDGVPLLTQCPIIPETTYRYKFPA-MPYGTFFYHSHIGFQKMDGLEGPLVIRRPKKADPNRDQY-DT  176 (613)
Q Consensus        99 iHwHGl~~~~~~~~DGv~~vtq~pI~pG~~~~Y~f~~-~~~GT~wyH~H~~~q~~~Gl~G~liV~~~~~~~p~~~~~-d~  176 (613)
                      |||||++|++++||||+++ |||||+||++|+|+|++ +++||||||||++.|+++||+|+|||+++++. +.  +| .+
T Consensus        84 iHWHGl~~~~~~~~DGv~~-tQ~pI~PG~sf~Y~F~~~~q~GT~WYHsH~~~q~~~Gl~G~lIV~~~~~~-~~--p~~~~  159 (539)
T PLN02835         84 LTWNGIKQRKNSWQDGVLG-TNCPIPPNSNYTYKFQTKDQIGTFTYFPSTLFHKAAGGFGAINVYERPRI-PI--PFPLP  159 (539)
T ss_pred             EEeCCcccCCCCCCCCCcc-CcCCCCCCCcEEEEEEECCCCEeEEEEeCccchhcCcccceeEEeCCCCC-Cc--CCCCC
Confidence            9999999999999999999 99999999999999997 58999999999999999999999999865322 21  12 12


Q ss_pred             CCCceEEEEeeeccCCCCcccCCCCCCCCCCCCcceeecCcccccCCCCCCCCCccceEEEeCCcEEEEEEEecCCCCCc
Q psy4302         177 DYPSHTIIITDWLHGMTDAKFPGNTYANFGTRTESFLINGRSVFKSGNGTSNPVPYSKFKVNKGLRHRFRIIGGSCLACP  256 (613)
Q Consensus       177 d~~e~~l~l~d~~~~~~~~~~~~~~~~~~~~~~~~~lING~~~~~~~~~~~~~~~~~~~~v~~G~~~rlRliN~~~~~~~  256 (613)
                      | .|.+|+++||+++...........+.....++.+||||+..             +.++|++|++|||||||++... .
T Consensus       160 d-~e~~l~l~Dw~~~~~~~~~~~~~~g~~~~~~d~~liNG~~~-------------~~~~v~~G~~yRlRliNa~~~~-~  224 (539)
T PLN02835        160 D-GDFTLLVGDWYKTSHKTLQQRLDSGKVLPFPDGVLINGQTQ-------------STFSGDQGKTYMFRISNVGLST-S  224 (539)
T ss_pred             C-ceEEEEeeccccCCHHHHHHHhhcCCCCCCCceEEEccccC-------------ceEEECCCCEEEEEEEEcCCCc-c
Confidence            3 26899999999987543221111222345789999999987             7899999999999999999985 8


Q ss_pred             EEEEEeceeeEEEEeCCcccceeeeeEEEEccceeeeecccEEEEccCCccC---------cCCCCceeEEEEecccCCC
Q psy4302         257 MLFFVEKHRMNLITVDGTPVQPQMFDSITIFPGQYTPVNSAIVLNINLDAAH---------MGSRRDRLNILRLRKSLNA  327 (613)
Q Consensus       257 ~~~~i~gh~~~via~DG~~v~P~~~d~l~l~pgeR~~~~~dv~v~a~~~~~~---------~~~~~~~~ail~Y~~~~~~  327 (613)
                      +.|+|+||+|+||++||.+++|..++.|.|++||||    ||+|+++++.+.         ........|||+|++...+
T Consensus       225 ~~f~i~gH~~~VI~~DG~~v~p~~~~~l~i~~GqRy----dvlv~~~~~~g~y~i~a~~~~~~~~~~~~ail~Y~~~~~~  300 (539)
T PLN02835        225 LNFRIQGHTMKLVEVEGSHTIQNIYDSLDVHVGQSV----AVLVTLNQSPKDYYIVASTRFTRQILTATAVLHYSNSRTP  300 (539)
T ss_pred             EEEEECCCEEEEEEECCccCCCceeeEEEECcCceE----EEEEEcCCCCCcEEEEEEccccCCCcceEEEEEECCCCCC
Confidence            999999999999999999999999999999999999    999999987663         1234567899999874221


Q ss_pred             CCCCCCCCCC--CCcccccCc----CCCCCCcccccc--------CCCCceEEEEEEeeeeeccCccccCCcccceeeee
Q psy4302         328 LDSSDCSDTN--PNVCWNHVN----SLTPATEKATVL--------KAVPDIRLVFAVDEYHFTRDSLFWNDEDEYHRWFQ  393 (613)
Q Consensus       328 ~~~~~~~~~~--~~~~~~~l~----~~~~~~~~~~~~--------~~~pd~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~  393 (613)
                      .....+..+.  ...+..+..    .+.+....  ..        ...++.++.+...+                     
T Consensus       301 ~~~~~p~~p~~~~~~~~~~~~~~~~~l~~~~~~--p~~~~~~~~~~~~~~~~~~~~~~~---------------------  357 (539)
T PLN02835        301 ASGPLPALPSGELHWSMRQARTYRWNLTASAAR--PNPQGSFHYGKITPTKTIVLANSA---------------------  357 (539)
T ss_pred             CCCCCCCCCccccccccchhhccccccCccccC--CCCCccccccccCCCceEEEeccc---------------------
Confidence            1111011010  000111100    01110000  00        00112222111100                     


Q ss_pred             cCCCceeeEEecceeccCCCCCcccccCCCCCCCCCCCCCCccCCccccCCccceeeEEEEecCCCEEEEEEEeCCCCCC
Q psy4302         394 SSPNVIKTHVTNNISLGILPFPILSQDLPIPKEMECPKDRSVCGKSAEKGGKLCECVEIIKVGLNQVAEIIFIDWIGPTS  473 (613)
Q Consensus       394 ~~~~~~~~~~iN~~s~~~p~~P~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~g~~ve~vl~N~~~~~~  473 (613)
                      ...++...|.+|+++|..|..|+|.+.+...++.||...-..-..    +...+.++.++.++.|++|||+|+|. .   
T Consensus       358 ~~~~g~~~w~iN~~s~~~p~~P~L~~~~~~~~~~~~~~~~~~~~~----~~~~~~~t~~~~~~~~~~Veivi~N~-~---  429 (539)
T PLN02835        358 PLINGKQRYAVNGVSYVNSDTPLKLADYFGIPGVFSVNSIQSLPS----GGPAFVATSVMQTSLHDFLEVVFQNN-E---  429 (539)
T ss_pred             cccCCeEEEEECCcccCCCCCChhhhhhhcCCCccccCccccCCC----CCccccCCeEEEcCCCCEEEEEEECC-C---
Confidence            001234689999999998999987654433345565332100000    02245578899999999999999998 3   


Q ss_pred             CCCCCeeeecCcEEEEEeccCCCcccccccccchHHhhhccCCCCCCCCCCCCCccceEEcCCCcEEEEEEEecCcceeE
Q psy4302         474 TFLHPMHLHGTDIYIIEQGIIPVAEDHRAFVGKLQERLAREGPDLATKIRPQPCVKDTVTIPPNGYTVVRVHFNNPGIWI  553 (613)
Q Consensus       474 ~~~HPfHLHG~~F~Vl~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~n~~~p~~kDTv~Vp~~g~~vIrf~adNPG~Wl  553 (613)
                      ...||||||||+||||++|. +.++                ......+|+.+|++||||.||++||++|||+|||||.|+
T Consensus       430 ~~~HP~HLHGh~F~Vlg~G~-g~~~----------------~~~~~~~nl~nP~~RDTv~vp~~gw~~IrF~aDNPG~Wl  492 (539)
T PLN02835        430 KTMQSWHLDGYDFWVVGYGS-GQWT----------------PAKRSLYNLVDALTRHTAQVYPKSWTTILVSLDNQGMWN  492 (539)
T ss_pred             CCCCCCCCCCccEEEEeccC-CCCC----------------cccccccCCCCCCccceEEeCCCCEEEEEEECcCCEEee
Confidence            45899999999999999986 4432                011123578999999999999999999999999999999


Q ss_pred             EeechhhhhhcCceEEEEeccC----CCCCCCCCCCCCCCCC
Q psy4302         554 MHCHFIFHTETGMNTVFQVGDR----KDFVQTPPEFPTCNNY  591 (613)
Q Consensus       554 ~HCHi~~H~~~GM~~~~~V~~~----~~~~~~p~~~p~C~~~  591 (613)
                      |||||++|+..||+++|+|++.    ++++++|+++|+||.-
T Consensus       493 ~HCHi~~H~~~Gm~~~~~V~~~~~~~~~~~~~P~~~~~Cg~~  534 (539)
T PLN02835        493 MRSAIWERQYLGQQFYLRVWNQVHSLANEYDIPDNALLCGKA  534 (539)
T ss_pred             eeecchhhhhcccEEEEEEccCCCccccccCCCccccccccC
Confidence            9999999999999999999876    6899999999999844

>PLN02991 oxidoreductase Back     alignment and domain information
>PLN02354 copper ion binding / oxidoreductase Back     alignment and domain information
>TIGR03389 laccase laccase, plant Back     alignment and domain information
>PLN00044 multi-copper oxidase-related protein; Provisional Back     alignment and domain information
>PLN02191 L-ascorbate oxidase Back     alignment and domain information
>TIGR03388 ascorbase L-ascorbate oxidase, plant type Back     alignment and domain information
>PLN02168 copper ion binding / pectinesterase Back     alignment and domain information
>PLN02792 oxidoreductase Back     alignment and domain information
>PLN02604 oxidoreductase Back     alignment and domain information
>KOG1263|consensus Back     alignment and domain information
>TIGR03390 ascorbOXfungal L-ascorbate oxidase, fungal type Back     alignment and domain information
>TIGR01480 copper_res_A copper-resistance protein, CopA family Back     alignment and domain information
>PRK10965 multicopper oxidase; Provisional Back     alignment and domain information
>PRK10883 FtsI repressor; Provisional Back     alignment and domain information
>COG2132 SufI Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing Back     alignment and domain information
>PF07732 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR011707 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>PF07731 Cu-oxidase_2: Multicopper oxidase; InterPro: IPR011706 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>PF00394 Cu-oxidase: Multicopper oxidase; InterPro: IPR001117 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>TIGR03095 rusti_cyanin rusticyanin Back     alignment and domain information
>TIGR01480 copper_res_A copper-resistance protein, CopA family Back     alignment and domain information
>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing Back     alignment and domain information
>PRK10965 multicopper oxidase; Provisional Back     alignment and domain information
>PRK10883 FtsI repressor; Provisional Back     alignment and domain information
>PLN02835 oxidoreductase Back     alignment and domain information
>TIGR03096 nitroso_cyanin nitrosocyanin Back     alignment and domain information
>TIGR03389 laccase laccase, plant Back     alignment and domain information
>COG2132 SufI Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03388 ascorbase L-ascorbate oxidase, plant type Back     alignment and domain information
>PLN02168 copper ion binding / pectinesterase Back     alignment and domain information
>PLN02991 oxidoreductase Back     alignment and domain information
>PLN02354 copper ion binding / oxidoreductase Back     alignment and domain information
>PLN02604 oxidoreductase Back     alignment and domain information
>PF07731 Cu-oxidase_2: Multicopper oxidase; InterPro: IPR011706 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>PLN02792 oxidoreductase Back     alignment and domain information
>TIGR03390 ascorbOXfungal L-ascorbate oxidase, fungal type Back     alignment and domain information
>PLN02191 L-ascorbate oxidase Back     alignment and domain information
>PF07732 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR011707 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>PLN00044 multi-copper oxidase-related protein; Provisional Back     alignment and domain information
>TIGR02656 cyanin_plasto plastocyanin Back     alignment and domain information
>PF00394 Cu-oxidase: Multicopper oxidase; InterPro: IPR001117 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>PF00127 Copper-bind: Copper binding proteins, plastocyanin/azurin family; InterPro: IPR000923 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>TIGR03095 rusti_cyanin rusticyanin Back     alignment and domain information
>PRK02710 plastocyanin; Provisional Back     alignment and domain information
>KOG1263|consensus Back     alignment and domain information
>PF13473 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>TIGR02657 amicyanin amicyanin Back     alignment and domain information
>TIGR02656 cyanin_plasto plastocyanin Back     alignment and domain information
>TIGR03094 sulfo_cyanin sulfocyanin Back     alignment and domain information
>TIGR02375 pseudoazurin pseudoazurin Back     alignment and domain information
>PF06525 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Members of this family are blue-copper redox proteins designated sulfocyanin, from the archaeal genera Sulfolobus, Ferroplasma, and Picrophilus Back     alignment and domain information
>TIGR03102 halo_cynanin halocyanin domain Back     alignment and domain information
>COG3794 PetE Plastocyanin [Energy production and conversion] Back     alignment and domain information
>TIGR03096 nitroso_cyanin nitrosocyanin Back     alignment and domain information
>PF00127 Copper-bind: Copper binding proteins, plastocyanin/azurin family; InterPro: IPR000923 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF13473 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D Back     alignment and domain information
>PRK02710 plastocyanin; Provisional Back     alignment and domain information
>TIGR02375 pseudoazurin pseudoazurin Back     alignment and domain information
>PF00116 COX2: Cytochrome C oxidase subunit II, periplasmic domain This family corresponds to chains b and o Back     alignment and domain information
>COG4454 Uncharacterized copper-binding protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4454 Uncharacterized copper-binding protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02657 amicyanin amicyanin Back     alignment and domain information
>TIGR03102 halo_cynanin halocyanin domain Back     alignment and domain information
>TIGR02695 azurin azurin Back     alignment and domain information
>PRK10378 inactive ferrous ion transporter periplasmic protein EfeO; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query613
1aoz_A552 Refined Crystal Structure Of Ascorbate Oxidase At 1 2e-40
3kw7_A502 Crystal Structure Of Lacb From Trametes Sp. Ah28-2 6e-36
2qt6_A498 Crystal Structure Determination Of A Blue Laccase F 6e-33
3t6v_A495 Crystal Structure Of Laccase From Steccherinum Ochr 4e-31
1gyc_A499 Crystal Structure Determination At Room Temperature 4e-31
1hfu_A503 Type-2 Cu-Depleted Laccase From Coprinus Cinereus A 1e-30
1a65_A504 Type-2 Cu-depleted Laccase From Coprinus Cinereus L 1e-30
3div_A499 Crystal Structure Of Laccase From Cerrena Maxima At 1e-30
1v10_A521 Structure Of Rigidoporus Lignosus Laccase From Hemi 2e-30
2hrg_A496 Crystal Structure Of Blue Laccase From Trametes Tro 2e-30
3fpx_A499 Native Fungus Laccase From Trametes Hirsuta Length 2e-30
3pxl_A499 Type-2 Cu-Depleted Fungus Laccase From Trametes Hir 2e-30
3v9e_A580 Structure Of The L513m Mutant Of The Laccase From B 4e-30
3v9e_A580 Structure Of The L513m Mutant Of The Laccase From B 4e-08
3sqr_A580 Crystal Structure Of Laccase From Botrytis Aclada A 4e-30
3sqr_A580 Crystal Structure Of Laccase From Botrytis Aclada A 1e-07
2hzh_A499 Crystal Structure Of Laccase From Coriolus Zonatus 4e-30
2hzh_A499 Crystal Structure Of Laccase From Coriolus Zonatus 2e-04
2h5u_A499 Crystal Structure Of Laccase From Cerrena Maxima At 1e-29
4a2f_A497 Coriolopsis Gallica Laccase Collected At 12.65 Kev 5e-29
4a2d_A496 Coriolopsis Gallica Laccase T2 Copper Depleted At P 5e-29
2xyb_A497 Crystal Structure Of A Fully Functional Laccase Fro 1e-28
1kya_A499 Active Laccase From Trametes Versicolor Complexed W 9e-28
1zpu_A534 Crystal Structure Of Fet3p, A Multicopper Oxidase T 1e-27
1gw0_A559 Crystal Structure Of Laccase From Melanocarpus Albo 6e-22
1gw0_A559 Crystal Structure Of Laccase From Melanocarpus Albo 1e-08
3dkh_A559 L559a Mutant Of Melanocarpus Albomyces Laccase Leng 6e-22
3dkh_A559 L559a Mutant Of Melanocarpus Albomyces Laccase Leng 1e-08
2q9o_A559 Near-Atomic Resolution Structure Of A Melanocarpus 1e-21
2q9o_A559 Near-Atomic Resolution Structure Of A Melanocarpus 1e-08
3g5w_A318 Crystal Structure Of Blue Copper Oxidase From Nitro 2e-19
3pps_A604 Crystal Structure Of An Ascomycete Fungal Laccase F 2e-17
3pps_A604 Crystal Structure Of An Ascomycete Fungal Laccase F 5e-07
3zx1_A481 Multicopper Oxidase From Campylobacter Jejuni: A Me 1e-11
3zx1_A481 Multicopper Oxidase From Campylobacter Jejuni: A Me 6e-04
3gdc_A288 Crystal Structure Of Multicopper Oxidase Length = 2 2e-07
3t9w_A299 Small Laccase From Amycolatopsis Sp. Atcc 39116 Len 6e-06
2xu9_A439 Crystal Structure Of Laccase From Thermus Thermophi 3e-05
>pdb|1AOZ|A Chain A, Refined Crystal Structure Of Ascorbate Oxidase At 1.9 Angstroms Resolution Length = 552 Back     alignment and structure 
Iteration: 1

 Score =  163 bits (413), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 141/543 (25%), Positives = 232/543 (42%), Gaps = 63/543 (11%)
Query: 61  ERPILTINRRLPSPSIQVCRGDTIVVDVKNKIVDRVVTIHWHGVYQRHTPHSDGVPLLTQ 120
           E  ++ IN + P P+I+   GD++VV++ NK+    V IHWHG+ QR TP +DG   ++Q
Sbjct: 21  ENIVMGINGQFPGPTIRANAGDSVVVELTNKLHTEGVVIHWHGILQRGTPWADGTASISQ 80
Query: 121 CPIIPETTYRYKFPAMPYGTFFYHSHIGFQKMDGLEGPLVIRRPK-KADPNRDQYDTDYP 179
           C I P  T+ Y F     GTFFYH H+G Q+  GL G L++  P+ K +P    YD +  
Sbjct: 81  CAINPGETFFYNFTVDNPGTFFYHGHLGMQRSAGLYGSLIVDPPQGKKEP--FHYDGEI- 137
Query: 180 SHTIIITDWLHGMTDAKFPGNTYA--NFGTRTESFLINGRSVFKSG-------------- 223
              ++++DW H     +  G +     +    ++ L+NGR  F                 
Sbjct: 138 --NLLLSDWWHQSIHKQEVGLSSKPIRWIGEPQTILLNGRGQFDCSIAAKYDSNLEPCKL 195
Query: 224 NGTSNPVPYSKFKVNKGLRHRFRIIGGSCLACPMLFFVEKHRMNLITVDGTPVQPQMFDS 283
            G+ +  PY  F V+    +R RI   + LA  + F +  H++ ++  DG  VQP     
Sbjct: 196 KGSESCAPYI-FHVSPKKTYRIRIASTTALAA-LNFAIGNHQLLVVEADGNYVQPFYTSD 253
Query: 284 ITIFPGQYTPV--------NSAIVLNINLDAAHMGSRRDRLNILRLRKSLNALDSSDCSD 335
           I I+ G+   V        +    +++   A H  +      +  L  S++ L +S    
Sbjct: 254 IDIYSGESYSVLITTDQNPSENYWVSVGTRARHPNTPPGLTLLNYLPNSVSKLPTSPPPQ 313
Query: 336 TNPNVCWNHVNSLTPATEKATVLKAVPDIRLVFAVDEYHFTRDSLFWNDEDEYHRWFQSS 395
           T     W+  +     T + T     P   +        F R     N ++  + + + +
Sbjct: 314 T---PAWDDFDRSKNFTYRITAAMGSPKPPV-------KFNRRIFLLNTQNVINGYVKWA 363
Query: 396 PNVIKTHVTNNISLGILPFPILSQDLPIPKEMECPKDRSVCGKSAEKGGKLCECVEIIKV 455
            N +   +     LG + + +L      P     P+D  +      +  ++   V   K+
Sbjct: 364 INDVSLALPPTPYLGAMKYNLLHAFDQNPPPEVFPEDYDIDTPPTNEKTRIGNGVYQFKI 423
Query: 456 GLNQVAEIIF--IDWIGPTSTFLHPMHLHGTDIYIIEQGIIPVAEDHRAFVGKLQERLAR 513
           G  +V ++I    + +    +  HP HLHG D +++  G            GK     A 
Sbjct: 424 G--EVVDVILQNANMMKENLSETHPWHLHGHDFWVLGYGD-----------GKFS---AE 467
Query: 514 EGPDLATKIRPQPCVKDTVTIPPNGYTVVRVHFNNPGIWIMHCHFIFHTETGMNTVFQVG 573
           E   L  K    P +++TV I P G+T +R   +NPG+W  HCH   H   GM  VF  G
Sbjct: 468 EESSLNLK---NPPLRNTVVIFPYGWTAIRFVADNPGVWAFHCHIEPHLHMGMGVVFAEG 524
Query: 574 DRK 576
             K
Sbjct: 525 VEK 527
>pdb|3KW7|A Chain A, Crystal Structure Of Lacb From Trametes Sp. Ah28-2 Length = 502 Back     alignment and structure
>pdb|2QT6|A Chain A, Crystal Structure Determination Of A Blue Laccase From Lentinus Tigrinus Length = 498 Back     alignment and structure
>pdb|3T6V|A Chain A, Crystal Structure Of Laccase From Steccherinum Ochraceum Length = 495 Back     alignment and structure
>pdb|1GYC|A Chain A, Crystal Structure Determination At Room Temperature Of A Laccase From Trametes Versicolor In Its Oxidised Form Containing A Full Complement Of Copper Ions Length = 499 Back     alignment and structure
>pdb|1HFU|A Chain A, Type-2 Cu-Depleted Laccase From Coprinus Cinereus At 1.68 A Resolution Length = 503 Back     alignment and structure
>pdb|1A65|A Chain A, Type-2 Cu-depleted Laccase From Coprinus Cinereus Length = 504 Back     alignment and structure
>pdb|3DIV|A Chain A, Crystal Structure Of Laccase From Cerrena Maxima At 1.76a Resolution Length = 499 Back     alignment and structure
>pdb|1V10|A Chain A, Structure Of Rigidoporus Lignosus Laccase From Hemihedrally Twinned Crystals Length = 521 Back     alignment and structure
>pdb|2HRG|A Chain A, Crystal Structure Of Blue Laccase From Trametes Trogii Complexed With P-Methylbenzoate Length = 496 Back     alignment and structure
>pdb|3FPX|A Chain A, Native Fungus Laccase From Trametes Hirsuta Length = 499 Back     alignment and structure
>pdb|3PXL|A Chain A, Type-2 Cu-Depleted Fungus Laccase From Trametes Hirsuta Length = 499 Back     alignment and structure
>pdb|3V9E|A Chain A, Structure Of The L513m Mutant Of The Laccase From B.aclada Length = 580 Back     alignment and structure
>pdb|3V9E|A Chain A, Structure Of The L513m Mutant Of The Laccase From B.aclada Length = 580 Back     alignment and structure
>pdb|3SQR|A Chain A, Crystal Structure Of Laccase From Botrytis Aclada At 1.67 A Resolution Length = 580 Back     alignment and structure
>pdb|3SQR|A Chain A, Crystal Structure Of Laccase From Botrytis Aclada At 1.67 A Resolution Length = 580 Back     alignment and structure
>pdb|2HZH|A Chain A, Crystal Structure Of Laccase From Coriolus Zonatus At 2.6 A Resolution Length = 499 Back     alignment and structure
>pdb|2HZH|A Chain A, Crystal Structure Of Laccase From Coriolus Zonatus At 2.6 A Resolution Length = 499 Back     alignment and structure
>pdb|2H5U|A Chain A, Crystal Structure Of Laccase From Cerrena Maxima At 1.9a Resolution Length = 499 Back     alignment and structure
>pdb|4A2F|A Chain A, Coriolopsis Gallica Laccase Collected At 12.65 Kev Length = 497 Back     alignment and structure
>pdb|4A2D|A Chain A, Coriolopsis Gallica Laccase T2 Copper Depleted At Ph 4.5 Length = 496 Back     alignment and structure
>pdb|2XYB|A Chain A, Crystal Structure Of A Fully Functional Laccase From The Ligninolytic Fungus Pycnoporus Cinnabarinus Length = 497 Back     alignment and structure
>pdb|1KYA|A Chain A, Active Laccase From Trametes Versicolor Complexed With 2,5-Xylidine Length = 499 Back     alignment and structure
>pdb|1ZPU|A Chain A, Crystal Structure Of Fet3p, A Multicopper Oxidase That Functions In Iron Import Length = 534 Back     alignment and structure
>pdb|1GW0|A Chain A, Crystal Structure Of Laccase From Melanocarpus Albomyces In Four Copper Form Length = 559 Back     alignment and structure
>pdb|1GW0|A Chain A, Crystal Structure Of Laccase From Melanocarpus Albomyces In Four Copper Form Length = 559 Back     alignment and structure
>pdb|3DKH|A Chain A, L559a Mutant Of Melanocarpus Albomyces Laccase Length = 559 Back     alignment and structure
>pdb|3DKH|A Chain A, L559a Mutant Of Melanocarpus Albomyces Laccase Length = 559 Back     alignment and structure
>pdb|2Q9O|A Chain A, Near-Atomic Resolution Structure Of A Melanocarpus Albomyces Laccase Length = 559 Back     alignment and structure
>pdb|2Q9O|A Chain A, Near-Atomic Resolution Structure Of A Melanocarpus Albomyces Laccase Length = 559 Back     alignment and structure
>pdb|3G5W|A Chain A, Crystal Structure Of Blue Copper Oxidase From Nitrosomonas Europaea Length = 318 Back     alignment and structure
>pdb|3PPS|A Chain A, Crystal Structure Of An Ascomycete Fungal Laccase From Thielavia Arenaria Length = 604 Back     alignment and structure
>pdb|3PPS|A Chain A, Crystal Structure Of An Ascomycete Fungal Laccase From Thielavia Arenaria Length = 604 Back     alignment and structure
>pdb|3ZX1|A Chain A, Multicopper Oxidase From Campylobacter Jejuni: A Metallo-Oxidase Length = 481 Back     alignment and structure
>pdb|3ZX1|A Chain A, Multicopper Oxidase From Campylobacter Jejuni: A Metallo-Oxidase Length = 481 Back     alignment and structure
>pdb|3GDC|A Chain A, Crystal Structure Of Multicopper Oxidase Length = 288 Back     alignment and structure
>pdb|3T9W|A Chain A, Small Laccase From Amycolatopsis Sp. Atcc 39116 Length = 299 Back     alignment and structure
>pdb|2XU9|A Chain A, Crystal Structure Of Laccase From Thermus Thermophilus Hb27 Length = 439 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query613
1aoz_A552 Ascorbate oxidase; oxidoreductase(oxygen acceptor) 1e-114
2q9o_A559 Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct 1e-109
3t6v_A495 Laccase; beta barrel, oxidoreductase; HET: CBS; 2. 1e-108
3sqr_A580 Laccase; multicopper oxidase, glycosylation, oxido 1e-107
1hfu_A503 Laccase 1; oxidoreductase, blue multi-copper oxida 1e-105
3pxl_A499 Laccase; 4-copper protein, metal-binding, oxidored 1e-105
1zpu_A534 Iron transport multicopper oxidase FET3; ferroxida 1e-104
1v10_A521 Laccase; multicopper blue oxidase, oxidase; 1.7A { 1e-101
3g5w_A318 Multicopper oxidase type 1; two domain, laccase, n 9e-66
3g5w_A318 Multicopper oxidase type 1; two domain, laccase, n 2e-07
2zwn_A339 Two-domain type laccase; muticopper oxidase, oxido 1e-64
2zwn_A339 Two-domain type laccase; muticopper oxidase, oxido 8e-06
3od3_A488 Blue copper oxidase CUEO; multicopper oxidase, Cu( 9e-44
2xu9_A439 Laccase; oxidoreductase, multicopper oxidases; 1.5 1e-41
2xu9_A439 Laccase; oxidoreductase, multicopper oxidases; 1.5 5e-15
3gdc_A288 Multicopper oxidase; beta sandwich, plasmid, oxido 2e-38
3gdc_A288 Multicopper oxidase; beta sandwich, plasmid, oxido 6e-11
3aw5_A448 Multicopper oxidase; beta barrel, oxidoreductase; 1e-35
3aw5_A448 Multicopper oxidase; beta barrel, oxidoreductase; 5e-11
2g23_A612 PHS, phenoxazinone synthase; copper, metalloprotei 2e-35
3zx1_A481 Oxidoreductase, putative; laccase, metallo-oxidase 6e-34
3zx1_A481 Oxidoreductase, putative; laccase, metallo-oxidase 9e-14
3abg_A534 Bilirubin oxidase; cleavage on PAIR of basic resid 3e-33
3abg_A534 Bilirubin oxidase; cleavage on PAIR of basic resid 1e-13
2uxt_A451 Protein SUFI, SUFI; oxidoreductase, periplasmic, c 2e-30
2uxt_A451 Protein SUFI, SUFI; oxidoreductase, periplasmic, c 4e-07
2zoo_A442 Probable nitrite reductase; electron transfer, ele 1e-25
2zoo_A 442 Probable nitrite reductase; electron transfer, ele 3e-06
3kw8_A276 Laccase, putative copper oxidase; two-domain lacca 3e-25
3kw8_A276 Laccase, putative copper oxidase; two-domain lacca 2e-09
2wsd_A513 Spore coat protein A; oxidoreductase, multi-copper 4e-25
2wsd_A513 Spore coat protein A; oxidoreductase, multi-copper 1e-13
2j5w_A1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 4e-24
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 7e-24
2j5w_A1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 1e-15
2j5w_A1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 9e-12
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 1e-08
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 1e-06
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 1e-04
2j5w_A1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 4e-04
3cg8_A343 Laccase; oxidoreductase, multicopper blue protein; 9e-24
3cg8_A343 Laccase; oxidoreductase, multicopper blue protein; 8e-10
1kbv_A327 ANIA, major outer membrane protein PAN 1; ANIA[NO2 6e-23
1kbv_A327 ANIA, major outer membrane protein PAN 1; ANIA[NO2 2e-06
1sdd_A306 Coagulation factor V; copper-binding protein, cofa 1e-21
1sdd_A306 Coagulation factor V; copper-binding protein, cofa 1e-09
2r7e_A742 Coagulation factor VIII; ceruloplasmin fold, cuppe 1e-21
2r7e_A 742 Coagulation factor VIII; ceruloplasmin fold, cuppe 1e-20
2r7e_A742 Coagulation factor VIII; ceruloplasmin fold, cuppe 7e-09
2r7e_A 742 Coagulation factor VIII; ceruloplasmin fold, cuppe 1e-08
2r7e_A742 Coagulation factor VIII; ceruloplasmin fold, cuppe 3e-06
2bw4_A340 Copper-containing nitrite reductase; oxidoreductas 3e-19
2bw4_A340 Copper-containing nitrite reductase; oxidoreductas 3e-05
2dv6_A447 Nitrite reductase; electron transfer, reduction, d 3e-19
2dv6_A447 Nitrite reductase; electron transfer, reduction, d 4e-07
2dv6_A447 Nitrite reductase; electron transfer, reduction, d 1e-06
1oe1_A336 Dissimilatory copper-containing nitrite reductase; 5e-15
1oe1_A336 Dissimilatory copper-containing nitrite reductase; 2e-04
1sdd_B647 Coagulation factor V; copper-binding protein, cofa 2e-14
1mzy_A333 Copper-containing nitrite reductase; mutant M182T, 6e-14
2r7e_B770 Coagulation factor VIII; ceruloplasmin fold, cuppe 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Length = 552 Back     alignment and structure
 Score =  352 bits (904), Expect = e-114
 Identities = 132/581 (22%), Positives = 221/581 (38%), Gaps = 84/581 (14%)

Query: 55  VTADGVERPILTINRRLPSPSIQVCRGDTIVVDVKNKIVDRVVTIHWHGVYQRHTPHSDG 114
              +  E  ++ IN + P P+I+   GD++VV++ NK+    V IHWHG+ QR TP +DG
Sbjct: 15  WAPNCNENIVMGINGQFPGPTIRANAGDSVVVELTNKLHTEGVVIHWHGILQRGTPWADG 74

Query: 115 VPLLTQCPIIPETTYRYKFPAMPYGTFFYHSHIGFQKMDGLEGPLVIRRPKKADPNRDQY 174
              ++QC I P  T+ Y F     GTFFYH H+G Q+  GL G L++  P +       Y
Sbjct: 75  TASISQCAINPGETFFYNFTVDNPGTFFYHGHLGMQRSAGLYGSLIVD-PPQGKKEPFHY 133

Query: 175 DTDYPSHTIIITDWLHGMTDAKFPG--NTYANFGTRTESFLINGRSVF---KSGNGTSNP 229
           D +     ++++DW H     +  G  +    +    ++ L+NGR  F    +    SN 
Sbjct: 134 DGE---INLLLSDWWHQSIHKQEVGLSSKPIRWIGEPQTILLNGRGQFDCSIAAKYDSNL 190

Query: 230 VP----------YSKFKVNKGLRHRFRIIGGSCLACPMLFFVEKHRMNLITVDGTPVQPQ 279
            P             F V+    +R RI   + L   + F +  H++ ++  DG  VQP 
Sbjct: 191 EPCKLKGSESCAPYIFHVSPKKTYRIRIASTTAL-AALNFAIGNHQLLVVEADGNYVQPF 249

Query: 280 MFDSITIFPGQ-Y--------TPV-NSAIVLNINLDAAHMGSRRDRLNILRLRKSLNALD 329
               I I+ G+ Y         P  N  + +          +    L +L    +  +  
Sbjct: 250 YTSDIDIYSGESYSVLITTDQNPSENYWVSVGTRAR---HPNTPPGLTLLNYLPNSVSKL 306

Query: 330 SSDCSDTNPNVCWNHVNSLTPATEKATVLKAVPDIRLV-FAVDEYHFTRDSLFWNDEDEY 388
            +      P       +    +      + A           +   F       N  + Y
Sbjct: 307 PTSPPPQTPAW-----DDFDRSKNFTYRITAAMGSPKPPVKFNRRIFL--LNTQNVINGY 359

Query: 389 HRWFQSSPNVIKTHVTNNISLGILPFPILSQDL--------PIPKEMECPKDRSVCGKSA 440
            +W             N++SL + P P L              P     P+D  +   + 
Sbjct: 360 VKWA-----------INDVSLALPPTPYLGAMKYNLLHAFDQNPPPEVFPEDYDI--DTP 406

Query: 441 EKGGKLCECVEIIKVGLNQVAEIIFIDW--IGPTSTFLHPMHLHGTDIYIIEQGIIPVAE 498
               K      + +  + +V ++I  +   +    +  HP HLHG D +++  G      
Sbjct: 407 PTNEKTRIGNGVYQFKIGEVVDVILQNANMMKENLSETHPWHLHGHDFWVLGYG------ 460

Query: 499 DHRAFVGKLQERLAREGPDLATKIRPQ-PCVKDTVTIPPNGYTVVRVHFNNPGIWIMHCH 557
                 GK          +  + +  + P +++TV I P G+T +R   +NPG+W  HCH
Sbjct: 461 -----DGKFS-------AEEESSLNLKNPPLRNTVVIFPYGWTAIRFVADNPGVWAFHCH 508

Query: 558 FIFHTETGMNTVFQVGDRKDFVQTPPEFPTCNNYLPPVDPN 598
              H   GM  VF  G      + P +   C      +  N
Sbjct: 509 IEPHLHMGMGVVFAEGVE-KVGRIPTKALACGGTAKSLINN 548
>2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* Length = 559 Back     alignment and structure
>3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* Length = 495 Back     alignment and structure
>3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} Length = 580 Back     alignment and structure
>1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* Length = 503 Back     alignment and structure
>3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* Length = 499 Back     alignment and structure
>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Length = 534 Back     alignment and structure
>1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 Length = 521 Back     alignment and structure
>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Length = 318 Back     alignment and structure
>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Length = 318 Back     alignment and structure
>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Length = 339 Back     alignment and structure
>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Length = 339 Back     alignment and structure
>3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... Length = 488 Back     alignment and structure
>2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A Length = 439 Back     alignment and structure
>2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A Length = 439 Back     alignment and structure
>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Length = 288 Back     alignment and structure
>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Length = 288 Back     alignment and structure
>3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} Length = 448 Back     alignment and structure
>3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} Length = 448 Back     alignment and structure
>3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} Length = 481 Back     alignment and structure
>3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} Length = 481 Back     alignment and structure
>3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* Length = 534 Back     alignment and structure
>3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* Length = 534 Back     alignment and structure
>2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A Length = 451 Back     alignment and structure
>2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A Length = 451 Back     alignment and structure
>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Length = 442 Back     alignment and structure
>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Length = 442 Back     alignment and structure
>3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} Length = 276 Back     alignment and structure
>3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} Length = 276 Back     alignment and structure
>2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A Length = 513 Back     alignment and structure
>2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A Length = 513 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 Back     alignment and structure
>3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} Length = 343 Back     alignment and structure
>3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} Length = 343 Back     alignment and structure
>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Length = 327 Back     alignment and structure
>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Length = 327 Back     alignment and structure
>1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 Length = 306 Back     alignment and structure
>1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 Length = 306 Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Length = 742 Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Length = 742 Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Length = 742 Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Length = 742 Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Length = 742 Back     alignment and structure
>2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... Length = 340 Back     alignment and structure
>2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... Length = 340 Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Length = 447 Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Length = 447 Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Length = 447 Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Length = 336 Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Length = 336 Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Length = 647 Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Length = 333 Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Length = 770 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query613
1aoz_A552 Ascorbate oxidase; oxidoreductase(oxygen acceptor) 100.0
3sqr_A580 Laccase; multicopper oxidase, glycosylation, oxido 100.0
3pxl_A499 Laccase; 4-copper protein, metal-binding, oxidored 100.0
3t6v_A495 Laccase; beta barrel, oxidoreductase; HET: CBS; 2. 100.0
1zpu_A534 Iron transport multicopper oxidase FET3; ferroxida 100.0
1v10_A521 Laccase; multicopper blue oxidase, oxidase; 1.7A { 100.0
1hfu_A503 Laccase 1; oxidoreductase, blue multi-copper oxida 100.0
2q9o_A559 Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct 100.0
2xu9_A439 Laccase; oxidoreductase, multicopper oxidases; 1.5 100.0
3abg_A534 Bilirubin oxidase; cleavage on PAIR of basic resid 100.0
2uxt_A451 Protein SUFI, SUFI; oxidoreductase, periplasmic, c 100.0
2wsd_A513 Spore coat protein A; oxidoreductase, multi-copper 100.0
3gyr_A612 PHS, phenoxazinone synthase; metalloprotein, lacca 100.0
3zx1_A481 Oxidoreductase, putative; laccase, metallo-oxidase 100.0
3aw5_A448 Multicopper oxidase; beta barrel, oxidoreductase; 100.0
3od3_A488 Blue copper oxidase CUEO; multicopper oxidase, Cu( 100.0
2g23_A612 PHS, phenoxazinone synthase; copper, metalloprotei 100.0
3g5w_A318 Multicopper oxidase type 1; two domain, laccase, n 100.0
2r7e_A 742 Coagulation factor VIII; ceruloplasmin fold, cuppe 100.0
2zwn_A339 Two-domain type laccase; muticopper oxidase, oxido 100.0
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 100.0
3kw8_A276 Laccase, putative copper oxidase; two-domain lacca 100.0
3t9w_A299 Small laccase, multi-copper oxidase; two-domain co 100.0
3tas_A313 Small laccase, multi-copper oxidase; two-domain la 100.0
2dv6_A447 Nitrite reductase; electron transfer, reduction, d 100.0
2j5w_A1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 100.0
1kbv_A327 ANIA, major outer membrane protein PAN 1; ANIA[NO2 100.0
3cg8_A343 Laccase; oxidoreductase, multicopper blue protein; 100.0
3gdc_A288 Multicopper oxidase; beta sandwich, plasmid, oxido 100.0
1mzy_A333 Copper-containing nitrite reductase; mutant M182T, 100.0
2zoo_A442 Probable nitrite reductase; electron transfer, ele 100.0
1oe1_A336 Dissimilatory copper-containing nitrite reductase; 100.0
2bw4_A340 Copper-containing nitrite reductase; oxidoreductas 100.0
1sdd_A306 Coagulation factor V; copper-binding protein, cofa 100.0
1sdd_B647 Coagulation factor V; copper-binding protein, cofa 100.0
2r7e_B770 Coagulation factor VIII; ceruloplasmin fold, cuppe 100.0
2dv6_A447 Nitrite reductase; electron transfer, reduction, d 100.0
2r7e_A742 Coagulation factor VIII; ceruloplasmin fold, cuppe 100.0
3gdc_A288 Multicopper oxidase; beta sandwich, plasmid, oxido 99.93
2zwn_A339 Two-domain type laccase; muticopper oxidase, oxido 99.92
3g5w_A318 Multicopper oxidase type 1; two domain, laccase, n 99.91
1sdd_A306 Coagulation factor V; copper-binding protein, cofa 99.81
1sdd_B 647 Coagulation factor V; copper-binding protein, cofa 99.8
1kbv_A327 ANIA, major outer membrane protein PAN 1; ANIA[NO2 99.74
2r7e_B 770 Coagulation factor VIII; ceruloplasmin fold, cuppe 99.74
2bw4_A340 Copper-containing nitrite reductase; oxidoreductas 99.74
1mzy_A333 Copper-containing nitrite reductase; mutant M182T, 99.69
2uxt_A451 Protein SUFI, SUFI; oxidoreductase, periplasmic, c 99.64
2xu9_A439 Laccase; oxidoreductase, multicopper oxidases; 1.5 99.63
2zoo_A 442 Probable nitrite reductase; electron transfer, ele 99.62
1oe1_A336 Dissimilatory copper-containing nitrite reductase; 99.59
3cvb_A105 Plastocyanin; cupredoxin, SELF assembly, copper, e 99.54
3kw8_A276 Laccase, putative copper oxidase; two-domain lacca 99.52
1hfu_A503 Laccase 1; oxidoreductase, blue multi-copper oxida 99.49
1v10_A521 Laccase; multicopper blue oxidase, oxidase; 1.7A { 99.49
3zx1_A481 Oxidoreductase, putative; laccase, metallo-oxidase 99.44
2cal_A154 Rusticyanin; iron respiratory electron transport c 99.42
3t6v_A495 Laccase; beta barrel, oxidoreductase; HET: CBS; 2. 99.37
1zpu_A534 Iron transport multicopper oxidase FET3; ferroxida 99.36
3pxl_A499 Laccase; 4-copper protein, metal-binding, oxidored 99.35
3aw5_A448 Multicopper oxidase; beta barrel, oxidoreductase; 99.33
3od3_A488 Blue copper oxidase CUEO; multicopper oxidase, Cu( 99.32
2q9o_A559 Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct 99.31
1aoz_A552 Ascorbate oxidase; oxidoreductase(oxygen acceptor) 99.3
3cg8_A343 Laccase; oxidoreductase, multicopper blue protein; 99.28
1iby_A112 Nitrosocyanin; RED copper, cupredoxin, beta hairpi 99.26
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 99.2
2g23_A612 PHS, phenoxazinone synthase; copper, metalloprotei 99.18
2wsd_A513 Spore coat protein A; oxidoreductase, multi-copper 99.15
3abg_A534 Bilirubin oxidase; cleavage on PAIR of basic resid 99.13
3sqr_A580 Laccase; multicopper oxidase, glycosylation, oxido 99.11
2ov0_A105 Amicyanin; beta-sandwich, electron transport; 0.75 99.04
2aan_A139 Auracyanin A; cupredoxin fold, electron transport; 98.99
3cvb_A105 Plastocyanin; cupredoxin, SELF assembly, copper, e 98.93
3tas_A313 Small laccase, multi-copper oxidase; two-domain la 98.88
3t9w_A299 Small laccase, multi-copper oxidase; two-domain co 98.87
2gim_A106 Plastocyanin; beta sheet, Cu, helix, electron tran 98.87
3gyr_A612 PHS, phenoxazinone synthase; metalloprotein, lacca 98.81
2aan_A139 Auracyanin A; cupredoxin fold, electron transport; 98.77
4hci_A100 Cupredoxin 1; structural genomics, niaid, national 98.65
2gim_A106 Plastocyanin; beta sheet, Cu, helix, electron tran 98.59
2plt_A98 Plastocyanin; electron transport; 1.50A {Chlamydom 98.56
1qhq_A140 Protein (auracyanin); electron transfer, cupredoxi 98.53
1pcs_A98 Plastocyanin; electron transport; 2.15A {Synechocy 98.51
1bxv_A91 Plastocyanin; copper protein, electron transfer; 1 98.49
1qhq_A140 Protein (auracyanin); electron transfer, cupredoxi 98.45
3erx_A123 Pseudoazurin; copper protein, high-resolution, E t 98.42
1b3i_A97 PETE protein, protein (plastocyanin); electron tra 98.39
1kdj_A102 Plastocyanin; electron transfer, photosystem, PAI- 98.36
3tu6_A127 Pseudoazurin (blue copper protein); cupredoxins, b 98.36
1byp_A99 Protein (plastocyanin); electron transfer, photosy 98.32
1pcs_A98 Plastocyanin; electron transport; 2.15A {Synechocy 98.31
1plc_A99 Plastocyanin; electron transport; 1.33A {Populus n 98.3
3ef4_A124 Pseudoazurin, blue copper protein; electron transf 98.3
2plt_A98 Plastocyanin; electron transport; 1.50A {Chlamydom 98.29
1bxv_A91 Plastocyanin; copper protein, electron transfer; 1 98.27
1b3i_A97 PETE protein, protein (plastocyanin); electron tra 98.2
1byp_A99 Protein (plastocyanin); electron transfer, photosy 98.09
1paz_A123 Pseudoazurin precursor; electron transfer(cupropro 98.08
1pmy_A123 Pseudoazurin; electron transfer(cuproprotein); 1.5 98.07
3c75_A132 Amicyanin; copper proteins, electron transfer comp 98.05
1iuz_A98 Plastocyanin; electron transport; 1.60A {Ulva pert 98.01
1iby_A112 Nitrosocyanin; RED copper, cupredoxin, beta hairpi 98.0
1cuo_A129 Protein (azurin ISO-2); beta barrel, periplasmic, 97.98
1kdj_A102 Plastocyanin; electron transfer, photosystem, PAI- 97.93
3ay2_A167 Lipid modified azurin protein; beta sandwich, bact 97.92
4hci_A100 Cupredoxin 1; structural genomics, niaid, national 97.87
2ccw_A129 Azurin II, AZN-2; electron transport (cuproprotein 97.77
1id2_A106 Amicyanin; beta barrel, type-1 blue copper protein 97.76
1plc_A99 Plastocyanin; electron transport; 1.33A {Populus n 97.68
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 97.68
2ux6_A122 Pseudoazurin; type-1 copper, metal-binding, redox 97.66
2iaa_C128 Azurin; quinoprotein, tryptophan tryptophylquinone 97.63
1nwp_A128 Azurin; electron transport, cupredoxin, electron t 97.61
2cal_A154 Rusticyanin; iron respiratory electron transport c 97.59
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 97.44
2ov0_A105 Amicyanin; beta-sandwich, electron transport; 0.75 97.12
3ef4_A124 Pseudoazurin, blue copper protein; electron transf 96.74
3fsa_A125 Azurin; copper, cupredoxin fold, metal-binding, pr 96.69
3erx_A123 Pseudoazurin; copper protein, high-resolution, E t 96.66
3tu6_A127 Pseudoazurin (blue copper protein); cupredoxins, b 96.66
1iuz_A98 Plastocyanin; electron transport; 1.60A {Ulva pert 96.55
1paz_A123 Pseudoazurin precursor; electron transfer(cupropro 95.65
2cua_A135 Protein (CUA); CUA center, electron transport; 1.6 95.44
1id2_A106 Amicyanin; beta barrel, type-1 blue copper protein 95.38
3c75_A132 Amicyanin; copper proteins, electron transfer comp 95.13
3s8f_B168 Cytochrome C oxidase subunit 2; complex IV, respir 95.06
1pmy_A123 Pseudoazurin; electron transfer(cuproprotein); 1.5 94.99
3ay2_A167 Lipid modified azurin protein; beta sandwich, bact 94.35
1cuo_A129 Protein (azurin ISO-2); beta barrel, periplasmic, 93.89
2ux6_A122 Pseudoazurin; type-1 copper, metal-binding, redox 93.32
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 93.13
2cua_A135 Protein (CUA); CUA center, electron transport; 1.6 92.72
3fsa_A125 Azurin; copper, cupredoxin fold, metal-binding, pr 91.36
2ccw_A129 Azurin II, AZN-2; electron transport (cuproprotein 91.3
2iaa_C128 Azurin; quinoprotein, tryptophan tryptophylquinone 90.79
1nwp_A128 Azurin; electron transport, cupredoxin, electron t 87.75
3s8f_B168 Cytochrome C oxidase subunit 2; complex IV, respir 84.93
>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Back     alignment and structure
Probab=100.00  E-value=2.1e-96  Score=823.49  Aligned_cols=501  Identities=24%  Similarity=0.396  Sum_probs=382.1

Q ss_pred             CceEEEEEEEeEeeecccccccCCCCCccccccceeecCCCeEEeEEEECCCCCCCeEEEecCCEEEEEEEECCCCCcee
Q psy4302          19 PMVCYYHFTLENYATIGPACGNCINGTMDDCFKKGCVTADGVERPILTINRRLPSPSIQVCRGDTIVVDVKNKIVDRVVT   98 (613)
Q Consensus        19 ~~~c~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dG~~~~~~~iNg~~PGP~i~v~~Gd~v~v~v~N~l~~~~~t   98 (613)
                      +++++|+|+|++.                      .+.+||.++.+|+|||++|||+|+|++||+|+|+|+|+|+.++++
T Consensus         1 ~~~~~y~~~v~~~----------------------~~~~dg~~~~~~~~Ng~~PGP~I~~~~GD~v~v~v~N~l~~~~ts   58 (552)
T 1aoz_A            1 SQIRHYKWEVEYM----------------------FWAPNCNENIVMGINGQFPGPTIRANAGDSVVVELTNKLHTEGVV   58 (552)
T ss_dssp             CCEEEEEEEEEEE----------------------EECTTSSCEEEEEETTBSSCCCEEEETTCEEEEEEEECCSSCCBC
T ss_pred             CeEEEEEEEEEEE----------------------EEcCCCceEEEEEECCccCCCcEEEeCCCEEEEEEEeCCCCCCee
Confidence            4789999999974                      368999999999999999999999999999999999999767999


Q ss_pred             EEeCCCcccCCCCCCCCCccccccCCCCCeEEEEEeecCCCceEEeecCcccccCCceeeEEEeCCCCCCCCCCCCCCCC
Q psy4302          99 IHWHGVYQRHTPHSDGVPLLTQCPIIPETTYRYKFPAMPYGTFFYHSHIGFQKMDGLEGPLVIRRPKKADPNRDQYDTDY  178 (613)
Q Consensus        99 iHwHGl~~~~~~~~DGv~~vtq~pI~pG~~~~Y~f~~~~~GT~wyH~H~~~q~~~Gl~G~liV~~~~~~~p~~~~~d~d~  178 (613)
                      |||||+++.+++||||+|++|||+|+||++|+|+|+++++||||||||.+.|+++||+|+|||++++..   ..+|++| 
T Consensus        59 iHwHGl~~~~~~~~DGv~~vtq~~I~PG~s~tY~f~~~~~GT~wYHsH~~~q~~~Gl~G~liV~~~~~~---~~~~~~d-  134 (552)
T 1aoz_A           59 IHWHGILQRGTPWADGTASISQCAINPGETFFYNFTVDNPGTFFYHGHLGMQRSAGLYGSLIVDPPQGK---KEPFHYD-  134 (552)
T ss_dssp             EEEETCCCTTCGGGSCCBTTTBCCBCTTCEEEEEEECCSCEEEEEEECSTTTGGGTCEEEEEEECCTTC---CCSSCCS-
T ss_pred             EEeCCCccCCCcccCCCcccccCCcCCCCeEEEEEECCCCEEEEEEECchhHHhccCeeeEEEeCCccc---CCCCCCC-
Confidence            999999999999999999999999999999999999999999999999999999999999999987432   2245666 


Q ss_pred             CceEEEEeeeccCCCCcccCCCCCC--CCCCCCcceeecCcccccCCCC----------C---CCCCccceEEEeCCcEE
Q psy4302         179 PSHTIIITDWLHGMTDAKFPGNTYA--NFGTRTESFLINGRSVFKSGNG----------T---SNPVPYSKFKVNKGLRH  243 (613)
Q Consensus       179 ~e~~l~l~d~~~~~~~~~~~~~~~~--~~~~~~~~~lING~~~~~~~~~----------~---~~~~~~~~~~v~~G~~~  243 (613)
                      .|++|+|+||+++.....+......  .....++++||||++.++|...          .   ....+++.++|++|++|
T Consensus       135 ~e~~l~l~Dw~~~~~~~~~~~~~~~~~~~~~~~~~~liNG~~~~~c~~~~~~~~~~~~c~~~~~~~~~~~~~~v~~G~~~  214 (552)
T 1aoz_A          135 GEINLLLSDWWHQSIHKQEVGLSSKPIRWIGEPQTILLNGRGQFDCSIAAKYDSNLEPCKLKGSESCAPYIFHVSPKKTY  214 (552)
T ss_dssp             EEEEEEEEEECSSCHHHHHHHTTSSSCCCCCSCSEEEETTBCCSSSBTTGGGCTTSCBCCCCSCSTTSCCCEEECTTCEE
T ss_pred             ccceEEeecccCCCHHHHHhhhhcccccCCCCCCeEEECCccccCcccCcccccccccccccCCCCCCceEEEEcCCCEE
Confidence            4899999999998654432111110  1113578999999998644211          0   11223458999999999


Q ss_pred             EEEEEecCCCCCcEEEEEeceeeEEEEeCCcccceeeeeEEEEccceeeeecccEEEEc-cCCccC----------cCCC
Q psy4302         244 RFRIIGGSCLACPMLFFVEKHRMNLITVDGTPVQPQMFDSITIFPGQYTPVNSAIVLNI-NLDAAH----------MGSR  312 (613)
Q Consensus       244 rlRliN~~~~~~~~~~~i~gh~~~via~DG~~v~P~~~d~l~l~pgeR~~~~~dv~v~a-~~~~~~----------~~~~  312 (613)
                      ||||||++.. +.+.|+|+||+|+||++||.+++|+.+++|.|+|||||    ||+|++ +++++.          ....
T Consensus       215 RlRliNa~~~-~~~~~~i~gh~~~vi~~DG~~~~P~~~~~l~i~pgqR~----dvlv~~~~~~~g~y~i~~~~~~~~~~~  289 (552)
T 1aoz_A          215 RIRIASTTAL-AALNFAIGNHQLLVVEADGNYVQPFYTSDIDIYSGESY----SVLITTDQNPSENYWVSVGTRARHPNT  289 (552)
T ss_dssp             EEEEEECCSS-CEEEEEETTCCEEEEEETTEEEEEEEESCEEECTTCEE----EEEEECCSCTTCCEEEEEEEESSCCCS
T ss_pred             EEEEEccccc-ceEEEEEcCcEEEEEEECCcccCceEEeEEEEcCCcEE----EEEEEcCCCCCCCEEEEEEcccCCCCC
Confidence            9999999987 48999999999999999999999999999999999999    999999 454442          1234


Q ss_pred             CceeEEEEecccCC--CCCCCCCCCCC-CC---cccccCcCCCCCCccccccCCCCceEEEEEEeeeeeccCccccCCcc
Q psy4302         313 RDRLNILRLRKSLN--ALDSSDCSDTN-PN---VCWNHVNSLTPATEKATVLKAVPDIRLVFAVDEYHFTRDSLFWNDED  386 (613)
Q Consensus       313 ~~~~ail~Y~~~~~--~~~~~~~~~~~-~~---~~~~~l~~~~~~~~~~~~~~~~pd~~~~l~~~~~~~~~~~~~~~~~~  386 (613)
                      ....|||+|.+...  .+....+..+. ..   .|...++.+......  .....+++++.+.+.....           
T Consensus       290 ~~~~ail~y~~~~~~~~p~~~~p~~p~~~~~~~~~~~~l~~l~~~~~~--~~~~~~~~~~~l~~~~~~~-----------  356 (552)
T 1aoz_A          290 PPGLTLLNYLPNSVSKLPTSPPPQTPAWDDFDRSKNFTYRITAAMGSP--KPPVKFNRRIFLLNTQNVI-----------  356 (552)
T ss_dssp             CCEEEEEEETTSCTTSCCSSCCCCCCCTTCHHHHHHHHTTCCBCTTCC--CCCSSCSEEEEEEEEEEEE-----------
T ss_pred             ccEEEEEEECCCCCCCCCCCCCCCCCccccccccccccccccccCCCC--CCCCCCcEEEEEEEeeccC-----------
Confidence            56789999997432  11111011110 00   011112222110010  1223467777666543211           


Q ss_pred             cceeeeecCCCceeeEEecceeccCCCCCcccccCCCCCCCC-----------CCCCC--CccCCccccCCccceeeEEE
Q psy4302         387 EYHRWFQSSPNVIKTHVTNNISLGILPFPILSQDLPIPKEME-----------CPKDR--SVCGKSAEKGGKLCECVEII  453 (613)
Q Consensus       387 ~~~~~~~~~~~~~~~~~iN~~s~~~p~~P~l~~~~~~~~~~~-----------~~~~~--~~~~~~~~~~~~~~~~~~~~  453 (613)
                                .+...|.|||++|..|..|+|.+...-..+.|           |.+..  ..|       ...|.|+.++
T Consensus       357 ----------~~~~~w~iNg~s~~~p~~P~L~~~~~~~~g~~~~~~p~~~~~~~~~~~~~~~~-------~~~~~~t~~~  419 (552)
T 1aoz_A          357 ----------NGYVKWAINDVSLALPPTPYLGAMKYNLLHAFDQNPPPEVFPEDYDIDTPPTN-------EKTRIGNGVY  419 (552)
T ss_dssp             ----------TTEEEEEETTEEECCCSSCHHHHHHTTCTTSSCCSCCCSCCCTTCCTTSCCCC-------TTCEEECCCE
T ss_pred             ----------CCeEEEEECCCccCCCCCCHHHHHhhcCccccccCCCcccccccccccccccc-------ccccccceEE
Confidence                      12457999999999999998866431111111           11100  111       3567889999


Q ss_pred             EecCCCEEEEEEEeCCCCCC---CCCCCeeeecCcEEEEEeccCCCcccccccccchHHhhhccCCCCCCCCCCCCCccc
Q psy4302         454 KVGLNQVAEIIFIDWIGPTS---TFLHPMHLHGTDIYIIEQGIIPVAEDHRAFVGKLQERLAREGPDLATKIRPQPCVKD  530 (613)
Q Consensus       454 ~v~~g~~ve~vl~N~~~~~~---~~~HPfHLHG~~F~Vl~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~n~~~p~~kD  530 (613)
                      .++.|++|||+|+|. +.+.   ...||||||||+|+||++|. +.++       . .        +...+|+.+|+|||
T Consensus       420 ~~~~g~~v~ivi~N~-~~~~~~~~~~HP~HLHGh~F~Vl~~g~-G~~~-------~-~--------~~~~~n~~~p~~RD  481 (552)
T 1aoz_A          420 QFKIGEVVDVILQNA-NMMKENLSETHPWHLHGHDFWVLGYGD-GKFS-------A-E--------EESSLNLKNPPLRN  481 (552)
T ss_dssp             EECTTCEEEEEEEEC-CCSSTTCCCCEEEEETTCCEEEEEEEE-SSCC-------G-G--------GGGGSCCSSCCEES
T ss_pred             EecCCCEEEEEEeCC-cccccccCCCCCEEEcCCceEEEeccc-CccC-------c-c--------cccccccCCCCccC
Confidence            999999999999998 5432   46799999999999999975 4433       1 0        12246889999999


Q ss_pred             eEEcCCCcEEEEEEEecCcceeEEeechhhhhhcCceEEEEeccCCCCCCCCCCCCCCCCCCCCCCCCC
Q psy4302         531 TVTIPPNGYTVVRVHFNNPGIWIMHCHFIFHTETGMNTVFQVGDRKDFVQTPPEFPTCNNYLPPVDPNE  599 (613)
Q Consensus       531 Tv~Vp~~g~~vIrf~adNPG~Wl~HCHi~~H~~~GM~~~~~V~~~~~~~~~p~~~p~C~~~~~~~~~~~  599 (613)
                      ||.||++||++|||+|||||.|+|||||+||++.|||++|.|+.. +++++|+++++||+|++.+..+.
T Consensus       482 Tv~vpp~g~v~Irf~aDNPG~W~~HCHi~~H~~~GM~~~~~~~~~-~~~~~P~~~~~C~~~~~~~~~~~  549 (552)
T 1aoz_A          482 TVVIFPYGWTAIRFVADNPGVWAFHCHIEPHLHMGMGVVFAEGVE-KVGRIPTKALACGGTAKSLINNP  549 (552)
T ss_dssp             EEEECTTEEEEEEEECCSCEEEEEEESSHHHHHTTCEEEEEECGG-GCCCCCHHHHSSHHHHHHHSCCC
T ss_pred             eEEeCCCceEEEEEEcCCCeEEEEEeeehhHhhCCCeEEEEeCch-hhccCCcchhhhhccCcccccCC
Confidence            999999999999999999999999999999999999999999754 89999999999999987766553
>3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} Back     alignment and structure
>3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* Back     alignment and structure
>3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* Back     alignment and structure
>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 Back     alignment and structure
>1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* Back     alignment and structure
>2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* Back     alignment and structure
>2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A Back     alignment and structure
>3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* Back     alignment and structure
>2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A Back     alignment and structure
>2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A Back     alignment and structure
>3gyr_A PHS, phenoxazinone synthase; metalloprotein, laccase, multicopper oxidase, hexamer, oxidoreductase, antibiotic biosynthesis; 2.30A {Streptomyces antibioticus} Back     alignment and structure
>3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} Back     alignment and structure
>3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} Back     alignment and structure
>3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... Back     alignment and structure
>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Back     alignment and structure
>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Back     alignment and structure
>3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} PDB: 4gxf_A* 4gy4_A* Back     alignment and structure
>3t9w_A Small laccase, multi-copper oxidase; two-domain copper oxidase, Cu-binding, oxidoreducta; 1.50A {Amycolatopsis SP} Back     alignment and structure
>3tas_A Small laccase, multi-copper oxidase; two-domain laccase, oxidoreductase, secreted; HET: PG4; 2.30A {Streptomyces viridosporus} PDB: 3tbb_A 3tbc_A* Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Back     alignment and structure
>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Back     alignment and structure
>3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} Back     alignment and structure
>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Back     alignment and structure
>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Back     alignment and structure
>2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... Back     alignment and structure
>1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Back     alignment and structure
>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Back     alignment and structure
>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Back     alignment and structure
>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Back     alignment and structure
>1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Back     alignment and structure
>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Back     alignment and structure
>2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Back     alignment and structure
>2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A Back     alignment and structure
>2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A Back     alignment and structure
>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Back     alignment and structure
>3cvb_A Plastocyanin; cupredoxin, SELF assembly, copper, electron transport, metal-binding, transport; 1.40A {Phormidium laminosum} PDB: 3cvc_A 3cvd_A 2w8c_A 2w88_A 2q5b_A 1baw_A 3bqv_A Back     alignment and structure
>3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} PDB: 4gxf_A* 4gy4_A* Back     alignment and structure
>1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* Back     alignment and structure
>1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 Back     alignment and structure
>3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} Back     alignment and structure
>2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A Back     alignment and structure
>3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* Back     alignment and structure
>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* Back     alignment and structure
>3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} Back     alignment and structure
>3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... Back     alignment and structure
>2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* Back     alignment and structure
>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Back     alignment and structure
>3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} Back     alignment and structure
>1iby_A Nitrosocyanin; RED copper, cupredoxin, beta hairpin, metal binding protein; 1.65A {Nitrosomonas europaea} SCOP: b.6.1.4 PDB: 1ibz_A 1ic0_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A Back     alignment and structure
>3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* Back     alignment and structure
>3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} Back     alignment and structure
>2ov0_A Amicyanin; beta-sandwich, electron transport; 0.75A {Paracoccus denitrificans} SCOP: b.6.1.1 PDB: 1aaj_A 1aan_A 1aac_A 1mg2_C* 1mg3_C* 1t5k_A 2gc4_C* 2gc7_C* 2j55_A* 2j56_A* 2j57_A* 2mta_A* 1bxa_A 2rac_A 3l45_A 3ie9_A 3iea_A 2idq_A 2ids_A 1sf3_A ... Back     alignment and structure
>2aan_A Auracyanin A; cupredoxin fold, electron transport; 1.85A {Chloroflexus aurantiacus} Back     alignment and structure
>3cvb_A Plastocyanin; cupredoxin, SELF assembly, copper, electron transport, metal-binding, transport; 1.40A {Phormidium laminosum} PDB: 3cvc_A 3cvd_A 2w8c_A 2w88_A 2q5b_A 1baw_A 3bqv_A Back     alignment and structure
>3tas_A Small laccase, multi-copper oxidase; two-domain laccase, oxidoreductase, secreted; HET: PG4; 2.30A {Streptomyces viridosporus} PDB: 3tbb_A 3tbc_A* Back     alignment and structure
>3t9w_A Small laccase, multi-copper oxidase; two-domain copper oxidase, Cu-binding, oxidoreducta; 1.50A {Amycolatopsis SP} Back     alignment and structure
>2gim_A Plastocyanin; beta sheet, Cu, helix, electron transport; 1.60A {Anabaena variabilis} SCOP: b.6.1.1 PDB: 1fa4_A 1nin_A 1tu2_A* 2cj3_A Back     alignment and structure
>3gyr_A PHS, phenoxazinone synthase; metalloprotein, laccase, multicopper oxidase, hexamer, oxidoreductase, antibiotic biosynthesis; 2.30A {Streptomyces antibioticus} Back     alignment and structure
>2aan_A Auracyanin A; cupredoxin fold, electron transport; 1.85A {Chloroflexus aurantiacus} Back     alignment and structure
>4hci_A Cupredoxin 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.63A {Bacillus anthracis} PDB: 4hcg_A 4hcf_A Back     alignment and structure
>2gim_A Plastocyanin; beta sheet, Cu, helix, electron transport; 1.60A {Anabaena variabilis} SCOP: b.6.1.1 PDB: 1fa4_A 1nin_A 1tu2_A* 2cj3_A Back     alignment and structure
>2plt_A Plastocyanin; electron transport; 1.50A {Chlamydomonas reinhardtii} SCOP: b.6.1.1 Back     alignment and structure
>1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A Back     alignment and structure
>1pcs_A Plastocyanin; electron transport; 2.15A {Synechocystis SP} SCOP: b.6.1.1 PDB: 1m9w_A 1j5c_A 1j5d_A 1jxd_A 1jxf_A Back     alignment and structure
>1bxv_A Plastocyanin; copper protein, electron transfer; 1.80A {Synechococcus elongatus} SCOP: b.6.1.1 PDB: 1bxu_A Back     alignment and structure
>1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A Back     alignment and structure
>3erx_A Pseudoazurin; copper protein, high-resolution, E transport, metal-binding, transport; 1.25A {Paracoccus pantotrophus} SCOP: b.6.1.1 PDB: 1adw_A Back     alignment and structure
>1b3i_A PETE protein, protein (plastocyanin); electron transport, type I copper protein, photosynthesis; NMR {Prochlorothrix hollandica} SCOP: b.6.1.1 PDB: 2b3i_A 2jxm_A* Back     alignment and structure
>1kdj_A Plastocyanin; electron transfer, photosystem, PAI-PAI stacking; 1.70A {Adiantum capillus-veneris} SCOP: b.6.1.1 PDB: 1kdi_A 2bz7_A 2bzc_A Back     alignment and structure
>3tu6_A Pseudoazurin (blue copper protein); cupredoxins, beta barrel, electron transfer, redox, electron transport; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>1byp_A Protein (plastocyanin); electron transfer, photosynthesis, acidic patch, double mutant, electron transport; 1.75A {Silene latifolia subsp} SCOP: b.6.1.1 PDB: 1pla_A 1plb_A Back     alignment and structure
>1pcs_A Plastocyanin; electron transport; 2.15A {Synechocystis SP} SCOP: b.6.1.1 PDB: 1m9w_A 1j5c_A 1j5d_A 1jxd_A 1jxf_A Back     alignment and structure
>1plc_A Plastocyanin; electron transport; 1.33A {Populus nigra} SCOP: b.6.1.1 PDB: 1pnc_A 1pnd_A 1tkw_A* 2pcy_A 3pcy_A 4pcy_A 5pcy_A 6pcy_A 1jxg_A 1ag6_A 1ylb_B 2pcf_A* 1oow_A 1tef_A 9pcy_A 1teg_A 1byo_A Back     alignment and structure
>3ef4_A Pseudoazurin, blue copper protein; electron transfer, electron transport; HET: PO4; 1.18A {Hyphomicrobium denitrificans} SCOP: b.6.1.0 Back     alignment and structure
>2plt_A Plastocyanin; electron transport; 1.50A {Chlamydomonas reinhardtii} SCOP: b.6.1.1 Back     alignment and structure
>1bxv_A Plastocyanin; copper protein, electron transfer; 1.80A {Synechococcus elongatus} SCOP: b.6.1.1 PDB: 1bxu_A Back     alignment and structure
>1b3i_A PETE protein, protein (plastocyanin); electron transport, type I copper protein, photosynthesis; NMR {Prochlorothrix hollandica} SCOP: b.6.1.1 PDB: 2b3i_A 2jxm_A* Back     alignment and structure
>1byp_A Protein (plastocyanin); electron transfer, photosynthesis, acidic patch, double mutant, electron transport; 1.75A {Silene latifolia subsp} SCOP: b.6.1.1 PDB: 1pla_A 1plb_A Back     alignment and structure
>1paz_A Pseudoazurin precursor; electron transfer(cuproprotein); 1.55A {Alcaligenes faecalis} SCOP: b.6.1.1 PDB: 1pza_A 1pzb_A 1pzc_A 2p80_D 3nyk_A 3paz_A 8paz_A 4paz_A 5paz_A 6paz_A 7paz_A 1py0_A* Back     alignment and structure
>1pmy_A Pseudoazurin; electron transfer(cuproprotein); 1.50A {Methylobacterium extorquens} SCOP: b.6.1.1 Back     alignment and structure
>3c75_A Amicyanin; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1iuz_A Plastocyanin; electron transport; 1.60A {Ulva pertusa} SCOP: b.6.1.1 PDB: 7pcy_A Back     alignment and structure
>1iby_A Nitrosocyanin; RED copper, cupredoxin, beta hairpin, metal binding protein; 1.65A {Nitrosomonas europaea} SCOP: b.6.1.4 PDB: 1ibz_A 1ic0_A Back     alignment and structure
>1cuo_A Protein (azurin ISO-2); beta barrel, periplasmic, electron transport; 1.60A {Methylomonas SP} SCOP: b.6.1.1 PDB: 1uat_A Back     alignment and structure
>1kdj_A Plastocyanin; electron transfer, photosystem, PAI-PAI stacking; 1.70A {Adiantum capillus-veneris} SCOP: b.6.1.1 PDB: 1kdi_A 2bz7_A 2bzc_A Back     alignment and structure
>3ay2_A Lipid modified azurin protein; beta sandwich, bacterial protein, anticancer, anti-HIV/AIDS, antiparasitic activity, antitumor protein; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>4hci_A Cupredoxin 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.63A {Bacillus anthracis} PDB: 4hcg_A 4hcf_A Back     alignment and structure
>2ccw_A Azurin II, AZN-2; electron transport (cuproprotein), alcaligenes xylosoxidans, electron transfer, cupredoxin, electron transport; 1.13A {Alcaligenes xylosoxydans} SCOP: b.6.1.1 PDB: 1dz0_A 1dyz_A 1aiz_A 1azb_A 1azc_A 1uri_A 2aza_A 1a4a_A 1a4b_A 1a4c_A Back     alignment and structure
>1id2_A Amicyanin; beta barrel, type-1 blue copper protein, electron transfer protein, electron transport; 2.15A {Paracoccus versutus} SCOP: b.6.1.1 Back     alignment and structure
>1plc_A Plastocyanin; electron transport; 1.33A {Populus nigra} SCOP: b.6.1.1 PDB: 1pnc_A 1pnd_A 1tkw_A* 2pcy_A 3pcy_A 4pcy_A 5pcy_A 6pcy_A 1jxg_A 1ag6_A 1ylb_B 2pcf_A* 1oow_A 1tef_A 9pcy_A 1teg_A 1byo_A Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>2ux6_A Pseudoazurin; type-1 copper, metal-binding, redox potential, copper, transport, cupredoxin, periplasmic, electron transport; 1.3A {Achromobacter cycloclastes} PDB: 2ux7_A 2uxf_A 2uxg_A 1bqk_A 1bqr_A 1zia_A 1zib_A 2jkw_A Back     alignment and structure
>2iaa_C Azurin; quinoprotein, tryptophan tryptophylquinone, cupredoxin, electron transfer, oxidoreductase/electron transport comple; HET: TRQ; 1.95A {Alcaligenes faecalis} PDB: 2h47_C* 2h3x_C* Back     alignment and structure
>1nwp_A Azurin; electron transport, cupredoxin, electron transfer; 1.60A {Pseudomonas putida} SCOP: b.6.1.1 PDB: 1nwo_A 1joi_A Back     alignment and structure
>2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2ov0_A Amicyanin; beta-sandwich, electron transport; 0.75A {Paracoccus denitrificans} SCOP: b.6.1.1 PDB: 1aaj_A 1aan_A 1aac_A 1mg2_C* 1mg3_C* 1t5k_A 2gc4_C* 2gc7_C* 2j55_A* 2j56_A* 2j57_A* 2mta_A* 1bxa_A 2rac_A 3l45_A 3ie9_A 3iea_A 2idq_A 2ids_A 1sf3_A ... Back     alignment and structure
>3ef4_A Pseudoazurin, blue copper protein; electron transfer, electron transport; HET: PO4; 1.18A {Hyphomicrobium denitrificans} SCOP: b.6.1.0 Back     alignment and structure
>3fsa_A Azurin; copper, cupredoxin fold, metal-binding, protein-protein interaction, metal binding protein; 0.98A {Pseudomonas aeruginosa} SCOP: b.6.1.1 PDB: 2xv2_A 2xv0_A 3fs9_A 2fta_A* 2hx7_A 2hx8_A 2hx9_A 2hxa_A 1cc3_A 2ft6_A 2ft7_A 2ft8_A 1azn_A 3n2j_A 2iwe_A 2ghz_A 2gi0_A 1jzg_A* 1azu_A* 1bex_A ... Back     alignment and structure
>3erx_A Pseudoazurin; copper protein, high-resolution, E transport, metal-binding, transport; 1.25A {Paracoccus pantotrophus} SCOP: b.6.1.1 PDB: 1adw_A Back     alignment and structure
>3tu6_A Pseudoazurin (blue copper protein); cupredoxins, beta barrel, electron transfer, redox, electron transport; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>1iuz_A Plastocyanin; electron transport; 1.60A {Ulva pertusa} SCOP: b.6.1.1 PDB: 7pcy_A Back     alignment and structure
>1paz_A Pseudoazurin precursor; electron transfer(cuproprotein); 1.55A {Alcaligenes faecalis} SCOP: b.6.1.1 PDB: 1pza_A 1pzb_A 1pzc_A 2p80_D 3nyk_A 3paz_A 8paz_A 4paz_A 5paz_A 6paz_A 7paz_A 1py0_A* Back     alignment and structure
>2cua_A Protein (CUA); CUA center, electron transport; 1.60A {Thermus thermophilus} SCOP: b.6.1.2 PDB: 2fwl_B* Back     alignment and structure
>1id2_A Amicyanin; beta barrel, type-1 blue copper protein, electron transfer protein, electron transport; 2.15A {Paracoccus versutus} SCOP: b.6.1.1 Back     alignment and structure
>3c75_A Amicyanin; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3s8f_B Cytochrome C oxidase subunit 2; complex IV, respiratory chain, lipid cubic phase, monoolein, peroxide, electron transport, proton pump; HET: HEM HAS OLC; 1.80A {Thermus thermophilus} PDB: 1ehk_B* 2qpd_B* 3qjq_B* 3qjr_B* 3qju_B* 3qjv_B* 1xme_B* 3s8g_B* 4esl_B* 4ev3_B* 4f05_B* 4fa7_B* 4faa_B* 3qjs_B* 3bvd_B* 2qpe_B* 3qjt_B* 3s3b_B* 3s33_B* 3s39_B* ... Back     alignment and structure
>1pmy_A Pseudoazurin; electron transfer(cuproprotein); 1.50A {Methylobacterium extorquens} SCOP: b.6.1.1 Back     alignment and structure
>3ay2_A Lipid modified azurin protein; beta sandwich, bacterial protein, anticancer, anti-HIV/AIDS, antiparasitic activity, antitumor protein; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1cuo_A Protein (azurin ISO-2); beta barrel, periplasmic, electron transport; 1.60A {Methylomonas SP} SCOP: b.6.1.1 PDB: 1uat_A Back     alignment and structure
>2ux6_A Pseudoazurin; type-1 copper, metal-binding, redox potential, copper, transport, cupredoxin, periplasmic, electron transport; 1.3A {Achromobacter cycloclastes} PDB: 2ux7_A 2uxf_A 2uxg_A 1bqk_A 1bqr_A 1zia_A 1zib_A 2jkw_A Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>2cua_A Protein (CUA); CUA center, electron transport; 1.60A {Thermus thermophilus} SCOP: b.6.1.2 PDB: 2fwl_B* Back     alignment and structure
>3fsa_A Azurin; copper, cupredoxin fold, metal-binding, protein-protein interaction, metal binding protein; 0.98A {Pseudomonas aeruginosa} SCOP: b.6.1.1 PDB: 2xv2_A 2xv0_A 3fs9_A 2fta_A* 2hx7_A 2hx8_A 2hx9_A 2hxa_A 1cc3_A 2ft6_A 2ft7_A 2ft8_A 1azn_A 3n2j_A 2iwe_A 2ghz_A 2gi0_A 1jzg_A* 1azu_A* 1bex_A ... Back     alignment and structure
>2ccw_A Azurin II, AZN-2; electron transport (cuproprotein), alcaligenes xylosoxidans, electron transfer, cupredoxin, electron transport; 1.13A {Alcaligenes xylosoxydans} SCOP: b.6.1.1 PDB: 1dz0_A 1dyz_A 1aiz_A 1azb_A 1azc_A 1uri_A 2aza_A 1a4a_A 1a4b_A 1a4c_A Back     alignment and structure
>2iaa_C Azurin; quinoprotein, tryptophan tryptophylquinone, cupredoxin, electron transfer, oxidoreductase/electron transport comple; HET: TRQ; 1.95A {Alcaligenes faecalis} PDB: 2h47_C* 2h3x_C* Back     alignment and structure
>1nwp_A Azurin; electron transport, cupredoxin, electron transfer; 1.60A {Pseudomonas putida} SCOP: b.6.1.1 PDB: 1nwo_A 1joi_A Back     alignment and structure
>3s8f_B Cytochrome C oxidase subunit 2; complex IV, respiratory chain, lipid cubic phase, monoolein, peroxide, electron transport, proton pump; HET: HEM HAS OLC; 1.80A {Thermus thermophilus} PDB: 1ehk_B* 2qpd_B* 3qjq_B* 3qjr_B* 3qju_B* 3qjv_B* 1xme_B* 3s8g_B* 4esl_B* 4ev3_B* 4f05_B* 4fa7_B* 4faa_B* 3qjs_B* 3bvd_B* 2qpe_B* 3qjt_B* 3s3b_B* 3s33_B* 3s39_B* ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 613
d1gyca1130 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, la 4e-32
d1hfua1131 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprin 4e-31
d1v10a1136 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [T 7e-31
d1aoza1129 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cuc 2e-29
d2q9oa1162 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces 7e-23
d1aoza3214 b.6.1.3 (A:339-552) Ascorbate oxidase {Zucchini (C 1e-21
d1oe2a1159 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcalige 2e-20
d1kbva1151 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisser 5e-20
d1sdda1180 b.6.1.3 (A:1-180) Coagulation factor V {Cow (Bos t 5e-20
d2q9oa3216 b.6.1.3 (A:344-559) Laccase {Melanocarpus albomyce 8e-20
d1gska3154 b.6.1.3 (A:357-510) Spore coat protein A, CotA {Ba 1e-19
d1gyca2170 b.6.1.3 (A:131-300) Laccase {Trametes versicolor, 7e-19
d2j5wa1192 b.6.1.3 (A:1-192) Ceruloplasmin {Human (Homo sapie 1e-18
d2j5wa3207 b.6.1.3 (A:347-553) Ceruloplasmin {Human (Homo sap 1e-18
d1v10a2168 b.6.1.3 (A:137-304) Laccase {Rigidoporus lignosus 6e-18
d1hfua2172 b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Copr 1e-17
d1gska1181 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Baci 3e-17
d2bw4a1157 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcalige 5e-17
d1kv7a1140 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Esch 6e-17
d2q9oa2181 b.6.1.3 (A:163-343) Laccase {Melanocarpus albomyce 6e-17
d2j5wa4179 b.6.1.3 (A:706-884) Ceruloplasmin {Human (Homo sap 8e-17
d1hfua3200 b.6.1.3 (A:304-503) Laccase {Inky cap fungus (Copr 1e-16
d1mzya1153 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodoba 2e-16
d1e30a_153 b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidan 3e-16
d1gyca3199 b.6.1.3 (A:301-499) Laccase {Trametes versicolor, 3e-15
d1aoza2209 b.6.1.3 (A:130-338) Ascorbate oxidase {Zucchini (C 3e-14
d1kv7a3181 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Esc 1e-12
d1sddb2139 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (B 3e-12
d1sddb2139 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (B 5e-10
d2j5wa5149 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sa 5e-12
d2j5wa5149 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sa 3e-10
d1v10a3190 b.6.1.3 (A:305-494) Laccase {Rigidoporus lignosus 3e-11
d2j5wa2145 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sap 1e-10
d2j5wa2145 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sap 7e-09
d1kv7a2165 b.6.1.3 (A:171-335) multi-copper oxidase CueO {Esc 1e-10
d1sdda2116 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos 2e-10
d1sdda2116 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos 6e-06
d1kcwa2146 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sap 1e-09
d1kcwa2146 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sap 6e-09
d1sddb167 b.6.1.3 (B:1657-1723) Coagulation factor V {Cow (B 1e-07
d1gska2174 b.6.1.3 (A:183-356) Spore coat protein A, CotA {Ba 9e-07
d1qhqa_139 b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus 3e-05
d2bw4a2173 b.6.1.3 (A:166-338) Nitrite reductase, NIR {Alcali 4e-05
d1kbva2151 b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisse 1e-04
d1kbva2151 b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisse 8e-04
d1oe1a2177 b.6.1.3 (A:160-336) Nitrite reductase, NIR {Alcali 6e-04
d1ibya_112 b.6.1.4 (A:) Red copper protein nitrosocyanin {Nit 0.004
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Length = 130 Back     information, alignment and structure

class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Multidomain cupredoxins
domain: Laccase
species: Trametes versicolor, laccase 2 [TaxId: 5325]

 Score =  118 bits (297), Expect = 4e-32
 Identities = 43/116 (37%), Positives = 61/116 (52%), Gaps = 5/116 (4%)

Query: 55  VTADGVERPILTINRRLPSPSIQVCRGDTIVVDVKNKIVDRV----VTIHWHGVYQRHTP 110
           V+ DG  R  + +N   PSP I   +GD   ++V + + +       +IHWHG +Q  T 
Sbjct: 15  VSPDGFLRDAIVVNGVFPSPLITGKKGDRFQLNVVDTLTNHTMLKSTSIHWHGFFQAGTN 74

Query: 111 HSDGVPLLTQCPIIPETTYRYKFPAM-PYGTFFYHSHIGFQKMDGLEGPLVIRRPK 165
            +DG   + QCPI    ++ Y F      GTF+YHSH+  Q  DGL GP V+  PK
Sbjct: 75  WADGPAFVNQCPIASGHSFLYDFHVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPK 130
>d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Length = 131 Back     information, alignment and structure
>d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [TaxId: 219653]} Length = 136 Back     information, alignment and structure
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Length = 129 Back     information, alignment and structure
>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Length = 162 Back     information, alignment and structure
>d1aoza3 b.6.1.3 (A:339-552) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Length = 214 Back     information, alignment and structure
>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Length = 159 Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Length = 151 Back     information, alignment and structure
>d1sdda1 b.6.1.3 (A:1-180) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 180 Back     information, alignment and structure
>d2q9oa3 b.6.1.3 (A:344-559) Laccase {Melanocarpus albomyces [TaxId: 204285]} Length = 216 Back     information, alignment and structure
>d1gska3 b.6.1.3 (A:357-510) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Length = 154 Back     information, alignment and structure
>d1gyca2 b.6.1.3 (A:131-300) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Length = 170 Back     information, alignment and structure
>d2j5wa1 b.6.1.3 (A:1-192) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d2j5wa3 b.6.1.3 (A:347-553) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1v10a2 b.6.1.3 (A:137-304) Laccase {Rigidoporus lignosus [TaxId: 219653]} Length = 168 Back     information, alignment and structure
>d1hfua2 b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Length = 172 Back     information, alignment and structure
>d1gska1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Length = 181 Back     information, alignment and structure
>d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Length = 157 Back     information, alignment and structure
>d1kv7a1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Length = 140 Back     information, alignment and structure
>d2q9oa2 b.6.1.3 (A:163-343) Laccase {Melanocarpus albomyces [TaxId: 204285]} Length = 181 Back     information, alignment and structure
>d2j5wa4 b.6.1.3 (A:706-884) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 179 Back     information, alignment and structure
>d1hfua3 b.6.1.3 (A:304-503) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Length = 200 Back     information, alignment and structure
>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Length = 153 Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Length = 153 Back     information, alignment and structure
>d1gyca3 b.6.1.3 (A:301-499) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Length = 199 Back     information, alignment and structure
>d1aoza2 b.6.1.3 (A:130-338) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Length = 209 Back     information, alignment and structure
>d1kv7a3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Length = 181 Back     information, alignment and structure
>d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 139 Back     information, alignment and structure
>d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 139 Back     information, alignment and structure
>d2j5wa5 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d2j5wa5 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d1v10a3 b.6.1.3 (A:305-494) Laccase {Rigidoporus lignosus [TaxId: 219653]} Length = 190 Back     information, alignment and structure
>d2j5wa2 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 145 Back     information, alignment and structure
>d2j5wa2 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 145 Back     information, alignment and structure
>d1kv7a2 b.6.1.3 (A:171-335) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Length = 165 Back     information, alignment and structure
>d1sdda2 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 116 Back     information, alignment and structure
>d1sdda2 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 116 Back     information, alignment and structure
>d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 146 Back     information, alignment and structure
>d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 146 Back     information, alignment and structure
>d1sddb1 b.6.1.3 (B:1657-1723) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 67 Back     information, alignment and structure
>d1gska2 b.6.1.3 (A:183-356) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Length = 174 Back     information, alignment and structure
>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} Length = 139 Back     information, alignment and structure
>d2bw4a2 b.6.1.3 (A:166-338) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Length = 173 Back     information, alignment and structure
>d1kbva2 b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Length = 151 Back     information, alignment and structure
>d1kbva2 b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Length = 151 Back     information, alignment and structure
>d1oe1a2 b.6.1.3 (A:160-336) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Length = 177 Back     information, alignment and structure
>d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} Length = 112 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query613
d1aoza1129 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 100.0
d1aoza3214 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 100.0
d1v10a1136 Laccase {Rigidoporus lignosus [TaxId: 219653]} 100.0
d1hfua1131 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 100.0
d1gyca1130 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 100.0
d2q9oa1162 Laccase {Melanocarpus albomyces [TaxId: 204285]} 100.0
d1hfua3200 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 100.0
d1gyca3199 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 99.98
d1v10a3190 Laccase {Rigidoporus lignosus [TaxId: 219653]} 99.97
d2q9oa3216 Laccase {Melanocarpus albomyces [TaxId: 204285]} 99.97
d1kv7a1140 multi-copper oxidase CueO {Escherichia coli [TaxId 99.97
d1oe2a1159 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 99.96
d2bw4a1157 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 99.96
d1gska3154 Spore coat protein A, CotA {Bacillus subtilis [Tax 99.96
d1mzya1153 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 99.95
d1gska1181 Spore coat protein A, CotA {Bacillus subtilis [Tax 99.94
d1hfua2172 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 99.94
d1v10a2168 Laccase {Rigidoporus lignosus [TaxId: 219653]} 99.94
d1gyca2170 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 99.94
d1kbva1151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 99.94
d2q9oa2181 Laccase {Melanocarpus albomyces [TaxId: 204285]} 99.94
d1sdda1180 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 99.91
d1aoza2209 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 99.91
d1kv7a3181 multi-copper oxidase CueO {Escherichia coli [TaxId 99.91
d2j5wa3207 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.87
d2j5wa5149 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.84
d2j5wa1192 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.84
d2j5wa4179 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1sddb2139 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 99.82
d2j5wa2145 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.79
d1e30a_153 Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920 99.78
d1kv7a2165 multi-copper oxidase CueO {Escherichia coli [TaxId 99.78
d1kcwa2146 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.77
d1kbva2151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 99.76
d1gska2174 Spore coat protein A, CotA {Bacillus subtilis [Tax 99.75
d1sdda2116 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 99.75
d1sddb2139 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 99.68
d1kbva2151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 99.68
d2j5wa5149 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.68
d1kcwa2146 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.67
d2j5wa2145 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.67
d2bw4a2173 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 99.61
d1sdda2116 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 99.56
d1oe1a2177 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 99.51
d1fwxa1132 Nitrous oxide reductase, C-terminal domain {Paraco 99.5
d1ibya_112 Red copper protein nitrosocyanin {Nitrosomonas eur 99.44
d1e30a_153 Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920 99.43
d1sddb167 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 99.29
d1aoza1129 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 99.23
d2q9oa1162 Laccase {Melanocarpus albomyces [TaxId: 204285]} 99.22
d1kbva1151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 99.16
d2bw4a1157 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 99.09
d1mzya1153 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 99.04
d1qnia1131 Nitrous oxide reductase, C-terminal domain {Pseudo 99.01
d1oe2a1159 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 98.97
d2bw4a2173 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 98.9
d1qhqa_139 Auracyanin {Chloroflexus aurantiacus [TaxId: 1108] 98.89
d1hfua1131 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 98.79
d2j5wa1192 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 98.76
d1qhqa_139 Auracyanin {Chloroflexus aurantiacus [TaxId: 1108] 98.74
d1kv7a1140 multi-copper oxidase CueO {Escherichia coli [TaxId 98.73
d1gyca1130 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 98.66
d1ibya_112 Red copper protein nitrosocyanin {Nitrosomonas eur 98.65
d1kv7a3181 multi-copper oxidase CueO {Escherichia coli [TaxId 98.61
d1hfua3200 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 98.52
d1oe1a2177 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 98.51
d1v10a1136 Laccase {Rigidoporus lignosus [TaxId: 219653]} 98.46
d1v10a3190 Laccase {Rigidoporus lignosus [TaxId: 219653]} 98.45
d1gska3154 Spore coat protein A, CotA {Bacillus subtilis [Tax 98.43
d1gyca3199 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 98.34
d2plta_98 Plastocyanin {Green alga (Chlamydomonas reinhardti 98.28
d1aoza3214 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 98.26
d1sdda1180 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 98.24
d1kdja_102 Plastocyanin {Fern (Adiantum capillus-veneris) [Ta 98.03
d2q9oa3216 Laccase {Melanocarpus albomyces [TaxId: 204285]} 98.03
d1fwxa1132 Nitrous oxide reductase, C-terminal domain {Paraco 98.03
d1pcsa_98 Plastocyanin {Cyanobacterium (Synechocystis sp.), 98.02
d2j5wa3207 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 98.0
d1bypa_99 Plastocyanin {White campion (Silene pratensis) [Ta 97.94
d2q5ba1105 Plastocyanin {Cyanobacterium (Phormidium laminosum 97.9
d2ov0a1105 Amicyanin {Paracoccus denitrificans [TaxId: 266]} 97.9
d1plca_99 Plastocyanin {Poplar (Populus nigra), variant ital 97.88
d1bxua_91 Plastocyanin {Cyanobacterium (Synechocystis sp.), 97.86
d2jxma197 Plastocyanin {Photosynthetic prokaryote (Prochloro 97.75
d1v10a2168 Laccase {Rigidoporus lignosus [TaxId: 219653]} 97.74
d2q9oa2181 Laccase {Melanocarpus albomyces [TaxId: 204285]} 97.71
d1iuza_98 Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 97.69
d1hfua2172 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 97.68
d1qnia1131 Nitrous oxide reductase, C-terminal domain {Pseudo 97.65
d1pmya_123 Pseudoazurin {Methylobacterium extorquens, strain 97.6
d1gyca2170 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 97.53
d2j5wa4179 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 97.52
d1aoza2209 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 97.52
d1paza_120 Pseudoazurin {Alcaligenes faecalis, strain s-6 [Ta 97.5
d1adwa_123 Pseudoazurin {Thiosphaera pantotropha [TaxId: 8236 97.5
d1gska1181 Spore coat protein A, CotA {Bacillus subtilis [Tax 97.49
d1mzya2178 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 97.39
d2ccwa1129 Azurin {Alcaligenes xylosoxidans, NCIMB (11015), d 97.39
d2cj3a1105 Plastocyanin {Anabaena variabilis [TaxId: 1172]} 97.37
d1bqka_124 Pseudoazurin {Achromobacter cycloclastes [TaxId: 2 97.33
d2cuaa_122 Cytochrome c oxidase {Thermus thermophilus, ba3 ty 97.28
d1cuoa_129 Azurin {Methylomonas sp. j [TaxId: 32038]} 97.27
d1jzga_128 Azurin {Pseudomonas aeruginosa [TaxId: 287]} 97.17
d1id2a_106 Amicyanin {Paracoccus versutus (Thiobacillus versu 97.15
d1nwpa_128 Azurin {Pseudomonas putida [TaxId: 303]} 97.15
d1kv7a2165 multi-copper oxidase CueO {Escherichia coli [TaxId 97.14
d1mzya2178 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 97.0
d1gska2174 Spore coat protein A, CotA {Bacillus subtilis [Tax 96.67
d2q5ba1105 Plastocyanin {Cyanobacterium (Phormidium laminosum 96.48
d2cuaa_122 Cytochrome c oxidase {Thermus thermophilus, ba3 ty 96.42
d1bxua_91 Plastocyanin {Cyanobacterium (Synechocystis sp.), 96.19
d1pmya_123 Pseudoazurin {Methylobacterium extorquens, strain 96.12
d2plta_98 Plastocyanin {Green alga (Chlamydomonas reinhardti 96.05
d1pcsa_98 Plastocyanin {Cyanobacterium (Synechocystis sp.), 95.88
d2jxma197 Plastocyanin {Photosynthetic prokaryote (Prochloro 95.6
d1sddb167 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 95.27
d1cuoa_129 Azurin {Methylomonas sp. j [TaxId: 32038]} 95.08
d2ccwa1129 Azurin {Alcaligenes xylosoxidans, NCIMB (11015), d 94.34
d1plca_99 Plastocyanin {Poplar (Populus nigra), variant ital 94.32
d1kdja_102 Plastocyanin {Fern (Adiantum capillus-veneris) [Ta 94.26
d1iuza_98 Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 94.13
d1jzga_128 Azurin {Pseudomonas aeruginosa [TaxId: 287]} 94.12
d1adwa_123 Pseudoazurin {Thiosphaera pantotropha [TaxId: 8236 94.05
d2cj3a1105 Plastocyanin {Anabaena variabilis [TaxId: 1172]} 94.03
d1nwpa_128 Azurin {Pseudomonas putida [TaxId: 303]} 93.48
d1bqka_124 Pseudoazurin {Achromobacter cycloclastes [TaxId: 2 92.86
d1paza_120 Pseudoazurin {Alcaligenes faecalis, strain s-6 [Ta 92.31
d2ov0a1105 Amicyanin {Paracoccus denitrificans [TaxId: 266]} 92.08
d1bypa_99 Plastocyanin {White campion (Silene pratensis) [Ta 91.74
d1id2a_106 Amicyanin {Paracoccus versutus (Thiobacillus versu 80.63
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Multidomain cupredoxins
domain: Ascorbate oxidase
species: Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]

Probab=100.00  E-value=6.1e-38  Score=281.12  Aligned_cols=126  Identities=37%  Similarity=0.729  Sum_probs=119.7

Q ss_pred             CceEEEEEEEeEeeecccccccCCCCCccccccceeecCCCeEEeEEEECCCCCCCeEEEecCCEEEEEEEECCCCCcee
Q psy4302          19 PMVCYYHFTLENYATIGPACGNCINGTMDDCFKKGCVTADGVERPILTINRRLPSPSIQVCRGDTIVVDVKNKIVDRVVT   98 (613)
Q Consensus        19 ~~~c~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dG~~~~~~~iNg~~PGP~i~v~~Gd~v~v~v~N~l~~~~~t   98 (613)
                      .++|+|+|+|++..                      .++||.++.+|+|||++|||+|+|++||+|+|+|+|+|..++++
T Consensus         1 ~~~~~~~~~v~~~~----------------------~~pdg~~~~~~~~NG~~PGP~i~v~~GD~v~i~l~N~l~~~~~~   58 (129)
T d1aoza1           1 SQIRHYKWEVEYMF----------------------WAPNCNENIVMGINGQFPGPTIRANAGDSVVVELTNKLHTEGVV   58 (129)
T ss_dssp             CCEEEEEEEEEEEE----------------------ECTTSSCEEEEEETTBSSCCCEEEETTCEEEEEEEECCSSCCBC
T ss_pred             CcEEEEEEEEEEEE----------------------ECCCCeEEEEEEECCCcCCCeEEEECCcEEEEEEEeCCCCCCee
Confidence            37899999999853                      68999999999999999999999999999999999999878999


Q ss_pred             EEeCCCcccCCCCCCCCCccccccCCCCCeEEEEEeecCCCceEEeecCcccccCCceeeEEEeCCCC
Q psy4302          99 IHWHGVYQRHTPHSDGVPLLTQCPIIPETTYRYKFPAMPYGTFFYHSHIGFQKMDGLEGPLVIRRPKK  166 (613)
Q Consensus        99 iHwHGl~~~~~~~~DGv~~vtq~pI~pG~~~~Y~f~~~~~GT~wyH~H~~~q~~~Gl~G~liV~~~~~  166 (613)
                      |||||+++...+++||+++++||+|+||++++|+|+++++||||||||++.|+.+||+|+|||+++++
T Consensus        59 iH~Hg~~~~~~~~~~~~~~~~~~~I~PG~s~~y~f~a~~~Gt~~YH~H~~~h~~~Gm~G~~iV~~~~~  126 (129)
T d1aoza1          59 IHWHGILQRGTPWADGTASISQCAINPGETFFYNFTVDNPGTFFYHGHLGMQRSAGLYGSLIVDPPQG  126 (129)
T ss_dssp             EEEETCCCTTCGGGSCCBTTTBCCBCTTCEEEEEEECCSCEEEEEEECSTTTGGGTCEEEEEEECCTT
T ss_pred             eeeccceeeccCccccccccccceECCCCEEEEEEECCCCCceEEecCCHHHHhCCCEEEEEEcCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999998854
>d1aoza3 b.6.1.3 (A:339-552) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1hfua3 b.6.1.3 (A:304-503) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1gyca3 b.6.1.3 (A:301-499) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d1v10a3 b.6.1.3 (A:305-494) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d2q9oa3 b.6.1.3 (A:344-559) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1kv7a1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1gska3 b.6.1.3 (A:357-510) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1gska1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1hfua2 b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1v10a2 b.6.1.3 (A:137-304) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d1gyca2 b.6.1.3 (A:131-300) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d2q9oa2 b.6.1.3 (A:163-343) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1sdda1 b.6.1.3 (A:1-180) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1aoza2 b.6.1.3 (A:130-338) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1kv7a3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j5wa3 b.6.1.3 (A:347-553) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j5wa5 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j5wa1 b.6.1.3 (A:1-192) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j5wa4 b.6.1.3 (A:706-884) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2j5wa2 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d1kv7a2 b.6.1.3 (A:171-335) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kbva2 b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d1gska2 b.6.1.3 (A:183-356) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sdda2 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kbva2 b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d2j5wa5 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j5wa2 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bw4a2 b.6.1.3 (A:166-338) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1sdda2 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1oe1a2 b.6.1.3 (A:160-336) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1fwxa1 b.6.1.4 (A:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d1sddb1 b.6.1.3 (B:1657-1723) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1qnia1 b.6.1.4 (A:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d2bw4a2 b.6.1.3 (A:166-338) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d2j5wa1 b.6.1.3 (A:1-192) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1kv7a1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1kv7a3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hfua3 b.6.1.3 (A:304-503) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1oe1a2 b.6.1.3 (A:160-336) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d1v10a3 b.6.1.3 (A:305-494) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d1gska3 b.6.1.3 (A:357-510) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gyca3 b.6.1.3 (A:301-499) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1aoza3 b.6.1.3 (A:339-552) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1sdda1 b.6.1.3 (A:1-180) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kdja_ b.6.1.1 (A:) Plastocyanin {Fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d2q9oa3 b.6.1.3 (A:344-559) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1fwxa1 b.6.1.4 (A:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pcsa_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d2j5wa3 b.6.1.3 (A:347-553) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]} Back     information, alignment and structure
>d2q5ba1 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Phormidium laminosum) [TaxId: 32059]} Back     information, alignment and structure
>d2ov0a1 b.6.1.1 (A:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1plca_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]} Back     information, alignment and structure
>d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId: 1143]} Back     information, alignment and structure
>d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]} Back     information, alignment and structure
>d1v10a2 b.6.1.3 (A:137-304) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d2q9oa2 b.6.1.3 (A:163-343) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1iuza_ b.6.1.1 (A:) Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 3120]} Back     information, alignment and structure
>d1hfua2 b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1qnia1 b.6.1.4 (A:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]} Back     information, alignment and structure
>d1gyca2 b.6.1.3 (A:131-300) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d2j5wa4 b.6.1.3 (A:706-884) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aoza2 b.6.1.3 (A:130-338) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1paza_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]} Back     information, alignment and structure
>d1adwa_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]} Back     information, alignment and structure
>d1gska1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mzya2 b.6.1.3 (A:194-371) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2ccwa1 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]} Back     information, alignment and structure
>d2cj3a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]} Back     information, alignment and structure
>d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} Back     information, alignment and structure
>d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]} Back     information, alignment and structure
>d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1id2a_ b.6.1.1 (A:) Amicyanin {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1kv7a2 b.6.1.3 (A:171-335) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mzya2 b.6.1.3 (A:194-371) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1gska2 b.6.1.3 (A:183-356) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2q5ba1 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Phormidium laminosum) [TaxId: 32059]} Back     information, alignment and structure
>d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} Back     information, alignment and structure
>d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId: 1143]} Back     information, alignment and structure
>d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]} Back     information, alignment and structure
>d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1pcsa_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]} Back     information, alignment and structure
>d1sddb1 b.6.1.3 (B:1657-1723) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]} Back     information, alignment and structure
>d2ccwa1 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]} Back     information, alignment and structure
>d1plca_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]} Back     information, alignment and structure
>d1kdja_ b.6.1.1 (A:) Plastocyanin {Fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d1iuza_ b.6.1.1 (A:) Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 3120]} Back     information, alignment and structure
>d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1adwa_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]} Back     information, alignment and structure
>d2cj3a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]} Back     information, alignment and structure
>d1paza_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]} Back     information, alignment and structure
>d2ov0a1 b.6.1.1 (A:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]} Back     information, alignment and structure
>d1id2a_ b.6.1.1 (A:) Amicyanin {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure