Psyllid ID: psy4400

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------
MDNLSCGLYIVTPKIMTKAKSKMAVMHPLPRVFEIAPEFDSDPRAAYFRQAEYGMYVRMALLTMVLGRDSALTYSNTPKKSCGLYIVTPKIMTKAKSKMAVMHPLPRVFEIAPEFDSDPRAAYFRQAEYGMYVRMALLTMVLGRDSALTYSNTPKKV
ccccccccccccHHHHHHcHHcccccccccccccccccccccccHHHHHHHHHcHHHHHHHHHHHHHccccccccccccccccEEEEcHHHHHHcccccEEEcccccccccccccccccccHHHHHHHHcHHHHHHHHHHHHccccccccccccccc
ccccccccccEcHHHHcccccccEEEccccccccEcHHHcccccEcHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHcccccEcHHHHcccccccEEEccccccccEcHHHcccccEcHHHHHHHHHHHHHHHHHHHHccccccccccccccc
mdnlscglyivTPKIMTKAKSkmavmhplprvfeiapefdsdpraayFRQAEYGMYVRMALLTMVLGrdsaltysntpkkscglyivtPKIMTKAKSkmavmhplprvfeiapefdsdpraayFRQAEYGMYVRMALLTMVLGrdsaltysntpkkv
mdnlscglYIVTPKIMTKAKSKMAVMHPLPRVFEiapefdsdPRAAYFRQAEYGMYVRMALLTMVLGRDSALtysntpkkscglyIVTPKIMTKAKSKMAVMHPLPRVFEiapefdsdPRAAYFRQAEYGMYVRMALLTMVLgrdsaltysntpkkv
MDNLSCGLYIVTPKIMTKAKSKMAVMHPLPRVFEIAPEFDSDPRAAYFRQAEYGMYVRMALLTMVLGRDSALTYSNTPKKSCGLYIVTPKIMTKAKSKMAVMHPLPRVFEIAPEFDSDPRAAYFRQAEYGMYVRMALLTMVLGRDSALTYSNTPKKV
****SCGLYIVTPKIMTKAKSKMAVMHPLPRVFEIAPEFDSDPRAAYFRQAEYGMYVRMALLTMVLGRDSALTYSNTPKKSCGLYIVTPKIMTKAKSKMAVMHPLPRVFEIAPEFDSDPRAAYFRQAEYGMYVRMALLTMVLGRDSAL*********
*DNLSCGLYIVTPKIMTKAKSKMAVMHPLPRVFEIAPEFDSDPRAAYFRQAEYGMYVRMALLTMVLGRDSALTYSNTPKKSCGLYIVTPKIMTKAKSKMAVMHPLPRVFEIAPEFDSDPRAAYFRQAEYGMYVRMALLTMVLGRDSAL*********
MDNLSCGLYIVTPKIMTKAKSKMAVMHPLPRVFEIAPEFDSDPRAAYFRQAEYGMYVRMALLTMVLGRDSALTYSNTPKKSCGLYIVTPKIMTKAKSKMAVMHPLPRVFEIAPEFDSDPRAAYFRQAEYGMYVRMALLTMVLGRDSALTYSNTPKKV
**NLSCGLYIVTPKIMTKAKSKMAVMHPLPRVFEIAPEFDSDPRAAYFRQAEYGMYVRMALLTMVLGRDSALTYSNTPKKSCGLYIVTPKIMTKAKSKMAVMHPLPRVFEIAPEFDSDPRAAYFRQAEYGMYVRMALLTMVLGRDSALT********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDNLSCGLYIVTPKIMTKAKSKMAVMHPLPRVFEIAPEFDSDPRAAYFRQAEYGMYVRMALLTMVLGRDSALTYSNTPKKSCGLYIVTPKIMTKAKSKMAVMHPLPRVFEIAPEFDSDPRAAYFRQAEYGMYVRMALLTMVLGRDSALTYSNTPKKV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query157 2.2.26 [Sep-21-2011]
Q914372242 CAD protein OS=Squalus ac N/A N/A 0.414 0.028 0.712 5e-21
P089552225 CAD protein OS=Mesocricet N/A N/A 0.394 0.027 0.741 5e-21
P277082225 CAD protein OS=Homo sapie yes N/A 0.394 0.027 0.741 7e-21
P059902224 CAD protein OS=Drosophila yes N/A 0.445 0.031 0.633 2e-20
P200542225 Protein PYR1-3 OS=Dictyos yes N/A 0.375 0.026 0.661 8e-19
P072592214 Protein URA2 OS=Saccharom yes N/A 0.445 0.031 0.589 4e-17
B2TNG3307 Aspartate carbamoyltransf yes N/A 0.375 0.192 0.661 2e-15
B2UW93307 Aspartate carbamoyltransf yes N/A 0.375 0.192 0.644 7e-15
A6LS54308 Aspartate carbamoyltransf yes N/A 0.375 0.191 0.644 2e-14
C1FLB6307 Aspartate carbamoyltransf yes N/A 0.375 0.192 0.610 3e-14
>sp|Q91437|PYR1_SQUAC CAD protein OS=Squalus acanthias GN=CAD PE=2 SV=1 Back     alignment and function desciption
 Score =  100 bits (248), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 54/66 (81%), Gaps = 1/66 (1%)

Query: 80   KSC-GLYIVTPKIMTKAKSKMAVMHPLPRVFEIAPEFDSDPRAAYFRQAEYGMYVRMALL 138
            ++C G +I+TP IMTK K KM VMHPLPRV E++ E DSDPRAAYFRQAE GMYVRMALL
Sbjct: 2176 EACFGQFILTPHIMTKGKKKMVVMHPLPRVNEVSVEVDSDPRAAYFRQAENGMYVRMALL 2235

Query: 139  TMVLGR 144
              VLG+
Sbjct: 2236 ATVLGK 2241
This protein is a "fusion" protein encoding four enzymatic activities of the pyrimidine pathway (GATase, CPSase, ATCase and DHOase).
Squalus acanthias (taxid: 7797)
EC: 3EC: .EC: 5EC: .EC: 2EC: .EC: 3
>sp|P08955|PYR1_MESAU CAD protein OS=Mesocricetus auratus GN=CAD PE=1 SV=4 Back     alignment and function description
>sp|P27708|PYR1_HUMAN CAD protein OS=Homo sapiens GN=CAD PE=1 SV=3 Back     alignment and function description
>sp|P05990|PYR1_DROME CAD protein OS=Drosophila melanogaster GN=r PE=1 SV=3 Back     alignment and function description
>sp|P20054|PYR1_DICDI Protein PYR1-3 OS=Dictyostelium discoideum GN=pyr1-3 PE=1 SV=3 Back     alignment and function description
>sp|P07259|PYR1_YEAST Protein URA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URA2 PE=1 SV=5 Back     alignment and function description
>sp|B2TNG3|PYRB_CLOBB Aspartate carbamoyltransferase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=pyrB PE=3 SV=1 Back     alignment and function description
>sp|B2UW93|PYRB_CLOBA Aspartate carbamoyltransferase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=pyrB PE=3 SV=1 Back     alignment and function description
>sp|A6LS54|PYRB_CLOB8 Aspartate carbamoyltransferase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=pyrB PE=3 SV=1 Back     alignment and function description
>sp|C1FLB6|PYRB_CLOBJ Aspartate carbamoyltransferase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=pyrB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query157
193697813 2235 PREDICTED: CAD protein-like [Acyrthosiph 0.439 0.030 0.797 1e-27
242001442 1136 carbamoyl-phosphate synthase large chain 0.420 0.058 0.787 2e-25
427782693 2135 Putative multifunctional pyrimidine synt 0.420 0.030 0.787 2e-25
427795101 2129 Putative multifunctional pyrimidine synt 0.420 0.031 0.787 2e-25
242002962 2251 carbamoyl-phosphate synthase, putative [ 0.420 0.029 0.787 2e-25
91090153 2198 PREDICTED: similar to carbamoyl-phosphat 0.414 0.029 0.784 2e-24
332016929 2231 CAD protein [Acromyrmex echinatior] 0.414 0.029 0.784 7e-24
380022553 2234 PREDICTED: LOW QUALITY PROTEIN: CAD prot 0.420 0.029 0.757 1e-23
383857632 2254 PREDICTED: CAD protein-like [Megachile r 0.420 0.029 0.727 1e-23
260829369242 hypothetical protein BRAFLDRAFT_123555 [ 0.420 0.272 0.757 2e-23
>gi|193697813|ref|XP_001943635.1| PREDICTED: CAD protein-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 55/69 (79%), Positives = 64/69 (92%)

Query: 76   NTPKKSCGLYIVTPKIMTKAKSKMAVMHPLPRVFEIAPEFDSDPRAAYFRQAEYGMYVRM 135
            N+ K++CGL++VTP++M KAK KM VMHPLPRVFEI+PEFDSDPRAAYFRQAEYGMYVRM
Sbjct: 2166 NSYKQACGLFVVTPEVMNKAKRKMIVMHPLPRVFEISPEFDSDPRAAYFRQAEYGMYVRM 2225

Query: 136  ALLTMVLGR 144
            ALL MVLG+
Sbjct: 2226 ALLAMVLGK 2234

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|242001442|ref|XP_002435364.1| carbamoyl-phosphate synthase large chain, putative [Ixodes scapularis] gi|215498694|gb|EEC08188.1| carbamoyl-phosphate synthase large chain, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|427782693|gb|JAA56798.1| Putative multifunctional pyrimidine synthesis protein cad includes carbamoyl-phosphate synthet [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|427795101|gb|JAA63002.1| Putative multifunctional pyrimidine synthesis protein cad includes carbamoyl-phosphate synthet, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|242002962|ref|XP_002422558.1| carbamoyl-phosphate synthase, putative [Pediculus humanus corporis] gi|212505348|gb|EEB09820.1| carbamoyl-phosphate synthase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|91090153|ref|XP_972190.1| PREDICTED: similar to carbamoyl-phosphate synthase large chain [Tribolium castaneum] gi|270013749|gb|EFA10197.1| hypothetical protein TcasGA2_TC012392 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|332016929|gb|EGI57738.1| CAD protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|380022553|ref|XP_003695107.1| PREDICTED: LOW QUALITY PROTEIN: CAD protein-like [Apis florea] Back     alignment and taxonomy information
>gi|383857632|ref|XP_003704308.1| PREDICTED: CAD protein-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|260829369|ref|XP_002609634.1| hypothetical protein BRAFLDRAFT_123555 [Branchiostoma floridae] gi|229294996|gb|EEN65644.1| hypothetical protein BRAFLDRAFT_123555 [Branchiostoma floridae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query157
UNIPROTKB|H7C2E4293 CAD "CAD protein" [Homo sapien 0.414 0.221 0.712 4.4e-20
UNIPROTKB|J9P2662162 CAD "Uncharacterized protein" 0.445 0.032 0.676 1.9e-18
RGD|15886062225 Cad "carbamoyl-phosphate synth 0.445 0.031 0.676 2e-18
UNIPROTKB|E2RAV22228 CAD "Uncharacterized protein" 0.445 0.031 0.676 2e-18
UNIPROTKB|F8VPD42162 CAD "CAD protein" [Homo sapien 0.414 0.030 0.712 2.4e-18
UNIPROTKB|F1MVC02225 CAD "Uncharacterized protein" 0.414 0.029 0.712 2.5e-18
UNIPROTKB|P277082225 CAD "CAD protein" [Homo sapien 0.414 0.029 0.712 2.5e-18
UNIPROTKB|P089552225 CAD "CAD protein" [Mesocricetu 0.414 0.029 0.712 2.5e-18
FB|FBgn00031892224 r "rudimentary" [Drosophila me 0.445 0.031 0.633 8.6e-18
ZFIN|ZDB-GENE-021030-42230 cad "carbamoyl-phosphate synth 0.420 0.029 0.712 1.1e-17
UNIPROTKB|H7C2E4 CAD "CAD protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 238 (88.8 bits), Expect = 4.4e-20, P = 4.4e-20
 Identities = 47/66 (71%), Positives = 55/66 (83%)

Query:    80 KSC-GLYIVTPKIMTKAKSKMAVMHPLPRVFEIAPEFDSDPRAAYFRQAEYGMYVRMALL 138
             ++C G +I+TP IMT+AK KM VMHP+PRV EI+ E DSDPRAAYFRQAE GMY+RMALL
Sbjct:   227 EACFGQFILTPHIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYIRMALL 286

Query:   139 TMVLGR 144
               VLGR
Sbjct:   287 ATVLGR 292
GO:0004070 "aspartate carbamoyltransferase activity" evidence=IEA
GO:0006207 "'de novo' pyrimidine nucleobase biosynthetic process" evidence=IEA
GO:0006520 "cellular amino acid metabolic process" evidence=IEA
GO:0016597 "amino acid binding" evidence=IEA
UNIPROTKB|J9P266 CAD "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1588606 Cad "carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RAV2 CAD "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F8VPD4 CAD "CAD protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MVC0 CAD "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P27708 CAD "CAD protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P08955 CAD "CAD protein" [Mesocricetus auratus (taxid:10036)] Back     alignment and assigned GO terms
FB|FBgn0003189 r "rudimentary" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-021030-4 cad "carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P05990PYR1_DROME3, ., 5, ., 2, ., 30.63380.44580.0314yesN/A
P07259PYR1_YEAST2, ., 1, ., 3, ., 20.58900.44580.0316yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.3LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
PLN02527306 PLN02527, PLN02527, aspartate carbamoyltransferase 4e-26
PLN02527306 PLN02527, PLN02527, aspartate carbamoyltransferase 4e-26
PRK00856305 PRK00856, pyrB, aspartate carbamoyltransferase cat 6e-22
PRK00856305 PRK00856, pyrB, aspartate carbamoyltransferase cat 6e-22
pfam00185156 pfam00185, OTCace, Aspartate/ornithine carbamoyltr 2e-20
pfam00185156 pfam00185, OTCace, Aspartate/ornithine carbamoyltr 2e-20
COG0540316 COG0540, PyrB, Aspartate carbamoyltransferase, cat 7e-20
COG0540316 COG0540, PyrB, Aspartate carbamoyltransferase, cat 7e-20
TIGR00670301 TIGR00670, asp_carb_tr, aspartate carbamoyltransfe 6e-19
TIGR00670301 TIGR00670, asp_carb_tr, aspartate carbamoyltransfe 6e-19
PRK08192338 PRK08192, PRK08192, aspartate carbamoyltransferase 7e-10
PRK08192338 PRK08192, PRK08192, aspartate carbamoyltransferase 7e-10
PRK11891429 PRK11891, PRK11891, aspartate carbamoyltransferase 7e-08
PRK11891429 PRK11891, PRK11891, aspartate carbamoyltransferase 7e-08
COG0078310 COG0078, ArgF, Ornithine carbamoyltransferase [Ami 7e-06
COG0078310 COG0078, ArgF, Ornithine carbamoyltransferase [Ami 7e-06
PRK00779304 PRK00779, PRK00779, ornithine carbamoyltransferase 4e-04
PRK00779304 PRK00779, PRK00779, ornithine carbamoyltransferase 4e-04
TIGR00658304 TIGR00658, orni_carb_tr, ornithine carbamoyltransf 5e-04
TIGR00658304 TIGR00658, orni_carb_tr, ornithine carbamoyltransf 5e-04
PRK13814310 PRK13814, pyrB, aspartate carbamoyltransferase cat 6e-04
PRK13814310 PRK13814, pyrB, aspartate carbamoyltransferase cat 6e-04
PRK13376 525 PRK13376, pyrB, bifunctional aspartate carbamoyltr 0.001
PRK13376 525 PRK13376, pyrB, bifunctional aspartate carbamoyltr 0.001
>gnl|CDD|178142 PLN02527, PLN02527, aspartate carbamoyltransferase Back     alignment and domain information 
 Score = 99.8 bits (249), Expect = 4e-26
 Identities = 35/61 (57%), Positives = 44/61 (72%)

Query: 7   GLYIVTPKIMTKAKSKMAVMHPLPRVFEIAPEFDSDPRAAYFRQAEYGMYVRMALLTMVL 66
           G YIV  K+M        VMHPLPR+ EI  + DSDPRAAYFRQA+ G+++RMALL ++L
Sbjct: 244 GKYIVDKKVMDVLPKHAVVMHPLPRLDEITTDVDSDPRAAYFRQAKNGLFIRMALLKLLL 303

Query: 67  G 67
           G
Sbjct: 304 G 304

Length = 306
>gnl|CDD|178142 PLN02527, PLN02527, aspartate carbamoyltransferase Back     alignment and domain information
>gnl|CDD|234849 PRK00856, pyrB, aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|234849 PRK00856, pyrB, aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|215776 pfam00185, OTCace, Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain Back     alignment and domain information
>gnl|CDD|215776 pfam00185, OTCace, Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain Back     alignment and domain information
>gnl|CDD|223614 COG0540, PyrB, Aspartate carbamoyltransferase, catalytic chain [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|223614 COG0540, PyrB, Aspartate carbamoyltransferase, catalytic chain [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|233083 TIGR00670, asp_carb_tr, aspartate carbamoyltransferase Back     alignment and domain information
>gnl|CDD|233083 TIGR00670, asp_carb_tr, aspartate carbamoyltransferase Back     alignment and domain information
>gnl|CDD|169269 PRK08192, PRK08192, aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|169269 PRK08192, PRK08192, aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|183362 PRK11891, PRK11891, aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|183362 PRK11891, PRK11891, aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|223156 COG0078, ArgF, Ornithine carbamoyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223156 COG0078, ArgF, Ornithine carbamoyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|234835 PRK00779, PRK00779, ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|234835 PRK00779, PRK00779, ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|129743 TIGR00658, orni_carb_tr, ornithine carbamoyltransferase Back     alignment and domain information
>gnl|CDD|129743 TIGR00658, orni_carb_tr, ornithine carbamoyltransferase Back     alignment and domain information
>gnl|CDD|139876 PRK13814, pyrB, aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|139876 PRK13814, pyrB, aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|237369 PRK13376, pyrB, bifunctional aspartate carbamoyltransferase catalytic subunit/aspartate carbamoyltransferase regulatory subunit; Provisional Back     alignment and domain information
>gnl|CDD|237369 PRK13376, pyrB, bifunctional aspartate carbamoyltransferase catalytic subunit/aspartate carbamoyltransferase regulatory subunit; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 157
TIGR00670301 asp_carb_tr aspartate carbamoyltransferase. Ornith 99.91
PLN02527306 aspartate carbamoyltransferase 99.9
PRK00856305 pyrB aspartate carbamoyltransferase catalytic subu 99.89
PRK13814310 pyrB aspartate carbamoyltransferase catalytic subu 99.88
PF00185158 OTCace: Aspartate/ornithine carbamoyltransferase, 99.88
PRK02255338 putrescine carbamoyltransferase; Provisional 99.87
PLN02342348 ornithine carbamoyltransferase 99.87
PRK04523335 N-acetylornithine carbamoyltransferase; Reviewed 99.87
TIGR00658304 orni_carb_tr ornithine carbamoyltransferase. Most 99.87
COG0540316 PyrB Aspartate carbamoyltransferase, catalytic cha 99.87
PRK08192338 aspartate carbamoyltransferase; Provisional 99.86
PRK11891429 aspartate carbamoyltransferase; Provisional 99.86
PRK14805302 ornithine carbamoyltransferase; Provisional 99.85
PRK12562334 ornithine carbamoyltransferase subunit F; Provisio 99.85
COG0078310 ArgF Ornithine carbamoyltransferase [Amino acid tr 99.85
PRK00779304 ornithine carbamoyltransferase; Provisional 99.85
PRK04284332 ornithine carbamoyltransferase; Provisional 99.85
PRK03515336 ornithine carbamoyltransferase subunit I; Provisio 99.84
PRK01713334 ornithine carbamoyltransferase; Provisional 99.84
PRK02102331 ornithine carbamoyltransferase; Validated 99.84
PRK07200395 aspartate/ornithine carbamoyltransferase family pr 99.82
TIGR03316357 ygeW probable carbamoyltransferase YgeW. Members o 99.82
PRK13376 525 pyrB bifunctional aspartate carbamoyltransferase c 99.81
PRK14804311 ornithine carbamoyltransferase; Provisional 99.79
KOG1504|consensus346 99.75
PLN02527306 aspartate carbamoyltransferase 99.71
TIGR00670301 asp_carb_tr aspartate carbamoyltransferase. Ornith 99.7
PF00185158 OTCace: Aspartate/ornithine carbamoyltransferase, 99.7
PRK00856305 pyrB aspartate carbamoyltransferase catalytic subu 99.67
PLN02342348 ornithine carbamoyltransferase 99.66
TIGR00658304 orni_carb_tr ornithine carbamoyltransferase. Most 99.66
PRK14805302 ornithine carbamoyltransferase; Provisional 99.65
PRK13814310 pyrB aspartate carbamoyltransferase catalytic subu 99.65
PRK02255338 putrescine carbamoyltransferase; Provisional 99.64
PRK00779304 ornithine carbamoyltransferase; Provisional 99.63
PRK04523335 N-acetylornithine carbamoyltransferase; Reviewed 99.6
PRK14804311 ornithine carbamoyltransferase; Provisional 99.6
COG0078310 ArgF Ornithine carbamoyltransferase [Amino acid tr 99.6
PRK04284332 ornithine carbamoyltransferase; Provisional 99.6
PRK12562334 ornithine carbamoyltransferase subunit F; Provisio 99.59
PRK02102331 ornithine carbamoyltransferase; Validated 99.59
PRK11891429 aspartate carbamoyltransferase; Provisional 99.58
PRK08192338 aspartate carbamoyltransferase; Provisional 99.57
PRK03515336 ornithine carbamoyltransferase subunit I; Provisio 99.57
PRK01713334 ornithine carbamoyltransferase; Provisional 99.57
PRK07200395 aspartate/ornithine carbamoyltransferase family pr 99.56
TIGR03316357 ygeW probable carbamoyltransferase YgeW. Members o 99.54
COG0540316 PyrB Aspartate carbamoyltransferase, catalytic cha 99.51
PRK13376 525 pyrB bifunctional aspartate carbamoyltransferase c 99.45
KOG1504|consensus346 99.44
>TIGR00670 asp_carb_tr aspartate carbamoyltransferase Back     alignment and domain information 
Probab=99.91  E-value=1.5e-25  Score=185.55  Aligned_cols=117  Identities=31%  Similarity=0.452  Sum_probs=93.0

Q ss_pred             HHhcCCCeEEeCCCCceeeecc-------------cccCCchhhhhhhhhhhHHHHHHHHHHHhccccccccCCCCCccC
Q psy4400          16 MTKAKSKMAVMHPLPRVFEIAP-------------EFDSDPRAAYFRQAEYGMYVRMALLTMVLGRDSALTYSNTPKKSC   82 (157)
Q Consensus        16 l~~a~~~~~vmHplPr~~Ei~~-------------~V~~~~~s~i~~QA~n~~~~RmAll~~ll~~~~~~~~~~ey~~~~   82 (157)
                      +...+.++.+.||  ++++++.             .+.+++..++ ++||..+..|++.+++        .+.+++.+.+
T Consensus       172 ~a~~g~~v~~~~P--~~~~~~~~~~~~~~~~G~~v~~~~d~~~a~-~~aDvvyt~~~~~er~--------~~~~~~~~~~  240 (301)
T TIGR00670       172 LTRFGVEVYLISP--EELRMPKEILEELKAKGIKVRETESLEEVI-DEADVLYVTRIQKERF--------PDPEEYEKYK  240 (301)
T ss_pred             HHHcCCEEEEECC--ccccCCHHHHHHHHHcCCEEEEECCHHHHh-CCCCEEEECCcccccc--------CCHHHHHHHh
Confidence            3445667777554  4554432             2357777774 9999999888754432        1224566678


Q ss_pred             CccccCHHHHhccCCCcEEeCCCCCccccCccccCCCCchhHHHHhhcHHHHHHHHHHHhc
Q psy4400          83 GLYIVTPKIMTKAKSKMAVMHPLPRVFEIAPEFDSDPRAAYFRQAEYGMYVRMALLTMVLG  143 (157)
Q Consensus        83 ~~~~l~~e~l~~~~~~~~vmHplPR~~Ei~~~v~~~~~s~~~~Qa~n~~~~rmAll~~ll~  143 (157)
                      .+|+||.++|+.++++++||||||||.||+++|+++|+|.+|+||+||+|+|||||+++++
T Consensus       241 ~~y~v~~ell~~a~~~ai~mHclPRg~Ev~~~V~d~p~s~i~~QaeNrl~~~~AvL~~ll~  301 (301)
T TIGR00670       241 GSYGITLERLEAAKKGVIIMHPLPRVDEIDPSVDDTPHAKYFKQAFNGVPVRMALLSLLLG  301 (301)
T ss_pred             cCCeECHHHHhhcCCCCEEECCCCCCcccCHHHhCCccchHHHHHhccHHHHHHHHHHHhC
Confidence            8899999999999999999999999999999999999999999999999999999998875

Ornithine carbamoyltransferases are in the same superfamily and form an outgroup.
>PLN02527 aspartate carbamoyltransferase Back     alignment and domain information
>PRK00856 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>PRK13814 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>PF00185 OTCace: Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain; InterPro: IPR006131 This family contains two related enzymes: Aspartate carbamoyltransferase (2 Back     alignment and domain information
>PRK02255 putrescine carbamoyltransferase; Provisional Back     alignment and domain information
>PLN02342 ornithine carbamoyltransferase Back     alignment and domain information
>PRK04523 N-acetylornithine carbamoyltransferase; Reviewed Back     alignment and domain information
>TIGR00658 orni_carb_tr ornithine carbamoyltransferase Back     alignment and domain information
>COG0540 PyrB Aspartate carbamoyltransferase, catalytic chain [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08192 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>PRK11891 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>PRK14805 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK12562 ornithine carbamoyltransferase subunit F; Provisional Back     alignment and domain information
>COG0078 ArgF Ornithine carbamoyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00779 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK04284 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK03515 ornithine carbamoyltransferase subunit I; Provisional Back     alignment and domain information
>PRK01713 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK02102 ornithine carbamoyltransferase; Validated Back     alignment and domain information
>PRK07200 aspartate/ornithine carbamoyltransferase family protein; Validated Back     alignment and domain information
>TIGR03316 ygeW probable carbamoyltransferase YgeW Back     alignment and domain information
>PRK13376 pyrB bifunctional aspartate carbamoyltransferase catalytic subunit/aspartate carbamoyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PRK14804 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>KOG1504|consensus Back     alignment and domain information
>PLN02527 aspartate carbamoyltransferase Back     alignment and domain information
>TIGR00670 asp_carb_tr aspartate carbamoyltransferase Back     alignment and domain information
>PF00185 OTCace: Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain; InterPro: IPR006131 This family contains two related enzymes: Aspartate carbamoyltransferase (2 Back     alignment and domain information
>PRK00856 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>PLN02342 ornithine carbamoyltransferase Back     alignment and domain information
>TIGR00658 orni_carb_tr ornithine carbamoyltransferase Back     alignment and domain information
>PRK14805 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK13814 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>PRK02255 putrescine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK00779 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK04523 N-acetylornithine carbamoyltransferase; Reviewed Back     alignment and domain information
>PRK14804 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>COG0078 ArgF Ornithine carbamoyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04284 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK12562 ornithine carbamoyltransferase subunit F; Provisional Back     alignment and domain information
>PRK02102 ornithine carbamoyltransferase; Validated Back     alignment and domain information
>PRK11891 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>PRK08192 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>PRK03515 ornithine carbamoyltransferase subunit I; Provisional Back     alignment and domain information
>PRK01713 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK07200 aspartate/ornithine carbamoyltransferase family protein; Validated Back     alignment and domain information
>TIGR03316 ygeW probable carbamoyltransferase YgeW Back     alignment and domain information
>COG0540 PyrB Aspartate carbamoyltransferase, catalytic chain [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13376 pyrB bifunctional aspartate carbamoyltransferase catalytic subunit/aspartate carbamoyltransferase regulatory subunit; Provisional Back     alignment and domain information
>KOG1504|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
1ml4_A308 The Pala-Liganded Aspartate Transcarbamoylase Catal 2e-14
3mpu_A310 Crystal Structure Of The C47aA241C DISULFIDE-Linked 2e-12
1sku_A310 E. Coli Aspartate Transcarbamylase 240's Loop Mutan 6e-12
1sku_A310 E. Coli Aspartate Transcarbamylase 240's Loop Mutan 6e-12
1raa_A310 Crystal Structure Of Ctp-Ligated T State Aspartate 6e-12
1raa_A310 Crystal Structure Of Ctp-Ligated T State Aspartate 6e-12
1at1_A310 Crystal Structures Of Phosphonoacetamide Ligated T 6e-12
1at1_A310 Crystal Structures Of Phosphonoacetamide Ligated T 6e-12
9atc_A310 Atcase Y165f Mutant Length = 310 6e-12
9atc_A310 Atcase Y165f Mutant Length = 310 6e-12
4e2f_I310 Crystal Structure Of E. Coli Aspartate Transcarbamo 6e-12
4e2f_I310 Crystal Structure Of E. Coli Aspartate Transcarbamo 6e-12
1d09_A310 Aspartate Transcarbamoylase Complexed With N-Phosph 6e-12
1d09_A310 Aspartate Transcarbamoylase Complexed With N-Phosph 6e-12
1tth_A310 Aspartate Transcarbamoylase Catalytic Chain Mutant 6e-12
1tth_A310 Aspartate Transcarbamoylase Catalytic Chain Mutant 6e-12
2a0f_A310 Structure Of D236a Mutant E. Coli Aspartate Transca 6e-12
2a0f_A310 Structure Of D236a Mutant E. Coli Aspartate Transca 6e-12
1acm_A310 Arginine 54 In The Active Site Of Escherichia Coli 6e-12
1acm_A310 Arginine 54 In The Active Site Of Escherichia Coli 6e-12
1i5o_A310 Crystal Structure Of Mutant R105a Of E. Coli Aspart 6e-12
1i5o_A310 Crystal Structure Of Mutant R105a Of E. Coli Aspart 6e-12
1ekx_A311 The Isolated, Unregulated Catalytic Trimer Of Aspar 6e-12
1ekx_A311 The Isolated, Unregulated Catalytic Trimer Of Aspar 6e-12
1xjw_A310 The Structure Of E. Coli Aspartate Transcarbamoylas 6e-12
1xjw_A310 The Structure Of E. Coli Aspartate Transcarbamoylas 6e-12
1ezz_A310 Crystal Structure Of E. Coli Aspartate Transcarbamo 4e-11
1ezz_A310 Crystal Structure Of E. Coli Aspartate Transcarbamo 4e-11
2be7_A326 Crystal Structure Of The Unliganded (T-State) Aspar 9e-11
2be7_A326 Crystal Structure Of The Unliganded (T-State) Aspar 9e-11
2atc_A305 Crystal And Molecular Structures Of Native And Ctp- 1e-10
2atc_A305 Crystal And Molecular Structures Of Native And Ctp- 1e-10
1pg5_A299 Crystal Structure Of The Unligated (t-state) Aspart 4e-10
2be9_A300 Crystal Structure Of The Ctp-Liganded (T-State) Asp 4e-10
3lxm_A335 2.00 Angstrom Resolution Crystal Structure Of A Cat 8e-10
3lxm_A335 2.00 Angstrom Resolution Crystal Structure Of A Cat 8e-10
2rgw_A306 Catalytic Subunit Of M. Jannaschii Aspartate Transc 3e-07
2rgw_A306 Catalytic Subunit Of M. Jannaschii Aspartate Transc 3e-07
>pdb|1ML4|A Chain A, The Pala-Liganded Aspartate Transcarbamoylase Catalytic Subunit From Pyrococcus Abyssi Length = 308 Back     alignment and structure 
Iteration: 1

 Score = 74.3 bits (181), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/120 (40%), Positives = 61/120 (50%), Gaps = 11/120 (9%)
Query: 35  IAPEFDSDPRAAYFRQAEYGM-YVRMALLTMVLGRDSALTYSNTPK----------KSCG 83
           I+PE    PR       E GM  V    L  V+G+   L  +   K          K  G
Sbjct: 187 ISPELLRMPRHIVEELREKGMKVVETTTLEDVIGKLDVLYVTRIQKERFPDEQEYLKVKG 246
Query: 84  LYIVTPKIMTKAKSKMAVMHPLPRVFEIAPEFDSDPRAAYFRQAEYGMYVRMALLTMVLG 143
            Y V  K++ KAK ++ +MHPLPRV EI PE D+   A YFRQ   G+ VRMALL +VLG
Sbjct: 247 SYQVNLKVLEKAKDELRIMHPLPRVDEIHPEVDNTKHAIYFRQVFNGVPVRMALLALVLG 306
>pdb|3MPU|A Chain A, Crystal Structure Of The C47aA241C DISULFIDE-Linked E. Coli Aspartate Transcarbamoylase Holoenzyme Length = 310 Back     alignment and structure
>pdb|1SKU|A Chain A, E. Coli Aspartate Transcarbamylase 240's Loop Mutant (K244n) Length = 310 Back     alignment and structure
>pdb|1SKU|A Chain A, E. Coli Aspartate Transcarbamylase 240's Loop Mutant (K244n) Length = 310 Back     alignment and structure
>pdb|1RAA|A Chain A, Crystal Structure Of Ctp-Ligated T State Aspartate Transcarbamoylase At 2.5 Angstroms Resolution: Implications For Atcase Mutants And The Mechanism Of Negative Cooperativity Length = 310 Back     alignment and structure
>pdb|1RAA|A Chain A, Crystal Structure Of Ctp-Ligated T State Aspartate Transcarbamoylase At 2.5 Angstroms Resolution: Implications For Atcase Mutants And The Mechanism Of Negative Cooperativity Length = 310 Back     alignment and structure
>pdb|1AT1|A Chain A, Crystal Structures Of Phosphonoacetamide Ligated T And Phosphonoacetamide And Malonate Ligated R States Of Aspartate Carbamoyltransferase At 2.8-Angstroms Resolution And Neutral PH Length = 310 Back     alignment and structure
>pdb|1AT1|A Chain A, Crystal Structures Of Phosphonoacetamide Ligated T And Phosphonoacetamide And Malonate Ligated R States Of Aspartate Carbamoyltransferase At 2.8-Angstroms Resolution And Neutral PH Length = 310 Back     alignment and structure
>pdb|9ATC|A Chain A, Atcase Y165f Mutant Length = 310 Back     alignment and structure
>pdb|9ATC|A Chain A, Atcase Y165f Mutant Length = 310 Back     alignment and structure
>pdb|4E2F|I Chain I, Crystal Structure Of E. Coli Aspartate Transcarbamoylase K164eE239K Mutant In An Intermediate State Length = 310 Back     alignment and structure
>pdb|4E2F|I Chain I, Crystal Structure Of E. Coli Aspartate Transcarbamoylase K164eE239K Mutant In An Intermediate State Length = 310 Back     alignment and structure
>pdb|1D09|A Chain A, Aspartate Transcarbamoylase Complexed With N-Phosphonacetyl-L- Aspartate (Pala) Length = 310 Back     alignment and structure
>pdb|1D09|A Chain A, Aspartate Transcarbamoylase Complexed With N-Phosphonacetyl-L- Aspartate (Pala) Length = 310 Back     alignment and structure
>pdb|1TTH|A Chain A, Aspartate Transcarbamoylase Catalytic Chain Mutant Glu50ala Complexed With N-(Phosphonacetyl-L-Aspartate) (Pala) Length = 310 Back     alignment and structure
>pdb|1TTH|A Chain A, Aspartate Transcarbamoylase Catalytic Chain Mutant Glu50ala Complexed With N-(Phosphonacetyl-L-Aspartate) (Pala) Length = 310 Back     alignment and structure
>pdb|2A0F|A Chain A, Structure Of D236a Mutant E. Coli Aspartate Transcarbamoylase In Presence Of Phosphonoacetamide At 2.90 A Resolution Length = 310 Back     alignment and structure
>pdb|2A0F|A Chain A, Structure Of D236a Mutant E. Coli Aspartate Transcarbamoylase In Presence Of Phosphonoacetamide At 2.90 A Resolution Length = 310 Back     alignment and structure
>pdb|1ACM|A Chain A, Arginine 54 In The Active Site Of Escherichia Coli Aspartate Transcarbamoylase Is Critical For Catalysis: A Site-Specific Mutagenesis, Nmr And X-Ray Crystallography Study Length = 310 Back     alignment and structure
>pdb|1ACM|A Chain A, Arginine 54 In The Active Site Of Escherichia Coli Aspartate Transcarbamoylase Is Critical For Catalysis: A Site-Specific Mutagenesis, Nmr And X-Ray Crystallography Study Length = 310 Back     alignment and structure
>pdb|1I5O|A Chain A, Crystal Structure Of Mutant R105a Of E. Coli Aspartate Transcarbamoylase Length = 310 Back     alignment and structure
>pdb|1I5O|A Chain A, Crystal Structure Of Mutant R105a Of E. Coli Aspartate Transcarbamoylase Length = 310 Back     alignment and structure
>pdb|1EKX|A Chain A, The Isolated, Unregulated Catalytic Trimer Of Aspartate Transcarbamoylase Complexed With Bisubstrate Analog Pala (N-(Phosphonacetyl)-L-Aspartate) Length = 311 Back     alignment and structure
>pdb|1EKX|A Chain A, The Isolated, Unregulated Catalytic Trimer Of Aspartate Transcarbamoylase Complexed With Bisubstrate Analog Pala (N-(Phosphonacetyl)-L-Aspartate) Length = 311 Back     alignment and structure
>pdb|1XJW|A Chain A, The Structure Of E. Coli Aspartate Transcarbamoylase Q137a Mutant In The R-State Length = 310 Back     alignment and structure
>pdb|1XJW|A Chain A, The Structure Of E. Coli Aspartate Transcarbamoylase Q137a Mutant In The R-State Length = 310 Back     alignment and structure
>pdb|1EZZ|A Chain A, Crystal Structure Of E. Coli Aspartate Transcarbamoylase P268a Mutant In The T-State Length = 310 Back     alignment and structure
>pdb|1EZZ|A Chain A, Crystal Structure Of E. Coli Aspartate Transcarbamoylase P268a Mutant In The T-State Length = 310 Back     alignment and structure
>pdb|2BE7|A Chain A, Crystal Structure Of The Unliganded (T-State) Aspartate Transcarbamoylase Of The Psychrophilic Bacterium Moritella Profunda Length = 326 Back     alignment and structure
>pdb|2BE7|A Chain A, Crystal Structure Of The Unliganded (T-State) Aspartate Transcarbamoylase Of The Psychrophilic Bacterium Moritella Profunda Length = 326 Back     alignment and structure
>pdb|2ATC|A Chain A, Crystal And Molecular Structures Of Native And Ctp-Liganded Aspartate Carbamoyltransferase From Escherichia Coli Length = 305 Back     alignment and structure
>pdb|2ATC|A Chain A, Crystal And Molecular Structures Of Native And Ctp-Liganded Aspartate Carbamoyltransferase From Escherichia Coli Length = 305 Back     alignment and structure
>pdb|1PG5|A Chain A, Crystal Structure Of The Unligated (t-state) Aspartate Transcarbamoylase From The Extremely Thermophilic Archaeon Sulfolobus Acidocaldarius Length = 299 Back     alignment and structure
>pdb|2BE9|A Chain A, Crystal Structure Of The Ctp-Liganded (T-State) Aspartate Transcarbamoylase From The Extremely Thermophilic Archaeon Sulfolobus Acidocaldarius Length = 300 Back     alignment and structure
>pdb|3LXM|A Chain A, 2.00 Angstrom Resolution Crystal Structure Of A Catalytic Subunit Of An Aspartate Carbamoyltransferase (Pyrb) From Yersinia Pestis Co92 Length = 335 Back     alignment and structure
>pdb|3LXM|A Chain A, 2.00 Angstrom Resolution Crystal Structure Of A Catalytic Subunit Of An Aspartate Carbamoyltransferase (Pyrb) From Yersinia Pestis Co92 Length = 335 Back     alignment and structure
>pdb|2RGW|A Chain A, Catalytic Subunit Of M. Jannaschii Aspartate Transcarbamoylase Length = 306 Back     alignment and structure
>pdb|2RGW|A Chain A, Catalytic Subunit Of M. Jannaschii Aspartate Transcarbamoylase Length = 306 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
3csu_A310 Protein (aspartate carbamoyltransferase); transfer 1e-33
3csu_A310 Protein (aspartate carbamoyltransferase); transfer 1e-33
1pg5_A299 Aspartate carbamoyltransferase; 2.60A {Sulfolobus 2e-32
1pg5_A299 Aspartate carbamoyltransferase; 2.60A {Sulfolobus 2e-32
1ml4_A308 Aspartate transcarbamoylase; beta pleated sheet, p 8e-32
1ml4_A308 Aspartate transcarbamoylase; beta pleated sheet, p 1e-31
4ekn_B306 Aspartate carbamoyltransferase; atcase, aspartate 2e-30
4ekn_B306 Aspartate carbamoyltransferase; atcase, aspartate 3e-30
3r7f_A304 Aspartate carbamoyltransferase; aspartate transcar 6e-10
3r7f_A304 Aspartate carbamoyltransferase; aspartate transcar 6e-10
3d6n_B291 Aspartate carbamoyltransferase; reactor, chamber, 1e-07
3d6n_B291 Aspartate carbamoyltransferase; reactor, chamber, 1e-07
2yfk_A418 Aspartate/ornithine carbamoyltransferase; transcar 6e-07
2yfk_A418 Aspartate/ornithine carbamoyltransferase; transcar 7e-07
3q98_A399 Transcarbamylase; rossmann fold, transferase; 2.00 1e-06
3q98_A399 Transcarbamylase; rossmann fold, transferase; 2.00 1e-06
3tpf_A307 Otcase, ornithine carbamoyltransferase; structural 2e-05
3tpf_A307 Otcase, ornithine carbamoyltransferase; structural 2e-05
4ep1_A340 Otcase, ornithine carbamoyltransferase; structural 3e-05
4ep1_A340 Otcase, ornithine carbamoyltransferase; structural 3e-05
1pvv_A315 Otcase, ornithine carbamoyltransferase; dodecamer; 6e-05
1pvv_A315 Otcase, ornithine carbamoyltransferase; dodecamer; 6e-05
1oth_A321 Protein (ornithine transcarbamoylase); transferase 6e-05
1oth_A321 Protein (ornithine transcarbamoylase); transferase 6e-05
3gd5_A323 Otcase, ornithine carbamoyltransferase; structural 6e-05
3gd5_A323 Otcase, ornithine carbamoyltransferase; structural 6e-05
1zq6_A359 Otcase, ornithine carbamoyltransferase; alpha/beta 7e-05
1zq6_A359 Otcase, ornithine carbamoyltransferase; alpha/beta 7e-05
4f2g_A309 Otcase 1, ornithine carbamoyltransferase 1; struct 1e-04
4f2g_A309 Otcase 1, ornithine carbamoyltransferase 1; struct 1e-04
2i6u_A307 Otcase, ornithine carbamoyltransferase; X-RAY crys 1e-04
2i6u_A307 Otcase, ornithine carbamoyltransferase; X-RAY crys 1e-04
2ef0_A301 Ornithine carbamoyltransferase; TTHA1199, thermus 2e-04
2ef0_A301 Ornithine carbamoyltransferase; TTHA1199, thermus 2e-04
4a8p_A355 Putrescine carbamoyltransferase; ornithine agmatin 5e-04
4a8p_A355 Putrescine carbamoyltransferase; ornithine agmatin 5e-04
3grf_A328 Ornithine carbamoyltransferase; ornithine transcar 6e-04
3grf_A328 Ornithine carbamoyltransferase; ornithine transcar 6e-04
>3csu_A Protein (aspartate carbamoyltransferase); transferase (carbamoyl-P; 1.88A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1r0b_A* 1q95_A* 1raa_A* 1rab_A* 1rac_A* 1rad_A* 1rae_A* 1raf_A* 1rag_A* 1rah_A* 1rai_A* 1r0c_A* 1za2_A* 1za1_A* 2fzc_A* 2fzg_A* 2fzk_A* 2h3e_A* 2ipo_A* 2qg9_A ... Length = 310 Back     alignment and structure
 Score =  119 bits (300), Expect = 1e-33
 Identities = 30/69 (43%), Positives = 41/69 (59%)

Query: 80  KSCGLYIVTPKIMTKAKSKMAVMHPLPRVFEIAPEFDSDPRAAYFRQAEYGMYVRMALLT 139
                +++    +  AK+ M V+HPLPRV EIA + D  P A YF+QA  G++ R ALL 
Sbjct: 242 NVKAQFVLRASDLHNAKANMKVLHPLPRVDEIATDVDKTPHAWYFQQAGNGIFARQALLA 301

Query: 140 MVLGRDSAL 148
           +VL RD  L
Sbjct: 302 LVLNRDLVL 310
>3csu_A Protein (aspartate carbamoyltransferase); transferase (carbamoyl-P; 1.88A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1r0b_A* 1q95_A* 1raa_A* 1rab_A* 1rac_A* 1rad_A* 1rae_A* 1raf_A* 1rag_A* 1rah_A* 1rai_A* 1r0c_A* 1za2_A* 1za1_A* 2fzc_A* 2fzg_A* 2fzk_A* 2h3e_A* 2ipo_A* 2qg9_A ... Length = 310 Back     alignment and structure
>1pg5_A Aspartate carbamoyltransferase; 2.60A {Sulfolobus acidocaldarius} SCOP: c.78.1.1 c.78.1.1 PDB: 2be9_A* Length = 299 Back     alignment and structure
>1pg5_A Aspartate carbamoyltransferase; 2.60A {Sulfolobus acidocaldarius} SCOP: c.78.1.1 c.78.1.1 PDB: 2be9_A* Length = 299 Back     alignment and structure
>1ml4_A Aspartate transcarbamoylase; beta pleated sheet, protein inhibitor complex, transferase; HET: PAL; 1.80A {Pyrococcus abyssi} SCOP: c.78.1.1 c.78.1.1 Length = 308 Back     alignment and structure
>1ml4_A Aspartate transcarbamoylase; beta pleated sheet, protein inhibitor complex, transferase; HET: PAL; 1.80A {Pyrococcus abyssi} SCOP: c.78.1.1 c.78.1.1 Length = 308 Back     alignment and structure
>4ekn_B Aspartate carbamoyltransferase; atcase, aspartate transcarbamoylase, pyrimidine biosynthesis thermostability, substrate channeling; 2.50A {Methanocaldococcus jannaschii} PDB: 3e2p_A 2rgw_A Length = 306 Back     alignment and structure
>4ekn_B Aspartate carbamoyltransferase; atcase, aspartate transcarbamoylase, pyrimidine biosynthesis thermostability, substrate channeling; 2.50A {Methanocaldococcus jannaschii} PDB: 3e2p_A 2rgw_A Length = 306 Back     alignment and structure
>3r7f_A Aspartate carbamoyltransferase; aspartate transcarbamoylase, carbamoyl phosphate, transferas catalytic cycle; 2.10A {Bacillus subtilis} PDB: 3r7d_A 3r7l_A* 2at2_A Length = 304 Back     alignment and structure
>3r7f_A Aspartate carbamoyltransferase; aspartate transcarbamoylase, carbamoyl phosphate, transferas catalytic cycle; 2.10A {Bacillus subtilis} PDB: 3r7d_A 3r7l_A* 2at2_A Length = 304 Back     alignment and structure
>3d6n_B Aspartate carbamoyltransferase; reactor, chamber, pores, internal cavity, hydrolase, metal-B pyrimidine biosynthesis, hydrolase-transferase; HET: FLC; 2.30A {Aquifex aeolicus} Length = 291 Back     alignment and structure
>3d6n_B Aspartate carbamoyltransferase; reactor, chamber, pores, internal cavity, hydrolase, metal-B pyrimidine biosynthesis, hydrolase-transferase; HET: FLC; 2.30A {Aquifex aeolicus} Length = 291 Back     alignment and structure
>2yfk_A Aspartate/ornithine carbamoyltransferase; transcarbamylase; 2.55A {Enterococcus faecalis} Length = 418 Back     alignment and structure
>2yfk_A Aspartate/ornithine carbamoyltransferase; transcarbamylase; 2.55A {Enterococcus faecalis} Length = 418 Back     alignment and structure
>3q98_A Transcarbamylase; rossmann fold, transferase; 2.00A {Escherichia coli} Length = 399 Back     alignment and structure
>3q98_A Transcarbamylase; rossmann fold, transferase; 2.00A {Escherichia coli} Length = 399 Back     alignment and structure
>3tpf_A Otcase, ornithine carbamoyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, rossman fold; 2.70A {Campylobacter jejuni subsp} Length = 307 Back     alignment and structure
>3tpf_A Otcase, ornithine carbamoyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, rossman fold; 2.70A {Campylobacter jejuni subsp} Length = 307 Back     alignment and structure
>4ep1_A Otcase, ornithine carbamoyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 3.25A {Bacillus anthracis} Length = 340 Back     alignment and structure
>4ep1_A Otcase, ornithine carbamoyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 3.25A {Bacillus anthracis} Length = 340 Back     alignment and structure
>1pvv_A Otcase, ornithine carbamoyltransferase; dodecamer; 1.87A {Pyrococcus furiosus} SCOP: c.78.1.1 c.78.1.1 PDB: 1a1s_A Length = 315 Back     alignment and structure
>1pvv_A Otcase, ornithine carbamoyltransferase; dodecamer; 1.87A {Pyrococcus furiosus} SCOP: c.78.1.1 c.78.1.1 PDB: 1a1s_A Length = 315 Back     alignment and structure
>1oth_A Protein (ornithine transcarbamoylase); transferase; HET: PAO; 1.85A {Homo sapiens} SCOP: c.78.1.1 c.78.1.1 PDB: 1ep9_A 1fvo_A 1c9y_A* 1fb5_A Length = 321 Back     alignment and structure
>1oth_A Protein (ornithine transcarbamoylase); transferase; HET: PAO; 1.85A {Homo sapiens} SCOP: c.78.1.1 c.78.1.1 PDB: 1ep9_A 1fvo_A 1c9y_A* 1fb5_A Length = 321 Back     alignment and structure
>3gd5_A Otcase, ornithine carbamoyltransferase; structural genomics, NYSGXRC, target 9454P, operon, amino-acid biosynthesis, ARGI biosynthesis; 2.10A {Gloeobacter violaceus} Length = 323 Back     alignment and structure
>3gd5_A Otcase, ornithine carbamoyltransferase; structural genomics, NYSGXRC, target 9454P, operon, amino-acid biosynthesis, ARGI biosynthesis; 2.10A {Gloeobacter violaceus} Length = 323 Back     alignment and structure
>4f2g_A Otcase 1, ornithine carbamoyltransferase 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Length = 309 Back     alignment and structure
>4f2g_A Otcase 1, ornithine carbamoyltransferase 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Length = 309 Back     alignment and structure
>2i6u_A Otcase, ornithine carbamoyltransferase; X-RAY crystallography, ornithine carbamyoltransferase, carbamoyl phosphate, L- norvaline; 2.20A {Mycobacterium tuberculosis} PDB: 2p2g_A Length = 307 Back     alignment and structure
>2i6u_A Otcase, ornithine carbamoyltransferase; X-RAY crystallography, ornithine carbamyoltransferase, carbamoyl phosphate, L- norvaline; 2.20A {Mycobacterium tuberculosis} PDB: 2p2g_A Length = 307 Back     alignment and structure
>2ef0_A Ornithine carbamoyltransferase; TTHA1199, thermus thermophil structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Length = 301 Back     alignment and structure
>2ef0_A Ornithine carbamoyltransferase; TTHA1199, thermus thermophil structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Length = 301 Back     alignment and structure
>4a8p_A Putrescine carbamoyltransferase; ornithine agmatine deiminase route; HET: PAO; 2.00A {Enterococcus faecalis} PDB: 4a8h_A* 3txx_A Length = 355 Back     alignment and structure
>4a8p_A Putrescine carbamoyltransferase; ornithine agmatine deiminase route; HET: PAO; 2.00A {Enterococcus faecalis} PDB: 4a8h_A* 3txx_A Length = 355 Back     alignment and structure
>3grf_A Ornithine carbamoyltransferase; ornithine transcarbamoylase, arginine degradation pathway, giardia lamblia, drug target; 2.00A {Giardia intestinalis} Length = 328 Back     alignment and structure
>3grf_A Ornithine carbamoyltransferase; ornithine transcarbamoylase, arginine degradation pathway, giardia lamblia, drug target; 2.00A {Giardia intestinalis} Length = 328 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query157
1pg5_A299 Aspartate carbamoyltransferase; 2.60A {Sulfolobus 99.92
1ml4_A308 Aspartate transcarbamoylase; beta pleated sheet, p 99.92
3csu_A310 Protein (aspartate carbamoyltransferase); transfer 99.92
4ekn_B306 Aspartate carbamoyltransferase; atcase, aspartate 99.91
4ep1_A340 Otcase, ornithine carbamoyltransferase; structural 99.91
3gd5_A323 Otcase, ornithine carbamoyltransferase; structural 99.9
2i6u_A307 Otcase, ornithine carbamoyltransferase; X-RAY crys 99.9
3r7f_A304 Aspartate carbamoyltransferase; aspartate transcar 99.9
4f2g_A309 Otcase 1, ornithine carbamoyltransferase 1; struct 99.9
2ef0_A301 Ornithine carbamoyltransferase; TTHA1199, thermus 99.9
1pvv_A315 Otcase, ornithine carbamoyltransferase; dodecamer; 99.9
1vlv_A325 Otcase, ornithine carbamoyltransferase; TM1097, st 99.89
3grf_A328 Ornithine carbamoyltransferase; ornithine transcar 99.89
1js1_X324 Transcarbamylase; alpha/beta topology, two domains 99.88
3tpf_A307 Otcase, ornithine carbamoyltransferase; structural 99.88
3kzn_A359 Aotcase, N-acetylornithine carbamoyltransferase; t 99.88
1zq6_A359 Otcase, ornithine carbamoyltransferase; alpha/beta 99.88
4a8t_A339 Putrescine carbamoyltransferase; trabnsferase PALO 99.88
3sds_A353 Ornithine carbamoyltransferase, mitochondrial; str 99.87
4a8p_A355 Putrescine carbamoyltransferase; ornithine agmatin 99.87
3d6n_B291 Aspartate carbamoyltransferase; reactor, chamber, 99.87
1dxh_A335 Ornithine carbamoyltransferase; transcarbamylase; 99.87
4h31_A358 Otcase, ornithine carbamoyltransferase; structural 99.87
1duv_G333 Octase-1, ornithine transcarbamoylase; enzyme-inhi 99.87
2w37_A359 Ornithine carbamoyltransferase, catabolic; transca 99.86
1oth_A321 Protein (ornithine transcarbamoylase); transferase 99.85
4amu_A365 Ornithine carbamoyltransferase, catabolic; ornithi 99.85
3q98_A399 Transcarbamylase; rossmann fold, transferase; 2.00 99.81
2yfk_A418 Aspartate/ornithine carbamoyltransferase; transcar 99.8
1pg5_A299 Aspartate carbamoyltransferase; 2.60A {Sulfolobus 99.73
1ml4_A308 Aspartate transcarbamoylase; beta pleated sheet, p 99.73
3csu_A310 Protein (aspartate carbamoyltransferase); transfer 99.72
2i6u_A307 Otcase, ornithine carbamoyltransferase; X-RAY crys 99.71
3r7f_A304 Aspartate carbamoyltransferase; aspartate transcar 99.7
1pvv_A315 Otcase, ornithine carbamoyltransferase; dodecamer; 99.7
4f2g_A309 Otcase 1, ornithine carbamoyltransferase 1; struct 99.7
2ef0_A301 Ornithine carbamoyltransferase; TTHA1199, thermus 99.7
3gd5_A323 Otcase, ornithine carbamoyltransferase; structural 99.7
3tpf_A307 Otcase, ornithine carbamoyltransferase; structural 99.69
3grf_A328 Ornithine carbamoyltransferase; ornithine transcar 99.69
4ep1_A340 Otcase, ornithine carbamoyltransferase; structural 99.69
1vlv_A325 Otcase, ornithine carbamoyltransferase; TM1097, st 99.68
4ekn_B306 Aspartate carbamoyltransferase; atcase, aspartate 99.67
4a8t_A339 Putrescine carbamoyltransferase; trabnsferase PALO 99.67
4a8p_A355 Putrescine carbamoyltransferase; ornithine agmatin 99.66
1zq6_A359 Otcase, ornithine carbamoyltransferase; alpha/beta 99.66
1oth_A321 Protein (ornithine transcarbamoylase); transferase 99.66
1duv_G333 Octase-1, ornithine transcarbamoylase; enzyme-inhi 99.66
1dxh_A335 Ornithine carbamoyltransferase; transcarbamylase; 99.65
3kzn_A359 Aotcase, N-acetylornithine carbamoyltransferase; t 99.65
4h31_A358 Otcase, ornithine carbamoyltransferase; structural 99.64
4amu_A365 Ornithine carbamoyltransferase, catabolic; ornithi 99.64
2w37_A359 Ornithine carbamoyltransferase, catabolic; transca 99.63
3sds_A353 Ornithine carbamoyltransferase, mitochondrial; str 99.63
1js1_X324 Transcarbamylase; alpha/beta topology, two domains 99.62
3d6n_B291 Aspartate carbamoyltransferase; reactor, chamber, 99.61
3q98_A399 Transcarbamylase; rossmann fold, transferase; 2.00 99.59
2yfk_A418 Aspartate/ornithine carbamoyltransferase; transcar 99.56
>1pg5_A Aspartate carbamoyltransferase; 2.60A {Sulfolobus acidocaldarius} SCOP: c.78.1.1 c.78.1.1 PDB: 2be9_A* Back     alignment and structure
Probab=99.92  E-value=6.3e-27  Score=192.43  Aligned_cols=113  Identities=28%  Similarity=0.445  Sum_probs=92.8

Q ss_pred             CCCeEEeCCCCceeeecc----------cccCCchhhhhhhhhhhHHHHHHHHHHHhccccccccCCCCCccCCccccCH
Q psy4400          20 KSKMAVMHPLPRVFEIAP----------EFDSDPRAAYFRQAEYGMYVRMALLTMVLGRDSALTYSNTPKKSCGLYIVTP   89 (157)
Q Consensus        20 ~~~~~vmHplPr~~Ei~~----------~V~~~~~s~i~~QA~n~~~~RmAll~~ll~~~~~~~~~~ey~~~~~~~~l~~   89 (157)
                      +.++.+.+  |.+++.+.          .+.+++..++ ++||..+..|++.++        +++.++|.+.+.+|+||.
T Consensus       176 g~~v~~~~--P~~~~~~~~~~~~~g~~~~~~~d~~eav-~~aDvvyt~~~q~er--------~~~~~~~~~~~~~y~v~~  244 (299)
T 1pg5_A          176 PKLVYLIS--PQLLRARKEILDELNYPVKEVENPFEVI-NEVDVLYVTRIQKER--------FVDEMEYEKIKGSYIVSL  244 (299)
T ss_dssp             CSEEEEEC--CGGGCCCHHHHTTCCSCEEEESCGGGTG-GGCSEEEEECCCSTT--------SSCHHHHHHHGGGGSBCH
T ss_pred             CCEEEEEC--CchhcCCHHHHHHcCCeEEEeCCHHHHh-cCCCEEEeCCccccc--------ccCHHHHHHhhcCcccCH
Confidence            56666644  44554432          2457787774 999999888774332        344567877788899999


Q ss_pred             HHHhccCCCcEEeCCCCCccccCccccCCCCchhHHHHhhcHHHHHHHHHHHhc
Q psy4400          90 KIMTKAKSKMAVMHPLPRVFEIAPEFDSDPRAAYFRQAEYGMYVRMALLTMVLG  143 (157)
Q Consensus        90 e~l~~~~~~~~vmHplPR~~Ei~~~v~~~~~s~~~~Qa~n~~~~rmAll~~ll~  143 (157)
                      ++|+.++++++||||||||.||+++|+++|+|.||+||+||+|+|||||+++++
T Consensus       245 ~~l~~a~~~ai~mH~lPrg~EI~~eV~d~p~s~vf~QaeNrl~~r~AlL~~ll~  298 (299)
T 1pg5_A          245 DLANKMKKDSIILHPLPRVNEIDRKVDKTTKAKYFEQASYGVPVRMSILTKIYG  298 (299)
T ss_dssp             HHHHTSCTTCEEECCSCCSSSBCGGGGGSTTBCHHHHHHHHHHHHHHHHHHHHC
T ss_pred             HHHHhcCCCCEEECCCCCCCccCHHHhCCcccHHHHHHHhCHHHHHHHHHHHhc
Confidence            999999999999999999999999999999999999999999999999999986
>1ml4_A Aspartate transcarbamoylase; beta pleated sheet, protein inhibitor complex, transferase; HET: PAL; 1.80A {Pyrococcus abyssi} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>3csu_A Protein (aspartate carbamoyltransferase); transferase (carbamoyl-P; 1.88A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1r0b_A* 1q95_A* 1raa_A* 1rab_A* 1rac_A* 1rad_A* 1rae_A* 1raf_A* 1rag_A* 1rah_A* 1rai_A* 1r0c_A* 1za2_A* 1za1_A* 2fzc_A* 2fzg_A* 2fzk_A* 2h3e_A* 2ipo_A* 2qg9_A ... Back     alignment and structure
>4ekn_B Aspartate carbamoyltransferase; atcase, aspartate transcarbamoylase, pyrimidine biosynthesis thermostability, substrate channeling; 2.50A {Methanocaldococcus jannaschii} PDB: 3e2p_A 2rgw_A Back     alignment and structure
>4ep1_A Otcase, ornithine carbamoyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 3.25A {Bacillus anthracis} Back     alignment and structure
>3gd5_A Otcase, ornithine carbamoyltransferase; structural genomics, NYSGXRC, target 9454P, operon, amino-acid biosynthesis, ARGI biosynthesis; 2.10A {Gloeobacter violaceus} Back     alignment and structure
>2i6u_A Otcase, ornithine carbamoyltransferase; X-RAY crystallography, ornithine carbamyoltransferase, carbamoyl phosphate, L- norvaline; 2.20A {Mycobacterium tuberculosis} PDB: 2p2g_A Back     alignment and structure
>3r7f_A Aspartate carbamoyltransferase; aspartate transcarbamoylase, carbamoyl phosphate, transferas catalytic cycle; 2.10A {Bacillus subtilis} PDB: 3r7d_A 3r7l_A* 2at2_A Back     alignment and structure
>4f2g_A Otcase 1, ornithine carbamoyltransferase 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>2ef0_A Ornithine carbamoyltransferase; TTHA1199, thermus thermophil structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>1pvv_A Otcase, ornithine carbamoyltransferase; dodecamer; 1.87A {Pyrococcus furiosus} SCOP: c.78.1.1 c.78.1.1 PDB: 1a1s_A Back     alignment and structure
>1vlv_A Otcase, ornithine carbamoyltransferase; TM1097, structural genomics, protein structure initiative, PSI, joint center for structu genomics; 2.25A {Thermotoga maritima} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>3grf_A Ornithine carbamoyltransferase; ornithine transcarbamoylase, arginine degradation pathway, giardia lamblia, drug target; 2.00A {Giardia intestinalis} Back     alignment and structure
>1js1_X Transcarbamylase; alpha/beta topology, two domains, transferase; 2.00A {Bacteroides fragilis} SCOP: c.78.1.1 c.78.1.1 PDB: 2fg6_X* 2fg7_X* 2g7m_X* Back     alignment and structure
>3tpf_A Otcase, ornithine carbamoyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, rossman fold; 2.70A {Campylobacter jejuni subsp} Back     alignment and structure
>3kzn_A Aotcase, N-acetylornithine carbamoyltransferase; transcarbamylase, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: KCX AOR; 1.80A {Xanthomonas campestris PV} PDB: 3kzc_A* 3kzm_A* 3kzk_A* 3kzo_A* 3m4j_A* 3m5d_A* 3m5c_A* 3l05_A* 3l02_A* 3m4n_A* 3l06_A* 3l04_A* Back     alignment and structure
>4a8t_A Putrescine carbamoyltransferase; trabnsferase PALO, delta-N-(phosphonoacetyl)-L- ornithine, agmatine deiminase route, agmatine catabolism; HET: PAO PGE; 1.59A {Enterococcus faecalis} Back     alignment and structure
>3sds_A Ornithine carbamoyltransferase, mitochondrial; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.80A {Coccidioides immitis} Back     alignment and structure
>4a8p_A Putrescine carbamoyltransferase; ornithine agmatine deiminase route; HET: PAO; 2.00A {Enterococcus faecalis} PDB: 4a8h_A* 3txx_A Back     alignment and structure
>3d6n_B Aspartate carbamoyltransferase; reactor, chamber, pores, internal cavity, hydrolase, metal-B pyrimidine biosynthesis, hydrolase-transferase; HET: FLC; 2.30A {Aquifex aeolicus} Back     alignment and structure
>1dxh_A Ornithine carbamoyltransferase; transcarbamylase; 2.50A {Pseudomonas aeruginosa} SCOP: c.78.1.1 c.78.1.1 PDB: 1ort_A Back     alignment and structure
>4h31_A Otcase, ornithine carbamoyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PE5; 1.70A {Vibrio vulnificus} PDB: 3upd_A* Back     alignment and structure
>1duv_G Octase-1, ornithine transcarbamoylase; enzyme-inhibitor complex, transferase; HET: PSQ; 1.70A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1akm_A* 2otc_A* Back     alignment and structure
>2w37_A Ornithine carbamoyltransferase, catabolic; transcarbamylase, metal binding-site, hexamer, cytoplasm, arginine metabolism; 2.10A {Lactobacillus hilgardii} Back     alignment and structure
>1oth_A Protein (ornithine transcarbamoylase); transferase; HET: PAO; 1.85A {Homo sapiens} SCOP: c.78.1.1 c.78.1.1 PDB: 1ep9_A 1fvo_A 1c9y_A* 1fb5_A Back     alignment and structure
>4amu_A Ornithine carbamoyltransferase, catabolic; ornithine transcarbamoylase, hydrolase; 2.50A {Mycoplasma penetrans} PDB: 4anf_A Back     alignment and structure
>3q98_A Transcarbamylase; rossmann fold, transferase; 2.00A {Escherichia coli} Back     alignment and structure
>2yfk_A Aspartate/ornithine carbamoyltransferase; transcarbamylase; 2.55A {Enterococcus faecalis} Back     alignment and structure
>1pg5_A Aspartate carbamoyltransferase; 2.60A {Sulfolobus acidocaldarius} SCOP: c.78.1.1 c.78.1.1 PDB: 2be9_A* Back     alignment and structure
>1ml4_A Aspartate transcarbamoylase; beta pleated sheet, protein inhibitor complex, transferase; HET: PAL; 1.80A {Pyrococcus abyssi} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>3csu_A Protein (aspartate carbamoyltransferase); transferase (carbamoyl-P; 1.88A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1r0b_A* 1q95_A* 1raa_A* 1rab_A* 1rac_A* 1rad_A* 1rae_A* 1raf_A* 1rag_A* 1rah_A* 1rai_A* 1r0c_A* 1za2_A* 1za1_A* 2fzc_A* 2fzg_A* 2fzk_A* 2h3e_A* 2ipo_A* 2qg9_A ... Back     alignment and structure
>2i6u_A Otcase, ornithine carbamoyltransferase; X-RAY crystallography, ornithine carbamyoltransferase, carbamoyl phosphate, L- norvaline; 2.20A {Mycobacterium tuberculosis} PDB: 2p2g_A Back     alignment and structure
>3r7f_A Aspartate carbamoyltransferase; aspartate transcarbamoylase, carbamoyl phosphate, transferas catalytic cycle; 2.10A {Bacillus subtilis} PDB: 3r7d_A 3r7l_A* 2at2_A Back     alignment and structure
>1pvv_A Otcase, ornithine carbamoyltransferase; dodecamer; 1.87A {Pyrococcus furiosus} SCOP: c.78.1.1 c.78.1.1 PDB: 1a1s_A Back     alignment and structure
>4f2g_A Otcase 1, ornithine carbamoyltransferase 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>2ef0_A Ornithine carbamoyltransferase; TTHA1199, thermus thermophil structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>3gd5_A Otcase, ornithine carbamoyltransferase; structural genomics, NYSGXRC, target 9454P, operon, amino-acid biosynthesis, ARGI biosynthesis; 2.10A {Gloeobacter violaceus} Back     alignment and structure
>3tpf_A Otcase, ornithine carbamoyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, rossman fold; 2.70A {Campylobacter jejuni subsp} Back     alignment and structure
>3grf_A Ornithine carbamoyltransferase; ornithine transcarbamoylase, arginine degradation pathway, giardia lamblia, drug target; 2.00A {Giardia intestinalis} Back     alignment and structure
>4ep1_A Otcase, ornithine carbamoyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 3.25A {Bacillus anthracis} Back     alignment and structure
>1vlv_A Otcase, ornithine carbamoyltransferase; TM1097, structural genomics, protein structure initiative, PSI, joint center for structu genomics; 2.25A {Thermotoga maritima} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>4ekn_B Aspartate carbamoyltransferase; atcase, aspartate transcarbamoylase, pyrimidine biosynthesis thermostability, substrate channeling; 2.50A {Methanocaldococcus jannaschii} PDB: 3e2p_A 2rgw_A Back     alignment and structure
>4a8t_A Putrescine carbamoyltransferase; trabnsferase PALO, delta-N-(phosphonoacetyl)-L- ornithine, agmatine deiminase route, agmatine catabolism; HET: PAO PGE; 1.59A {Enterococcus faecalis} Back     alignment and structure
>4a8p_A Putrescine carbamoyltransferase; ornithine agmatine deiminase route; HET: PAO; 2.00A {Enterococcus faecalis} PDB: 4a8h_A* 3txx_A Back     alignment and structure
>1oth_A Protein (ornithine transcarbamoylase); transferase; HET: PAO; 1.85A {Homo sapiens} SCOP: c.78.1.1 c.78.1.1 PDB: 1ep9_A 1fvo_A 1c9y_A* 1fb5_A Back     alignment and structure
>1duv_G Octase-1, ornithine transcarbamoylase; enzyme-inhibitor complex, transferase; HET: PSQ; 1.70A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1akm_A* 2otc_A* Back     alignment and structure
>1dxh_A Ornithine carbamoyltransferase; transcarbamylase; 2.50A {Pseudomonas aeruginosa} SCOP: c.78.1.1 c.78.1.1 PDB: 1ort_A Back     alignment and structure
>3kzn_A Aotcase, N-acetylornithine carbamoyltransferase; transcarbamylase, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: KCX AOR; 1.80A {Xanthomonas campestris PV} PDB: 3kzc_A* 3kzm_A* 3kzk_A* 3kzo_A* 3m4j_A* 3m5d_A* 3m5c_A* 3l05_A* 3l02_A* 3m4n_A* 3l06_A* 3l04_A* Back     alignment and structure
>4h31_A Otcase, ornithine carbamoyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PE5; 1.70A {Vibrio vulnificus} PDB: 3upd_A* Back     alignment and structure
>4amu_A Ornithine carbamoyltransferase, catabolic; ornithine transcarbamoylase, hydrolase; 2.50A {Mycoplasma penetrans} PDB: 4anf_A Back     alignment and structure
>2w37_A Ornithine carbamoyltransferase, catabolic; transcarbamylase, metal binding-site, hexamer, cytoplasm, arginine metabolism; 2.10A {Lactobacillus hilgardii} Back     alignment and structure
>3sds_A Ornithine carbamoyltransferase, mitochondrial; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.80A {Coccidioides immitis} Back     alignment and structure
>1js1_X Transcarbamylase; alpha/beta topology, two domains, transferase; 2.00A {Bacteroides fragilis} SCOP: c.78.1.1 c.78.1.1 PDB: 2fg6_X* 2fg7_X* 2g7m_X* Back     alignment and structure
>3d6n_B Aspartate carbamoyltransferase; reactor, chamber, pores, internal cavity, hydrolase, metal-B pyrimidine biosynthesis, hydrolase-transferase; HET: FLC; 2.30A {Aquifex aeolicus} Back     alignment and structure
>3q98_A Transcarbamylase; rossmann fold, transferase; 2.00A {Escherichia coli} Back     alignment and structure
>2yfk_A Aspartate/ornithine carbamoyltransferase; transcarbamylase; 2.55A {Enterococcus faecalis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 157
d1ml4a2157 c.78.1.1 (A:152-308) Aspartate carbamoyltransferas 2e-20
d1ml4a2157 c.78.1.1 (A:152-308) Aspartate carbamoyltransferas 1e-19
d1tuga1310 c.78.1.1 (A:1-150,A:151-310) Aspartate carbamoyltr 2e-20
d1tuga1310 c.78.1.1 (A:1-150,A:151-310) Aspartate carbamoyltr 2e-20
d1ekxa2160 c.78.1.1 (A:151-310) Aspartate carbamoyltransferas 2e-18
d1ekxa2160 c.78.1.1 (A:151-310) Aspartate carbamoyltransferas 2e-18
d1pg5a2153 c.78.1.1 (A:147-299) Aspartate carbamoyltransferas 4e-17
d1pg5a2153 c.78.1.1 (A:147-299) Aspartate carbamoyltransferas 4e-17
d1pvva2163 c.78.1.1 (A:151-313) Ornithine transcarbamoylase { 4e-14
d1otha2170 c.78.1.1 (A:185-354) Ornithine transcarbamoylase { 1e-13
d1otha2170 c.78.1.1 (A:185-354) Ornithine transcarbamoylase { 4e-13
d1vlva2161 c.78.1.1 (A:153-313) Ornithine transcarbamoylase { 4e-13
d1vlva2161 c.78.1.1 (A:153-313) Ornithine transcarbamoylase { 4e-13
d1dxha2185 c.78.1.1 (A:151-335) Ornithine transcarbamoylase { 7e-12
d1dxha2185 c.78.1.1 (A:151-335) Ornithine transcarbamoylase { 4e-10
d1duvg2183 c.78.1.1 (G:151-333) Ornithine transcarbamoylase { 1e-11
d1duvg2183 c.78.1.1 (G:151-333) Ornithine transcarbamoylase { 1e-11
d1js1x2161 c.78.1.1 (X:164-324) Transcarbamylase-like protein 4e-10
d1js1x2161 c.78.1.1 (X:164-324) Transcarbamylase-like protein 7e-10
>d1ml4a2 c.78.1.1 (A:152-308) Aspartate carbamoyltransferase catalytic subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 157 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ATC-like
superfamily: Aspartate/ornithine carbamoyltransferase
family: Aspartate/ornithine carbamoyltransferase
domain: Aspartate carbamoyltransferase catalytic subunit
species: Archaeon Pyrococcus abyssi [TaxId: 29292]

 Score = 80.3 bits (197), Expect = 2e-20
 Identities = 35/70 (50%), Positives = 43/70 (61%)

Query: 74  YSNTPKKSCGLYIVTPKIMTKAKSKMAVMHPLPRVFEIAPEFDSDPRAAYFRQAEYGMYV 133
                 K  G Y V  K++ KAK ++ +MHPLPRV EI PE D+   A YFRQ   G+ V
Sbjct: 86  DEQEYLKVKGSYQVNLKVLEKAKDELRIMHPLPRVDEIHPEVDNTKHAIYFRQVFNGVPV 145

Query: 134 RMALLTMVLG 143
           RMALL +VLG
Sbjct: 146 RMALLALVLG 155
>d1ml4a2 c.78.1.1 (A:152-308) Aspartate carbamoyltransferase catalytic subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 157 Back     information, alignment and structure
>d1tuga1 c.78.1.1 (A:1-150,A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Length = 310 Back     information, alignment and structure
>d1tuga1 c.78.1.1 (A:1-150,A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Length = 310 Back     information, alignment and structure
>d1ekxa2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Length = 160 Back     information, alignment and structure
>d1ekxa2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Length = 160 Back     information, alignment and structure
>d1pg5a2 c.78.1.1 (A:147-299) Aspartate carbamoyltransferase catalytic subunit {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 153 Back     information, alignment and structure
>d1pg5a2 c.78.1.1 (A:147-299) Aspartate carbamoyltransferase catalytic subunit {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 153 Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 163 Back     information, alignment and structure
>d1otha2 c.78.1.1 (A:185-354) Ornithine transcarbamoylase {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1otha2 c.78.1.1 (A:185-354) Ornithine transcarbamoylase {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} Length = 161 Back     information, alignment and structure
>d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} Length = 161 Back     information, alignment and structure
>d1dxha2 c.78.1.1 (A:151-335) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]} Length = 185 Back     information, alignment and structure
>d1dxha2 c.78.1.1 (A:151-335) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]} Length = 185 Back     information, alignment and structure
>d1duvg2 c.78.1.1 (G:151-333) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]} Length = 183 Back     information, alignment and structure
>d1duvg2 c.78.1.1 (G:151-333) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]} Length = 183 Back     information, alignment and structure
>d1js1x2 c.78.1.1 (X:164-324) Transcarbamylase-like protein {Bacteroides fragilis [TaxId: 817]} Length = 161 Back     information, alignment and structure
>d1js1x2 c.78.1.1 (X:164-324) Transcarbamylase-like protein {Bacteroides fragilis [TaxId: 817]} Length = 161 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query157
d1pg5a2153 Aspartate carbamoyltransferase catalytic subunit { 99.93
d1ml4a2157 Aspartate carbamoyltransferase catalytic subunit { 99.92
d1pvva2163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 99.92
d1ekxa2160 Aspartate carbamoyltransferase catalytic subunit { 99.92
d2at2a2151 Aspartate carbamoyltransferase catalytic subunit { 99.91
d1js1x2161 Transcarbamylase-like protein {Bacteroides fragili 99.9
d1vlva2161 Ornithine transcarbamoylase {Thermotoga maritima [ 99.88
d1tuga1310 Aspartate carbamoyltransferase catalytic subunit { 99.88
d1dxha2185 Ornithine transcarbamoylase {Pseudomonas aeruginos 99.87
d1duvg2183 Ornithine transcarbamoylase {Escherichia coli [Tax 99.86
d1otha2170 Ornithine transcarbamoylase {Human (Homo sapiens) 99.85
d1pg5a2153 Aspartate carbamoyltransferase catalytic subunit { 99.81
d1ml4a2157 Aspartate carbamoyltransferase catalytic subunit { 99.77
d1pvva2163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 99.77
d1ekxa2160 Aspartate carbamoyltransferase catalytic subunit { 99.77
d2at2a2151 Aspartate carbamoyltransferase catalytic subunit { 99.74
d1otha2170 Ornithine transcarbamoylase {Human (Homo sapiens) 99.7
d1js1x2161 Transcarbamylase-like protein {Bacteroides fragili 99.69
d1tuga1310 Aspartate carbamoyltransferase catalytic subunit { 99.69
d1vlva2161 Ornithine transcarbamoylase {Thermotoga maritima [ 99.63
d1duvg2183 Ornithine transcarbamoylase {Escherichia coli [Tax 99.62
d1dxha2185 Ornithine transcarbamoylase {Pseudomonas aeruginos 99.62
>d1pg5a2 c.78.1.1 (A:147-299) Aspartate carbamoyltransferase catalytic subunit {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ATC-like
superfamily: Aspartate/ornithine carbamoyltransferase
family: Aspartate/ornithine carbamoyltransferase
domain: Aspartate carbamoyltransferase catalytic subunit
species: Archaeon Sulfolobus acidocaldarius [TaxId: 2285]

Probab=99.93  E-value=5.2e-28  Score=179.33  Aligned_cols=98  Identities=32%  Similarity=0.471  Sum_probs=81.6

Q ss_pred             cccCCchhhhhhhhhhhHHHHHHHHHHHhccccccccCCCCCccCCccccCHHHHhccCCCcEEeCCCCCccccCccccC
Q psy4400          38 EFDSDPRAAYFRQAEYGMYVRMALLTMVLGRDSALTYSNTPKKSCGLYIVTPKIMTKAKSKMAVMHPLPRVFEIAPEFDS  117 (157)
Q Consensus        38 ~V~~~~~s~i~~QA~n~~~~RmAll~~ll~~~~~~~~~~ey~~~~~~~~l~~e~l~~~~~~~~vmHplPR~~Ei~~~v~~  117 (157)
                      .+.+++..++ ++||..+..|.+.+        ...+..++.+.+..|++|.++++.++++++||||||||.||+++|++
T Consensus        56 ~~~~d~~eai-~~aDvvy~~~~q~~--------~~~~~~~~~~~~~~y~v~~~~l~~~~~~~i~mH~LPR~~EI~~~v~~  126 (153)
T d1pg5a2          56 KEVENPFEVI-NEVDVLYVTRIQKE--------RFVDEMEYEKIKGSYIVSLDLANKMKKDSIILHPLPRVNEIDRKVDK  126 (153)
T ss_dssp             EEESCGGGTG-GGCSEEEEECCCST--------TSSCHHHHHHHGGGGSBCHHHHHTSCTTCEEECCSCCSSSBCGGGGG
T ss_pred             EEEeCHHHHh-hcCCeEEEeeeeeh--------hccchhHHHHHHHhhhhhHHHHhccCCCeEEecCCCCcCCcchhhcc
Confidence            4556777774 88998776665422        12233445566778999999999999999999999999999999999


Q ss_pred             CCCchhHHHHhhcHHHHHHHHHHHhcC
Q psy4400         118 DPRAAYFRQAEYGMYVRMALLTMVLGR  144 (157)
Q Consensus       118 ~~~s~~~~Qa~n~~~~rmAll~~ll~~  144 (157)
                      +|+|+||+||+||+|+|||||++|||.
T Consensus       127 ~~~s~v~~Qa~Nrl~~rmAlL~~llg~  153 (153)
T d1pg5a2         127 TTKAKYFEQASYGVPVRMSILTKIYGE  153 (153)
T ss_dssp             STTBCHHHHHHHHHHHHHHHHHHHHCC
T ss_pred             CcccHHHHHHHcCHHHHHHHHHHHhCC
Confidence            999999999999999999999999984
>d1ml4a2 c.78.1.1 (A:152-308) Aspartate carbamoyltransferase catalytic subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ekxa2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2at2a2 c.78.1.1 (A:145-295) Aspartate carbamoyltransferase catalytic subunit {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1js1x2 c.78.1.1 (X:164-324) Transcarbamylase-like protein {Bacteroides fragilis [TaxId: 817]} Back     information, alignment and structure
>d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tuga1 c.78.1.1 (A:1-150,A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxha2 c.78.1.1 (A:151-335) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1duvg2 c.78.1.1 (G:151-333) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1otha2 c.78.1.1 (A:185-354) Ornithine transcarbamoylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pg5a2 c.78.1.1 (A:147-299) Aspartate carbamoyltransferase catalytic subunit {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1ml4a2 c.78.1.1 (A:152-308) Aspartate carbamoyltransferase catalytic subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ekxa2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2at2a2 c.78.1.1 (A:145-295) Aspartate carbamoyltransferase catalytic subunit {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1otha2 c.78.1.1 (A:185-354) Ornithine transcarbamoylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1js1x2 c.78.1.1 (X:164-324) Transcarbamylase-like protein {Bacteroides fragilis [TaxId: 817]} Back     information, alignment and structure
>d1tuga1 c.78.1.1 (A:1-150,A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1duvg2 c.78.1.1 (G:151-333) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxha2 c.78.1.1 (A:151-335) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure