Psyllid ID: psy4403
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 101 | ||||||
| 242005452 | 409 | tRNA-dihydrouridine synthase, putative [ | 0.950 | 0.234 | 0.618 | 1e-26 | |
| 91082415 | 455 | PREDICTED: similar to tRNA-dihydrouridin | 0.950 | 0.210 | 0.597 | 2e-25 | |
| 328787042 | 460 | PREDICTED: tRNA-dihydrouridine synthase | 0.950 | 0.208 | 0.628 | 1e-24 | |
| 380016047 | 460 | PREDICTED: tRNA-dihydrouridine(20) synth | 0.950 | 0.208 | 0.628 | 1e-24 | |
| 350412745 | 467 | PREDICTED: tRNA-dihydrouridine synthase | 0.950 | 0.205 | 0.628 | 1e-24 | |
| 345479115 | 465 | PREDICTED: tRNA-dihydrouridine synthase | 0.950 | 0.206 | 0.587 | 3e-24 | |
| 340720499 | 450 | PREDICTED: tRNA-dihydrouridine synthase | 0.950 | 0.213 | 0.618 | 3e-24 | |
| 307169925 | 467 | tRNA-dihydrouridine synthase 2-like [Cam | 0.950 | 0.205 | 0.587 | 6e-24 | |
| 383849955 | 467 | PREDICTED: tRNA-dihydrouridine(20) synth | 0.950 | 0.205 | 0.597 | 2e-23 | |
| 357623751 | 438 | putative tRNA-dihydrouridine synthase [D | 0.950 | 0.219 | 0.587 | 3e-23 |
| >gi|242005452|ref|XP_002423579.1| tRNA-dihydrouridine synthase, putative [Pediculus humanus corporis] gi|212506727|gb|EEB10841.1| tRNA-dihydrouridine synthase, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 123 bits (309), Expect = 1e-26, Method: Composition-based stats.
Identities = 60/97 (61%), Positives = 76/97 (78%), Gaps = 1/97 (1%)
Query: 4 SGGSKEIVDYGGILKFKADTNASSVMIARAAQDNCSIFSPTKGIQDIHQMIKEYLRYCVD 63
+GGSKEI +Y ILKFK T SS+M+ARAA+ NCS+FS KG DI +IK+YL+Y +D
Sbjct: 169 NGGSKEIDNYNDILKFKEATGCSSIMLARAAEWNCSVFS-NKGKVDIDTIIKQYLKYAID 227
Query: 64 YDNSAPNSKYCVQSMLGSQQESPLGKKFLESQTLEQI 100
YDNS NSKYC+Q++L QE+P GKKFLE+QT+EQI
Sbjct: 228 YDNSPANSKYCIQNILKELQETPRGKKFLEAQTMEQI 264
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|91082415|ref|XP_970120.1| PREDICTED: similar to tRNA-dihydrouridine synthase [Tribolium castaneum] gi|270007514|gb|EFA03962.1| hypothetical protein TcasGA2_TC014107 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|328787042|ref|XP_393745.3| PREDICTED: tRNA-dihydrouridine synthase 2-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380016047|ref|XP_003692004.1| PREDICTED: tRNA-dihydrouridine(20) synthase [NAD(P)+]-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|350412745|ref|XP_003489746.1| PREDICTED: tRNA-dihydrouridine synthase 2-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|345479115|ref|XP_001602214.2| PREDICTED: tRNA-dihydrouridine synthase 2-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|340720499|ref|XP_003398674.1| PREDICTED: tRNA-dihydrouridine synthase 2-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|307169925|gb|EFN62434.1| tRNA-dihydrouridine synthase 2-like [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|383849955|ref|XP_003700598.1| PREDICTED: tRNA-dihydrouridine(20) synthase [NAD(P)+]-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|357623751|gb|EHJ74777.1| putative tRNA-dihydrouridine synthase [Danaus plexippus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 101 | ||||||
| FB|FBgn0030554 | 473 | CG1434 [Drosophila melanogaste | 0.950 | 0.202 | 0.536 | 3.5e-22 | |
| ZFIN|ZDB-GENE-100922-233 | 504 | dus2l "dihydrouridine synthase | 0.950 | 0.190 | 0.438 | 7e-15 | |
| UNIPROTKB|E7EUN9 | 458 | DUS2L "tRNA-dihydrouridine(20) | 0.950 | 0.209 | 0.428 | 6.9e-14 | |
| UNIPROTKB|Q9NX74 | 493 | DUS2L "tRNA-dihydrouridine(20) | 0.950 | 0.194 | 0.428 | 8.1e-14 | |
| UNIPROTKB|E1C4F6 | 493 | DUS2L "Uncharacterized protein | 0.950 | 0.194 | 0.428 | 1.7e-13 | |
| UNIPROTKB|E2RKU2 | 493 | DUS2L "Uncharacterized protein | 0.950 | 0.194 | 0.418 | 4.6e-13 | |
| UNIPROTKB|Q0VC60 | 493 | DUS2L "Uncharacterized protein | 0.950 | 0.194 | 0.428 | 6e-13 | |
| MGI|MGI:1913619 | 493 | Dus2l "dihydrouridine synthase | 0.950 | 0.194 | 0.418 | 6e-13 | |
| RGD|1305612 | 493 | Dus2l "dihydrouridine synthase | 0.950 | 0.194 | 0.418 | 6e-13 | |
| UNIPROTKB|I3LES5 | 493 | DUS2L "Uncharacterized protein | 0.950 | 0.194 | 0.418 | 7.6e-13 |
| FB|FBgn0030554 CG1434 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 263 (97.6 bits), Expect = 3.5e-22, P = 3.5e-22
Identities = 52/97 (53%), Positives = 72/97 (74%)
Query: 4 SGGSKEIVDYGGILKFKADTNASSVMIARAAQDNCSIFSPTKGIQDIHQMIKEYLRYCVD 63
+GGSK + Y + KF+ + A SVM+ARAAQ N SIF P +G+ + ++I++YLR CVD
Sbjct: 227 NGGSKNMHCYDDLRKFQMECGADSVMVARAAQINVSIFRP-EGLLPMDELIEKYLRLCVD 285
Query: 64 YDNSAPNSKYCVQSMLGSQQESPLGKKFLESQTLEQI 100
YDN+ N+KYCVQS+L QE+P GK+FL+ QTL+QI
Sbjct: 286 YDNAPHNAKYCVQSILRELQETPRGKRFLQCQTLQQI 322
|
|
| ZFIN|ZDB-GENE-100922-233 dus2l "dihydrouridine synthase 2-like, SMM1 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7EUN9 DUS2L "tRNA-dihydrouridine(20) synthase [NAD(P)+]-like" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9NX74 DUS2L "tRNA-dihydrouridine(20) synthase [NAD(P)+]-like" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C4F6 DUS2L "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RKU2 DUS2L "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0VC60 DUS2L "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1913619 Dus2l "dihydrouridine synthase 2-like (SMM1, S. cerevisiae)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1305612 Dus2l "dihydrouridine synthase 2-like, SMM1 homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LES5 DUS2L "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 101 | |||
| cd02801 | 231 | cd02801, DUS_like_FMN, Dihydrouridine synthase-lik | 3e-04 |
| >gnl|CDD|239200 cd02801, DUS_like_FMN, Dihydrouridine synthase-like (DUS-like) FMN-binding domain | Back alignment and domain information |
|---|
Score = 37.5 bits (88), Expect = 3e-04
Identities = 11/41 (26%), Positives = 16/41 (39%)
Query: 9 EIVDYGGILKFKADTNASSVMIARAAQDNCSIFSPTKGIQD 49
+I L+ T VMI R A N +F K + +
Sbjct: 191 DIFSLEDALRCLEQTGVDGVMIGRGALGNPWLFREIKELLE 231
|
Members of this family catalyze the reduction of the 5,6-double bond of a uridine residue on tRNA. Dihydrouridine modification of tRNA is widely observed in prokaryotes and eukaryotes, and also in some archaea. Most dihydrouridines are found in the D loop of t-RNAs. The role of dihydrouridine in tRNA is currently unknown, but may increase conformational flexibility of the tRNA. It is likely that different family members have different substrate specificities, which may overlap. 1VHN, a putative flavin oxidoreductase, has high sequence similarity to DUS. The enzymatic mechanism of 1VHN is not known at the present. Length = 231 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 101 | |||
| PRK10550 | 312 | tRNA-dihydrouridine synthase C; Provisional | 99.87 | |
| PRK10415 | 321 | tRNA-dihydrouridine synthase B; Provisional | 99.86 | |
| COG0042 | 323 | tRNA-dihydrouridine synthase [Translation, ribosom | 99.85 | |
| KOG2335|consensus | 358 | 99.8 | ||
| PF01207 | 309 | Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 | 99.8 | |
| TIGR00742 | 318 | yjbN tRNA dihydrouridine synthase A. Members of th | 99.78 | |
| TIGR00737 | 319 | nifR3_yhdG putative TIM-barrel protein, nifR3 fami | 99.76 | |
| KOG2334|consensus | 477 | 99.69 | ||
| PRK11815 | 333 | tRNA-dihydrouridine synthase A; Provisional | 99.68 | |
| KOG2333|consensus | 614 | 99.5 | ||
| cd02911 | 233 | arch_FMN Archeal FMN-binding domain. This family o | 99.17 | |
| cd02801 | 231 | DUS_like_FMN Dihydrouridine synthase-like (DUS-lik | 98.99 | |
| TIGR00736 | 231 | nifR3_rel_arch TIM-barrel protein, putative. Membe | 98.87 | |
| TIGR01037 | 300 | pyrD_sub1_fam dihydroorotate dehydrogenase (subfam | 98.79 | |
| cd04734 | 343 | OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN | 98.71 | |
| cd04741 | 294 | DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c | 98.58 | |
| cd04740 | 296 | DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c | 98.48 | |
| cd02810 | 289 | DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) | 98.38 | |
| PRK07259 | 301 | dihydroorotate dehydrogenase 1B; Reviewed | 98.34 | |
| cd02931 | 382 | ER_like_FMN Enoate reductase (ER)-like FMN-binding | 98.34 | |
| cd02929 | 370 | TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) | 98.32 | |
| PRK13523 | 337 | NADPH dehydrogenase NamA; Provisional | 98.31 | |
| cd02930 | 353 | DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin | 98.3 | |
| cd04733 | 338 | OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN | 98.26 | |
| cd02940 | 299 | DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM | 98.26 | |
| PRK08255 | 765 | salicylyl-CoA 5-hydroxylase; Reviewed | 98.19 | |
| cd02803 | 327 | OYE_like_FMN_family Old yellow enzyme (OYE)-like F | 98.17 | |
| cd04738 | 327 | DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl | 98.16 | |
| cd04735 | 353 | OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN | 98.15 | |
| PRK05286 | 344 | dihydroorotate dehydrogenase 2; Reviewed | 98.14 | |
| cd02933 | 338 | OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind | 98.07 | |
| PRK14024 | 241 | phosphoribosyl isomerase A; Provisional | 98.07 | |
| PRK08318 | 420 | dihydropyrimidine dehydrogenase subunit B; Validat | 98.05 | |
| cd02932 | 336 | OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN | 97.96 | |
| cd04747 | 361 | OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN | 97.95 | |
| PRK00748 | 233 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 97.89 | |
| PRK02083 | 253 | imidazole glycerol phosphate synthase subunit HisF | 97.81 | |
| PRK07565 | 334 | dihydroorotate dehydrogenase 2; Reviewed | 97.8 | |
| cd04732 | 234 | HisA HisA. Phosphoribosylformimino-5-aminoimidazol | 97.79 | |
| cd04739 | 325 | DHOD_like Dihydroorotate dehydrogenase (DHOD) like | 97.74 | |
| TIGR00007 | 230 | phosphoribosylformimino-5-aminoimidazole carboxami | 97.73 | |
| cd04731 | 243 | HisF The cyclase subunit of imidazoleglycerol phos | 97.65 | |
| cd04731 | 243 | HisF The cyclase subunit of imidazoleglycerol phos | 97.58 | |
| cd02809 | 299 | alpha_hydroxyacid_oxid_FMN Family of homologous FM | 97.5 | |
| PRK13585 | 241 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 97.48 | |
| cd04732 | 234 | HisA HisA. Phosphoribosylformimino-5-aminoimidazol | 97.27 | |
| PRK01033 | 258 | imidazole glycerol phosphate synthase subunit HisF | 97.24 | |
| TIGR00735 | 254 | hisF imidazoleglycerol phosphate synthase, cyclase | 97.24 | |
| PRK02083 | 253 | imidazole glycerol phosphate synthase subunit HisF | 97.17 | |
| TIGR02708 | 367 | L_lactate_ox L-lactate oxidase. Members of this pr | 97.05 | |
| TIGR03572 | 232 | WbuZ glycosyl amidation-associated protein WbuZ. T | 96.76 | |
| PRK04180 | 293 | pyridoxal biosynthesis lyase PdxS; Provisional | 96.74 | |
| cd04737 | 351 | LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d | 96.68 | |
| TIGR00735 | 254 | hisF imidazoleglycerol phosphate synthase, cyclase | 96.44 | |
| TIGR00343 | 287 | pyridoxal 5'-phosphate synthase, synthase subunit | 96.34 | |
| PF00724 | 341 | Oxidored_FMN: NADH:flavin oxidoreductase / NADH ox | 96.29 | |
| cd04727 | 283 | pdxS PdxS is a subunit of the pyridoxal 5'-phospha | 96.26 | |
| PRK08649 | 368 | inosine 5-monophosphate dehydrogenase; Validated | 96.26 | |
| PRK10605 | 362 | N-ethylmaleimide reductase; Provisional | 96.25 | |
| PRK13585 | 241 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 96.25 | |
| TIGR01304 | 369 | IMP_DH_rel_2 IMP dehydrogenase family protein. Thi | 96.12 | |
| TIGR02151 | 333 | IPP_isom_2 isopentenyl-diphosphate delta-isomerase | 96.07 | |
| cd04729 | 219 | NanE N-acetylmannosamine-6-phosphate epimerase (Na | 95.94 | |
| cd00381 | 325 | IMPDH IMPDH: The catalytic domain of the inosine m | 95.94 | |
| PRK05458 | 326 | guanosine 5'-monophosphate oxidoreductase; Provisi | 95.84 | |
| PRK02506 | 310 | dihydroorotate dehydrogenase 1A; Reviewed | 95.83 | |
| cd04730 | 236 | NPD_like 2-Nitropropane dioxygenase (NPD), one of | 95.78 | |
| TIGR03572 | 232 | WbuZ glycosyl amidation-associated protein WbuZ. T | 95.48 | |
| PRK04128 | 228 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 95.47 | |
| PRK01130 | 221 | N-acetylmannosamine-6-phosphate 2-epimerase; Provi | 95.43 | |
| TIGR03151 | 307 | enACPred_II putative enoyl-(acyl-carrier-protein) | 95.38 | |
| TIGR01036 | 335 | pyrD_sub2 dihydroorotate dehydrogenase, subfamily | 95.02 | |
| PLN02411 | 391 | 12-oxophytodienoate reductase | 94.54 | |
| PRK05437 | 352 | isopentenyl pyrophosphate isomerase; Provisional | 94.38 | |
| TIGR01306 | 321 | GMP_reduct_2 guanosine monophosphate reductase, ba | 94.3 | |
| COG0167 | 310 | PyrD Dihydroorotate dehydrogenase [Nucleotide tran | 94.22 | |
| cd04728 | 248 | ThiG Thiazole synthase (ThiG) is the tetrameric en | 94.09 | |
| COG1902 | 363 | NemA NADH:flavin oxidoreductases, Old Yellow Enzym | 94.09 | |
| PRK00208 | 250 | thiG thiazole synthase; Reviewed | 94.05 | |
| PRK00748 | 233 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 94.01 | |
| cd00331 | 217 | IGPS Indole-3-glycerol phosphate synthase (IGPS); | 93.96 | |
| cd02811 | 326 | IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di | 93.92 | |
| PRK01033 | 258 | imidazole glycerol phosphate synthase subunit HisF | 93.56 | |
| PRK07695 | 201 | transcriptional regulator TenI; Provisional | 93.21 | |
| PF01180 | 295 | DHO_dh: Dihydroorotate dehydrogenase; InterPro: IP | 93.16 | |
| COG0106 | 241 | HisA Phosphoribosylformimino-5-aminoimidazole carb | 93.0 | |
| PLN02495 | 385 | oxidoreductase, acting on the CH-CH group of donor | 92.88 | |
| TIGR01919 | 243 | hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy | 92.85 | |
| COG0106 | 241 | HisA Phosphoribosylformimino-5-aminoimidazole carb | 92.71 | |
| PRK00278 | 260 | trpC indole-3-glycerol-phosphate synthase; Reviewe | 92.71 | |
| TIGR01304 | 369 | IMP_DH_rel_2 IMP dehydrogenase family protein. Thi | 92.62 | |
| PRK04128 | 228 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 92.58 | |
| PRK14024 | 241 | phosphoribosyl isomerase A; Provisional | 92.52 | |
| cd02812 | 219 | PcrB_like PcrB_like proteins. One member of this f | 92.44 | |
| COG0107 | 256 | HisF Imidazoleglycerol-phosphate synthase [Amino a | 92.41 | |
| PRK13587 | 234 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 92.4 | |
| PF00218 | 254 | IGPS: Indole-3-glycerol phosphate synthase; InterP | 92.24 | |
| TIGR00734 | 221 | hisAF_rel hisA/hisF family protein. This alignment | 92.05 | |
| KOG1606|consensus | 296 | 91.93 | ||
| PRK13586 | 232 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 91.65 | |
| PRK14114 | 241 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 91.52 | |
| PRK06843 | 404 | inosine 5-monophosphate dehydrogenase; Validated | 91.52 | |
| TIGR01768 | 223 | GGGP-family geranylgeranylglyceryl phosphate synth | 91.52 | |
| TIGR00007 | 230 | phosphoribosylformimino-5-aminoimidazole carboxami | 91.48 | |
| PLN02460 | 338 | indole-3-glycerol-phosphate synthase | 91.4 | |
| COG0134 | 254 | TrpC Indole-3-glycerol phosphate synthase [Amino a | 91.23 | |
| PLN02535 | 364 | glycolate oxidase | 91.16 | |
| PRK13586 | 232 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 91.09 | |
| cd04723 | 233 | HisA_HisF Phosphoribosylformimino-5-aminoimidazole | 90.98 | |
| PLN02826 | 409 | dihydroorotate dehydrogenase | 90.69 | |
| PRK13957 | 247 | indole-3-glycerol-phosphate synthase; Provisional | 89.99 | |
| PRK08649 | 368 | inosine 5-monophosphate dehydrogenase; Validated | 89.63 | |
| TIGR01919 | 243 | hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy | 89.42 | |
| PF00977 | 229 | His_biosynth: Histidine biosynthesis protein; Inte | 89.27 | |
| PRK06739 | 352 | pyruvate kinase; Validated | 89.25 | |
| PRK13587 | 234 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 89.11 | |
| PRK04302 | 223 | triosephosphate isomerase; Provisional | 88.68 | |
| cd02808 | 392 | GltS_FMN Glutamate synthase (GltS) FMN-binding dom | 88.65 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 88.49 | |
| PRK04169 | 232 | geranylgeranylglyceryl phosphate synthase-like pro | 87.6 | |
| cd04736 | 361 | MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin | 87.53 | |
| cd02922 | 344 | FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom | 87.47 | |
| PF00977 | 229 | His_biosynth: Histidine biosynthesis protein; Inte | 87.26 | |
| PRK14114 | 241 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 87.17 | |
| PRK13802 | 695 | bifunctional indole-3-glycerol phosphate synthase/ | 87.0 | |
| PRK09427 | 454 | bifunctional indole-3-glycerol phosphate synthase/ | 86.42 | |
| PRK14725 | 608 | pyruvate kinase; Provisional | 86.19 | |
| PRK14567 | 253 | triosephosphate isomerase; Provisional | 85.87 | |
| PF00478 | 352 | IMPDH: IMP dehydrogenase / GMP reductase domain; I | 85.85 | |
| PRK11197 | 381 | lldD L-lactate dehydrogenase; Provisional | 85.56 | |
| cd03332 | 383 | LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin | 85.44 | |
| PLN02461 | 511 | Probable pyruvate kinase | 85.36 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 85.33 | |
| TIGR00734 | 221 | hisAF_rel hisA/hisF family protein. This alignment | 84.98 | |
| PTZ00066 | 513 | pyruvate kinase; Provisional | 84.91 | |
| PLN02762 | 509 | pyruvate kinase complex alpha subunit | 84.86 | |
| PLN02446 | 262 | (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy | 84.75 | |
| PLN02979 | 366 | glycolate oxidase | 84.37 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 84.07 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 83.85 | |
| PLN02765 | 526 | pyruvate kinase | 83.77 | |
| PLN02446 | 262 | (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy | 83.68 | |
| COG1304 | 360 | idi Isopentenyl diphosphate isomerase (BS_ypgA, MT | 83.37 | |
| COG0214 | 296 | SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme meta | 82.81 | |
| KOG2334|consensus | 477 | 82.61 | ||
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 82.59 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 82.08 | |
| PLN02493 | 367 | probable peroxisomal (S)-2-hydroxy-acid oxidase | 81.79 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 81.78 | |
| TIGR02129 | 253 | hisA_euk phosphoribosylformimino-5-aminoimidazole | 80.25 |
| >PRK10550 tRNA-dihydrouridine synthase C; Provisional | Back alignment and domain information |
|---|
Probab=99.87 E-value=3.6e-22 Score=147.35 Aligned_cols=97 Identities=20% Similarity=0.160 Sum_probs=79.7
Q ss_pred CccCCCCCCCCCHHHHHHHHHhcCCCeeeeecccccCCCccCCCCC---CCCHHH---HHHHHHHHHHHhcCCC---CcH
Q psy4403 1 MDPSGGSKEIVDYGGILKFKADTNASSVMIARAAQDNCSIFSPTKG---IQDIHQ---MIKEYLRYCVDYDNSA---PNS 71 (101)
Q Consensus 1 ~~aNGgsGDI~s~~d~~~~~~~tg~dgvMigRgAl~nP~iF~~~~~---~~~~~~---~~~~~l~~~~~~~~~~---~~~ 71 (101)
+++|| ||+|++|++++++.||||+||||||+++|||||+++.. ..++.+ ++.+|+++..++.... ..+
T Consensus 197 Vi~nG---dI~t~~da~~~l~~~g~DgVmiGRg~l~nP~lf~~~~~g~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~ 273 (312)
T PRK10550 197 VIANG---EIWDWQSAQQCMAITGCDAVMIGRGALNIPNLSRVVKYNEPRMPWPEVVALLQKYTRLEKQGDTGLYHVARI 273 (312)
T ss_pred EEEeC---CcCCHHHHHHHHhccCCCEEEEcHHhHhCcHHHHHhhcCCCCCCHHHHHHHHHHHHHHHHhcCcchhHHHHH
Confidence 46788 99999999999999999999999999999999998632 234544 4677777655554322 226
Q ss_pred HHHHHhhhCCCCC-hHHHHHHHhcCChhhh
Q psy4403 72 KYCVQSMLGSQQE-SPLGKKFLESQTLEQI 100 (101)
Q Consensus 72 k~~l~~~~~~~~~-~~~~~~i~~~~~~~e~ 100 (101)
|.++.+|++++++ +++|+++.+++|++|+
T Consensus 274 rk~~~~y~~~~~~~~~~r~~i~~~~~~~e~ 303 (312)
T PRK10550 274 KQWLGYLRKEYDEATELFQEIRALNNSPDI 303 (312)
T ss_pred HHHHHHHHhcCCcHHHHHHHHHcCCCHHHH
Confidence 8999999999999 9999999999999986
|
|
| >PRK10415 tRNA-dihydrouridine synthase B; Provisional | Back alignment and domain information |
|---|
| >COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG2335|consensus | Back alignment and domain information |
|---|
| >PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA | Back alignment and domain information |
|---|
| >TIGR00742 yjbN tRNA dihydrouridine synthase A | Back alignment and domain information |
|---|
| >TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family | Back alignment and domain information |
|---|
| >KOG2334|consensus | Back alignment and domain information |
|---|
| >PRK11815 tRNA-dihydrouridine synthase A; Provisional | Back alignment and domain information |
|---|
| >KOG2333|consensus | Back alignment and domain information |
|---|
| >cd02911 arch_FMN Archeal FMN-binding domain | Back alignment and domain information |
|---|
| >cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain | Back alignment and domain information |
|---|
| >TIGR00736 nifR3_rel_arch TIM-barrel protein, putative | Back alignment and domain information |
|---|
| >TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein | Back alignment and domain information |
|---|
| >cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 | Back alignment and domain information |
|---|
| >cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain | Back alignment and domain information |
|---|
| >cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain | Back alignment and domain information |
|---|
| >cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain | Back alignment and domain information |
|---|
| >PRK07259 dihydroorotate dehydrogenase 1B; Reviewed | Back alignment and domain information |
|---|
| >cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain | Back alignment and domain information |
|---|
| >cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain | Back alignment and domain information |
|---|
| >PRK13523 NADPH dehydrogenase NamA; Provisional | Back alignment and domain information |
|---|
| >cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain | Back alignment and domain information |
|---|
| >cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 | Back alignment and domain information |
|---|
| >cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain | Back alignment and domain information |
|---|
| >PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed | Back alignment and domain information |
|---|
| >cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain | Back alignment and domain information |
|---|
| >cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 | Back alignment and domain information |
|---|
| >cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 | Back alignment and domain information |
|---|
| >PRK05286 dihydroorotate dehydrogenase 2; Reviewed | Back alignment and domain information |
|---|
| >cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain | Back alignment and domain information |
|---|
| >PRK14024 phosphoribosyl isomerase A; Provisional | Back alignment and domain information |
|---|
| >PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated | Back alignment and domain information |
|---|
| >cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain | Back alignment and domain information |
|---|
| >cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 | Back alignment and domain information |
|---|
| >PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated | Back alignment and domain information |
|---|
| >PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional | Back alignment and domain information |
|---|
| >PRK07565 dihydroorotate dehydrogenase 2; Reviewed | Back alignment and domain information |
|---|
| >cd04732 HisA HisA | Back alignment and domain information |
|---|
| >cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins | Back alignment and domain information |
|---|
| >TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase | Back alignment and domain information |
|---|
| >cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) | Back alignment and domain information |
|---|
| >cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) | Back alignment and domain information |
|---|
| >cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes | Back alignment and domain information |
|---|
| >PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04732 HisA HisA | Back alignment and domain information |
|---|
| >PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional | Back alignment and domain information |
|---|
| >TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit | Back alignment and domain information |
|---|
| >PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional | Back alignment and domain information |
|---|
| >TIGR02708 L_lactate_ox L-lactate oxidase | Back alignment and domain information |
|---|
| >TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ | Back alignment and domain information |
|---|
| >PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional | Back alignment and domain information |
|---|
| >cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain | Back alignment and domain information |
|---|
| >TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit | Back alignment and domain information |
|---|
| >TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 | Back alignment and domain information |
|---|
| >PF00724 Oxidored_FMN: NADH:flavin oxidoreductase / NADH oxidase family; InterPro: IPR001155 The TIM-barrel fold is a closed barrel structure composed of an eight-fold repeat of beta-alpha units, where the eight parallel beta strands on the inside are covered by the eight alpha helices on the outside [] | Back alignment and domain information |
|---|
| >cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa | Back alignment and domain information |
|---|
| >PRK08649 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK10605 N-ethylmaleimide reductase; Provisional | Back alignment and domain information |
|---|
| >PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 | Back alignment and domain information |
|---|
| >cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate | Back alignment and domain information |
|---|
| >cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK02506 dihydroorotate dehydrogenase 1A; Reviewed | Back alignment and domain information |
|---|
| >cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites | Back alignment and domain information |
|---|
| >TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ | Back alignment and domain information |
|---|
| >PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional | Back alignment and domain information |
|---|
| >TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II | Back alignment and domain information |
|---|
| >TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2 | Back alignment and domain information |
|---|
| >PLN02411 12-oxophytodienoate reductase | Back alignment and domain information |
|---|
| >PRK05437 isopentenyl pyrophosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial | Back alignment and domain information |
|---|
| >COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism | Back alignment and domain information |
|---|
| >COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK00208 thiG thiazole synthase; Reviewed | Back alignment and domain information |
|---|
| >PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated | Back alignment and domain information |
|---|
| >cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water | Back alignment and domain information |
|---|
| >cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain | Back alignment and domain information |
|---|
| >PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional | Back alignment and domain information |
|---|
| >PRK07695 transcriptional regulator TenI; Provisional | Back alignment and domain information |
|---|
| >PF01180 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IPR012135 Dihydroorotate dehydrogenase (DHOD), also known as dihydroorotate oxidase, catalyses the fourth step in de novo pyrimidine biosynthesis, the stereospecific oxidation of (S)-dihydroorotate to orotate, which is the only redox reaction in this pathway | Back alignment and domain information |
|---|
| >COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02495 oxidoreductase, acting on the CH-CH group of donors | Back alignment and domain information |
|---|
| >TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase | Back alignment and domain information |
|---|
| >COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK14024 phosphoribosyl isomerase A; Provisional | Back alignment and domain information |
|---|
| >cd02812 PcrB_like PcrB_like proteins | Back alignment and domain information |
|---|
| >COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4 | Back alignment and domain information |
|---|
| >TIGR00734 hisAF_rel hisA/hisF family protein | Back alignment and domain information |
|---|
| >KOG1606|consensus | Back alignment and domain information |
|---|
| >PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK06843 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein | Back alignment and domain information |
|---|
| >TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase | Back alignment and domain information |
|---|
| >PLN02460 indole-3-glycerol-phosphate synthase | Back alignment and domain information |
|---|
| >COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02535 glycolate oxidase | Back alignment and domain information |
|---|
| >PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) | Back alignment and domain information |
|---|
| >PLN02826 dihydroorotate dehydrogenase | Back alignment and domain information |
|---|
| >PRK13957 indole-3-glycerol-phosphate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK08649 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase | Back alignment and domain information |
|---|
| >PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes | Back alignment and domain information |
|---|
| >PRK06739 pyruvate kinase; Validated | Back alignment and domain information |
|---|
| >PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK04302 triosephosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd02808 GltS_FMN Glutamate synthase (GltS) FMN-binding domain | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed | Back alignment and domain information |
|---|
| >cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain | Back alignment and domain information |
|---|
| >cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain | Back alignment and domain information |
|---|
| >PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes | Back alignment and domain information |
|---|
| >PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK14725 pyruvate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14567 triosephosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase | Back alignment and domain information |
|---|
| >PRK11197 lldD L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain | Back alignment and domain information |
|---|
| >PLN02461 Probable pyruvate kinase | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00734 hisAF_rel hisA/hisF family protein | Back alignment and domain information |
|---|
| >PTZ00066 pyruvate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02762 pyruvate kinase complex alpha subunit | Back alignment and domain information |
|---|
| >PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase | Back alignment and domain information |
|---|
| >PLN02979 glycolate oxidase | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02765 pyruvate kinase | Back alignment and domain information |
|---|
| >PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase | Back alignment and domain information |
|---|
| >COG1304 idi Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 and related proteins) [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >COG0214 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG2334|consensus | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 101 | |||
| 1vhn_A | 318 | Putative flavin oxidoreducatase; structural genomi | 99.69 | |
| 3b0p_A | 350 | TRNA-dihydrouridine synthase; TIM barrel, oxidored | 99.64 | |
| 3kru_A | 343 | NADH:flavin oxidoreductase/NADH oxidase; homotetra | 98.45 | |
| 4ef8_A | 354 | Dihydroorotate dehydrogenase; phenyl isothiocyanat | 98.43 | |
| 1icp_A | 376 | OPR1, 12-oxophytodienoate reductase 1; beta-alpha- | 98.41 | |
| 2hsa_B | 402 | 12-oxophytodienoate reductase 3; alpha beta 8 barr | 98.4 | |
| 3oix_A | 345 | Putative dihydroorotate dehydrogenase; dihydrooro | 98.39 | |
| 3o07_A | 291 | Pyridoxine biosynthesis protein SNZ1; (beta/alpha) | 98.39 | |
| 3k30_A | 690 | Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi | 98.37 | |
| 2y88_A | 244 | Phosphoribosyl isomerase A; aromatic amino acid bi | 98.36 | |
| 3tdn_A | 247 | FLR symmetric alpha-beta TIM barrel; symmetric sup | 98.36 | |
| 2r14_A | 377 | Morphinone reductase; H-tunnelling, flavoprotein, | 98.36 | |
| 3gr7_A | 340 | NADPH dehydrogenase; flavin, FMN, beta-alpha-barre | 98.36 | |
| 1jub_A | 311 | Dihydroorotate dehydrogenase A; homodimer, alpha-b | 98.35 | |
| 1vyr_A | 364 | Pentaerythritol tetranitrate reductase; oxidoreduc | 98.35 | |
| 1f76_A | 336 | Dihydroorotate dehydrogenase; monomer, alpha-beta- | 98.34 | |
| 1z41_A | 338 | YQJM, probable NADH-dependent flavin oxidoreductas | 98.34 | |
| 2e6f_A | 314 | Dihydroorotate dehydrogenase; chagas disease, pyri | 98.33 | |
| 2gou_A | 365 | Oxidoreductase, FMN-binding; OLD yeallow enzyme, f | 98.32 | |
| 4ab4_A | 362 | Xenobiotic reductase B; oxidoreductase, OLD yellow | 98.31 | |
| 2agk_A | 260 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me | 98.3 | |
| 3gka_A | 361 | N-ethylmaleimide reductase; decode biostructures, | 98.27 | |
| 3aty_A | 379 | Tcoye, prostaglandin F2A synthase; alpha/beta barr | 98.23 | |
| 3zwt_A | 367 | Dihydroorotate dehydrogenase (quinone), mitochond; | 98.21 | |
| 1o94_A | 729 | Tmadh, trimethylamine dehydrogenase; electron tran | 98.2 | |
| 3l5a_A | 419 | NADH/flavin oxidoreductase/NADH oxidase; OLD yello | 98.14 | |
| 3hgj_A | 349 | Chromate reductase; TIM barrel, oxidoreductase; HE | 98.14 | |
| 1ep3_A | 311 | Dihydroorotate dehydrogenase B (PYRD subunit); het | 98.13 | |
| 3l5l_A | 363 | Xenobiotic reductase A; TIM barrel, oxidoreductase | 98.1 | |
| 1jvn_A | 555 | Glutamine, bifunctional histidine biosynthesis pro | 98.1 | |
| 1vzw_A | 244 | Phosphoribosyl isomerase A; histidine biosynthesis | 98.1 | |
| 3i65_A | 415 | Dihydroorotate dehydrogenase homolog, mitochondria | 98.1 | |
| 3tjl_A | 407 | NADPH dehydrogenase; OLD yellow enzyme, flavin mon | 98.03 | |
| 1ka9_F | 252 | Imidazole glycerol phosphtate synthase; riken stru | 98.01 | |
| 1ps9_A | 671 | 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel | 98.0 | |
| 2w6r_A | 266 | Imidazole glycerol phosphate synthase subunit HISF | 97.99 | |
| 1tv5_A | 443 | Dhodehase, dihydroorotate dehydrogenase homolog, m | 97.91 | |
| 1thf_D | 253 | HISF protein; thermophIle, TIM-barrel, histidine b | 97.86 | |
| 3tjx_A | 354 | Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh | 97.79 | |
| 1qo2_A | 241 | Molecule: N-((5-phosphoribosyl)-formimino)-5-amino | 97.7 | |
| 2yzr_A | 330 | Pyridoxal biosynthesis lyase PDXS; redox protein, | 97.67 | |
| 2nli_A | 368 | Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid | 97.55 | |
| 3tdn_A | 247 | FLR symmetric alpha-beta TIM barrel; symmetric sup | 97.47 | |
| 1gte_A | 1025 | Dihydropyrimidine dehydrogenase; electron transfer | 97.39 | |
| 3q58_A | 229 | N-acetylmannosamine-6-phosphate 2-epimerase; TIM b | 97.35 | |
| 2nzl_A | 392 | Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G | 97.31 | |
| 1vcf_A | 332 | Isopentenyl-diphosphate delta-isomerase; TIM barre | 97.29 | |
| 1qo2_A | 241 | Molecule: N-((5-phosphoribosyl)-formimino)-5-amino | 97.26 | |
| 3igs_A | 232 | N-acetylmannosamine-6-phosphate 2-epimerase 2; ene | 97.16 | |
| 1kbi_A | 511 | Cytochrome B2, L-LCR; flavocytochrome B2, electron | 97.14 | |
| 1h5y_A | 253 | HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py | 97.1 | |
| 3sgz_A | 352 | Hydroxyacid oxidase 2; flavoprotein, homology, INH | 97.02 | |
| 2nv1_A | 305 | Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b | 96.93 | |
| 1ypf_A | 336 | GMP reductase; GUAC, purines, pyrimidines, nucleos | 96.91 | |
| 3cwo_X | 237 | Beta/alpha-barrel protein based on 1THF and 1TMY; | 96.9 | |
| 1p4c_A | 380 | L(+)-mandelate dehydrogenase; TIM barrel, hydroxy | 96.9 | |
| 1eep_A | 404 | Inosine 5'-monophosphate dehydrogenase; alpha-beta | 96.86 | |
| 1gox_A | 370 | (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu | 96.83 | |
| 1p0k_A | 349 | Isopentenyl-diphosphate delta-isomerase; terpene b | 96.82 | |
| 1thf_D | 253 | HISF protein; thermophIle, TIM-barrel, histidine b | 96.8 | |
| 2qr6_A | 393 | IMP dehydrogenase/GMP reductase; NP_599840.1, G re | 96.57 | |
| 2z6i_A | 332 | Trans-2-enoyl-ACP reductase II; fatty acid synthes | 96.57 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 96.49 | |
| 3r2g_A | 361 | Inosine 5'-monophosphate dehydrogenase; structural | 96.44 | |
| 3bw2_A | 369 | 2-nitropropane dioxygenase; TIM barrel, oxidoreduc | 96.36 | |
| 4a3u_A | 358 | NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET | 96.35 | |
| 2y88_A | 244 | Phosphoribosyl isomerase A; aromatic amino acid bi | 96.17 | |
| 3sr7_A | 365 | Isopentenyl-diphosphate delta-isomerase; isopenten | 96.17 | |
| 1ka9_F | 252 | Imidazole glycerol phosphtate synthase; riken stru | 96.17 | |
| 1h5y_A | 253 | HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py | 96.12 | |
| 1y0e_A | 223 | Putative N-acetylmannosamine-6-phosphate 2-epimer; | 96.11 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 95.96 | |
| 1vzw_A | 244 | Phosphoribosyl isomerase A; histidine biosynthesis | 95.89 | |
| 1yxy_A | 234 | Putative N-acetylmannosamine-6-phosphate 2-epimer; | 95.89 | |
| 2gjl_A | 328 | Hypothetical protein PA1024; 2-nitropropane dioxyg | 95.87 | |
| 3vkj_A | 368 | Isopentenyl-diphosphate delta-isomerase; type 2 is | 95.82 | |
| 2zbt_A | 297 | Pyridoxal biosynthesis lyase PDXS; pyridoxine bios | 95.77 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 95.77 | |
| 3khj_A | 361 | Inosine-5-monophosphate dehydrogenase; enzyme-inhi | 95.76 | |
| 2qjg_A | 273 | Putative aldolase MJ0400; beta-alpha barrel, lyase | 95.6 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 95.58 | |
| 3bo9_A | 326 | Putative nitroalkan dioxygenase; TM0800, structura | 95.51 | |
| 3ffs_A | 400 | Inosine-5-monophosphate dehydrogenase; beta-alpha | 95.5 | |
| 3vzx_A | 228 | Heptaprenylglyceryl phosphate synthase; biosynthes | 94.99 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 94.93 | |
| 4fo4_A | 366 | Inosine 5'-monophosphate dehydrogenase; structural | 94.75 | |
| 1viz_A | 240 | PCRB protein homolog; structural genomics, unknown | 94.68 | |
| 3vk5_A | 286 | MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {S | 94.67 | |
| 4adt_A | 297 | Pyridoxine biosynthetic enzyme PDX1 homologue, PU; | 94.52 | |
| 1vc4_A | 254 | Indole-3-glycerol phosphate synthase; lyase, trypt | 94.36 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 94.25 | |
| 2w6r_A | 266 | Imidazole glycerol phosphate synthase subunit HISF | 93.97 | |
| 2f6u_A | 234 | GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy | 93.82 | |
| 3w01_A | 235 | Heptaprenylglyceryl phosphate synthase; biosynthes | 93.71 | |
| 4gbu_A | 400 | NADPH dehydrogenase 1; alpha/beta barrel, enenone | 93.64 | |
| 1wv2_A | 265 | Thiazole moeity, thiazole biosynthesis protein THI | 93.0 | |
| 4a29_A | 258 | Engineered retro-aldol enzyme RA95.0; de novo prot | 92.73 | |
| 1yad_A | 221 | Regulatory protein TENI; TIM barrel, transcription | 92.69 | |
| 4gj1_A | 243 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me | 92.49 | |
| 3tsm_A | 272 | IGPS, indole-3-glycerol phosphate synthase; struct | 92.35 | |
| 3qja_A | 272 | IGPS, indole-3-glycerol phosphate synthase; struct | 91.1 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 91.02 | |
| 2c6q_A | 351 | GMP reductase 2; TIM barrel, metal-binding, NADP, | 91.01 | |
| 1xi3_A | 215 | Thiamine phosphate pyrophosphorylase; structural g | 90.32 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 90.03 | |
| 1mzh_A | 225 | Deoxyribose-phosphate aldolase; alpha-beta barrel, | 89.91 | |
| 1xm3_A | 264 | Thiazole biosynthesis protein THIG; structural gen | 89.43 | |
| 1i4n_A | 251 | Indole-3-glycerol phosphate synthase; thermostable | 86.6 | |
| 2qr6_A | 393 | IMP dehydrogenase/GMP reductase; NP_599840.1, G re | 86.27 | |
| 2htm_A | 268 | Thiazole biosynthesis protein THIG; thiamin biosyn | 85.68 | |
| 1w8s_A | 263 | FBP aldolase, fructose-bisphosphate aldolase class | 84.98 | |
| 2h6r_A | 219 | Triosephosphate isomerase; beta-alpha barrel; 2.30 | 84.17 | |
| 1pii_A | 452 | N-(5'phosphoribosyl)anthranilate isomerase; bifunc | 82.35 | |
| 2tps_A | 227 | Protein (thiamin phosphate synthase); thiamin bios | 82.34 | |
| 2pgw_A | 384 | Muconate cycloisomerase; enolase superfamily, octa | 81.18 | |
| 1hg3_A | 225 | Triosephosphate isomerase; thermostability, tetram | 80.09 |
| >1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 | Back alignment and structure |
|---|
Probab=99.69 E-value=9.6e-18 Score=122.38 Aligned_cols=97 Identities=12% Similarity=0.169 Sum_probs=81.6
Q ss_pred CccCCCCCCCCCHHHHHHHHHhcCCCeeeeecccccCCCccCCCC-----CC---CCHH---HHHHHHHHHHHHhcCC--
Q psy4403 1 MDPSGGSKEIVDYGGILKFKADTNASSVMIARAAQDNCSIFSPTK-----GI---QDIH---QMIKEYLRYCVDYDNS-- 67 (101)
Q Consensus 1 ~~aNGgsGDI~s~~d~~~~~~~tg~dgvMigRgAl~nP~iF~~~~-----~~---~~~~---~~~~~~l~~~~~~~~~-- 67 (101)
+++|| +|+|++|+.++++.+|||+|||||+++.|||+|.++. +. .++. +++.+|++.+.++.+.
T Consensus 186 Vi~~G---gI~s~~da~~~l~~~gad~V~iGR~~l~~P~l~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~g~~~ 262 (318)
T 1vhn_A 186 TFVSG---DIFTPEDAKRALEESGCDGLLVARGAIGRPWIFKQIKDFLRSGKYSEPSREEILRTFERHLELLIKTKGERK 262 (318)
T ss_dssp EEEES---SCCSHHHHHHHHHHHCCSEEEESGGGTTCTTHHHHHHHHHHHSCCCCCCHHHHHHHHHHHHHHHHHHHCHHH
T ss_pred EEEEC---CcCCHHHHHHHHHcCCCCEEEECHHHHhCcchHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHHhcCchH
Confidence 46788 9999999999999999999999999999999998761 32 2333 6788999988887653
Q ss_pred -CCcHHHHHHhhhCCCCC-hHHHHHHHhcCChhhh
Q psy4403 68 -APNSKYCVQSMLGSQQE-SPLGKKFLESQTLEQI 100 (101)
Q Consensus 68 -~~~~k~~l~~~~~~~~~-~~~~~~i~~~~~~~e~ 100 (101)
...+|.++.+|++++++ +++|+.|.+++|++|+
T Consensus 263 ~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~ 297 (318)
T 1vhn_A 263 AVVEMRKFLAGYTKDLKGARRFREKVMKIEEVQIL 297 (318)
T ss_dssp HHHHHHTTHHHHTTTCTTHHHHHHHHTTCCCHHHH
T ss_pred HHHHHHHHHHHHHhcCCChHHHHHHHHcCCCHHHH
Confidence 23467888999999999 9999999999999886
|
| >3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* | Back alignment and structure |
|---|
| >3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* | Back alignment and structure |
|---|
| >4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* | Back alignment and structure |
|---|
| >1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* | Back alignment and structure |
|---|
| >2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* | Back alignment and structure |
|---|
| >3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A | Back alignment and structure |
|---|
| >3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} | Back alignment and structure |
|---|
| >2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* | Back alignment and structure |
|---|
| >2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* | Back alignment and structure |
|---|
| >3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* | Back alignment and structure |
|---|
| >1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* | Back alignment and structure |
|---|
| >1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... | Back alignment and structure |
|---|
| >1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 | Back alignment and structure |
|---|
| >1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* | Back alignment and structure |
|---|
| >2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* | Back alignment and structure |
|---|
| >2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* | Back alignment and structure |
|---|
| >4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 | Back alignment and structure |
|---|
| >3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* | Back alignment and structure |
|---|
| >3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... | Back alignment and structure |
|---|
| >1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* | Back alignment and structure |
|---|
| >3l5a_A NADH/flavin oxidoreductase/NADH oxidase; OLD yellow enzyme family, OYE-like FMN-binding domain, TIM B oxidoreductase; HET: PGE; 1.65A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* | Back alignment and structure |
|---|
| >1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* | Back alignment and structure |
|---|
| >3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* | Back alignment and structure |
|---|
| >1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A | Back alignment and structure |
|---|
| >1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A | Back alignment and structure |
|---|
| >3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* | Back alignment and structure |
|---|
| >3tjl_A NADPH dehydrogenase; OLD yellow enzyme, flavin mononucleotide, TIM barrel, NADPH oxidoreductase, enone reductase; HET: FMN; 1.50A {Scheffersomyces stipitis cbs 6054} PDB: 3upw_A* 4df2_A* | Back alignment and structure |
|---|
| >1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 | Back alignment and structure |
|---|
| >1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 | Back alignment and structure |
|---|
| >2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 | Back alignment and structure |
|---|
| >1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A | Back alignment and structure |
|---|
| >3tjx_A Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh, oxidored mutation H174A; HET: FMN; 1.64A {Leishmania major} PDB: 3gz3_A* 3gye_A* 3tro_A* | Back alignment and structure |
|---|
| >1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A | Back alignment and structure |
|---|
| >2yzr_A Pyridoxal biosynthesis lyase PDXS; redox protein, pyridoxal phosphate, structural genomi NPPSFA; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* | Back alignment and structure |
|---|
| >3tdn_A FLR symmetric alpha-beta TIM barrel; symmetric superfold, de novo protein; 1.40A {Synthetic construct} PDB: 3og3_A 3tdm_A | Back alignment and structure |
|---|
| >1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* | Back alignment and structure |
|---|
| >3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* | Back alignment and structure |
|---|
| >1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* | Back alignment and structure |
|---|
| >1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A | Back alignment and structure |
|---|
| >3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 | Back alignment and structure |
|---|
| >1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* | Back alignment and structure |
|---|
| >1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 | Back alignment and structure |
|---|
| >3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* | Back alignment and structure |
|---|
| >2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A | Back alignment and structure |
|---|
| >1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* | Back alignment and structure |
|---|
| >3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A | Back alignment and structure |
|---|
| >1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* | Back alignment and structure |
|---|
| >1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 | Back alignment and structure |
|---|
| >1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* | Back alignment and structure |
|---|
| >1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A | Back alignment and structure |
|---|
| >2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* | Back alignment and structure |
|---|
| >4a3u_A NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET: FMN; 1.70A {Zymomonas mobilis} | Back alignment and structure |
|---|
| >2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* | Back alignment and structure |
|---|
| >3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 | Back alignment and structure |
|---|
| >1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 | Back alignment and structure |
|---|
| >1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A | Back alignment and structure |
|---|
| >1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 | Back alignment and structure |
|---|
| >2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* | Back alignment and structure |
|---|
| >3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* | Back alignment and structure |
|---|
| >2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A | Back alignment and structure |
|---|
| >1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1 | Back alignment and structure |
|---|
| >3vk5_A MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {Streptomyces ghanaensis} PDB: 3vka_A* 3vkb_A* 3vkc_A* 3vkd_A* | Back alignment and structure |
|---|
| >4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A | Back alignment and structure |
|---|
| >1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A* | Back alignment and structure |
|---|
| >3w01_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; HET: PGE; 1.54A {Staphylococcus aureus} PDB: 3w02_A | Back alignment and structure |
|---|
| >4gbu_A NADPH dehydrogenase 1; alpha/beta barrel, enenone reductase, alkene reductase, NADP oxidoreductase, carvone, enenatioselectivity; HET: 0WV 1PE FMN; 1.18A {Saccharomyces pastorianus} PDB: 4ge8_A* 1oya_A* 1oyb_A* 1oyc_A* 3tx9_A* 3rnd_A* 1k02_A* 1k03_A* 1bwk_A* 1bwl_A* | Back alignment and structure |
|---|
| >1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 | Back alignment and structure |
|---|
| >4a29_A Engineered retro-aldol enzyme RA95.0; de novo protein, engineered enzyme, retro-aldolase, directed evolution; HET: 3NK MLT; 1.10A {Synthetic construct} PDB: 4a2s_A* 4a2r_A* 3tc7_A 3tc6_A 3nl8_A* 3nxf_A* 3o6y_X 3ud6_A* 1igs_A 1juk_A 1jul_A* 3hoj_A 1a53_A* 1lbf_A* 1lbl_A* 3nyz_A 3nz1_A* 3uy7_A 3uxd_A* 3uxa_A* ... | Back alignment and structure |
|---|
| >1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* | Back alignment and structure |
|---|
| >4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 | Back alignment and structure |
|---|
| >3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* | Back alignment and structure |
|---|
| >1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A | Back alignment and structure |
|---|
| >1i4n_A Indole-3-glycerol phosphate synthase; thermostable TIM-barrel protein, salt bridges, electrostatic interactions, lyase; 2.50A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1j5t_A | Back alignment and structure |
|---|
| >2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A | Back alignment and structure |
|---|
| >2h6r_A Triosephosphate isomerase; beta-alpha barrel; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A | Back alignment and structure |
|---|
| >2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* | Back alignment and structure |
|---|
| >2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1hg3_A Triosephosphate isomerase; thermostability, tetrameric; 2.7A {Pyrococcus woesei} SCOP: c.1.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 101 | |||
| d1vhna_ | 305 | Putative flavin oxidoreducatase TM0096 {Thermotoga | 99.89 | |
| d1ep3a_ | 311 | Dihydroorotate dehydrogenase {Lactococcus lactis, | 99.01 | |
| d1y0ea_ | 222 | Putative N-acetylmannosamine-6-phosphate 2-epimera | 98.02 | |
| d1djqa1 | 340 | Trimethylamine dehydrogenase, N-terminal domain {M | 97.73 | |
| d1z41a1 | 337 | NADPH dehydrogenase NamA {Bacillus subtilis [TaxId | 97.68 | |
| d1ps9a1 | 330 | 2,4-dienoyl-CoA reductase, N-terminal domain {Esch | 97.57 | |
| d1yxya1 | 230 | Putative N-acetylmannosamine-6-phosphate 2-epimera | 97.53 | |
| d1gtea2 | 312 | Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su | 97.33 | |
| d1icpa_ | 364 | 12-oxophytodienoate reductase (OPR, OYE homolog) { | 96.32 | |
| d1gwja_ | 374 | Morphinone reductase {Pseudomonas putida [TaxId: 3 | 96.13 | |
| d1vyra_ | 363 | Pentaerythritol tetranirate reductase {Enterobacte | 95.66 | |
| d1juba_ | 311 | Dihydroorotate dehydrogenase {Lactococcus lactis, | 95.48 | |
| d1vcfa1 | 310 | Isopentenyl-diphosphate delta-isomerase {Thermus t | 95.06 | |
| d1oyaa_ | 399 | Old yellow enzyme (OYE) {Lager yeast (Saccharomyce | 94.49 | |
| d1q45a_ | 380 | 12-oxophytodienoate reductase (OPR, OYE homolog) { | 94.06 | |
| d1p0ka_ | 329 | Isopentenyl-diphosphate delta-isomerase {Bacillus | 94.05 | |
| d1a53a_ | 247 | Indole-3-glycerophosphate synthase, IPGS {Archaeon | 93.4 | |
| d1f76a_ | 336 | Dihydroorotate dehydrogenase {Escherichia coli [Ta | 92.95 | |
| d1d3ga_ | 367 | Dihydroorotate dehydrogenase {Human (Homo sapiens) | 92.95 | |
| d1tv5a1 | 409 | Dihydroorotate dehydrogenase {Plasmodium falciparu | 92.2 | |
| d2b4ga1 | 312 | Dihydroorotate dehydrogenase {Trypanosoma brucei [ | 92.03 | |
| d1p4ca_ | 353 | Membrane-associated (S)-mandelate dehydrogenase {P | 90.35 | |
| d1vzwa1 | 239 | Phosphoribosylformimino-5-aminoimidazole carboxami | 90.01 | |
| d1tb3a1 | 349 | Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxI | 89.46 | |
| d1piia2 | 254 | Indole-3-glycerophosphate synthase, IPGS {Escheric | 89.34 | |
| d1jvna1 | 323 | Cyclase subunit (or domain) of imidazoleglycerolph | 89.21 | |
| d1goxa_ | 359 | Glycolate oxidase {Spinach (Spinacia oleracea) [Ta | 87.49 | |
| d1thfd_ | 253 | Cyclase subunit (or domain) of imidazoleglycerolph | 87.33 | |
| d1vc4a_ | 254 | Indole-3-glycerophosphate synthase, IPGS {Thermus | 87.19 | |
| d1vrda1 | 330 | Inosine monophosphate dehydrogenase (IMPDH) {Therm | 87.11 | |
| d1pvna1 | 362 | Inosine monophosphate dehydrogenase (IMPDH) {Tritr | 86.84 | |
| d1ka9f_ | 251 | Cyclase subunit (or domain) of imidazoleglycerolph | 86.06 | |
| d1i4na_ | 251 | Indole-3-glycerophosphate synthase, IPGS {Thermoto | 85.82 | |
| d1eepa_ | 388 | Inosine monophosphate dehydrogenase (IMPDH) {Lyme | 85.79 | |
| d1jr1a1 | 378 | Inosine monophosphate dehydrogenase (IMPDH) {Chine | 85.57 | |
| d1ka9f_ | 251 | Cyclase subunit (or domain) of imidazoleglycerolph | 84.82 | |
| d1hg3a_ | 224 | Triosephosphate isomerase {Archaeon Pyrococcus woe | 84.55 | |
| d1zfja1 | 365 | Inosine monophosphate dehydrogenase (IMPDH) {Strep | 84.36 | |
| d1kbia1 | 414 | Flavocytochrome b2, C-terminal domain {Baker's yea | 84.05 | |
| d1mo0a_ | 257 | Triosephosphate isomerase {Nematode (Caenorhabditi | 83.55 | |
| d2cu0a1 | 368 | Inosine monophosphate dehydrogenase (IMPDH) {Pyroc | 83.42 | |
| d1znna1 | 254 | Pyridoxal biosynthesis lyase PdxS {Bacillus stearo | 82.94 | |
| d1h5ya_ | 252 | Cyclase subunit (or domain) of imidazoleglycerolph | 82.36 | |
| d1qo2a_ | 241 | Phosphoribosylformimino-5-aminoimidazole carboxami | 81.18 | |
| d1vzwa1 | 239 | Phosphoribosylformimino-5-aminoimidazole carboxami | 81.14 | |
| d1e0ta2 | 246 | Pyruvate kinase, N-terminal domain {Escherichia co | 80.8 | |
| d1w0ma_ | 226 | Triosephosphate isomerase {Thermoproteus tenax [Ta | 80.62 | |
| d1o5xa_ | 246 | Triosephosphate isomerase {Plasmodium falciparum [ | 80.55 | |
| d1h5ya_ | 252 | Cyclase subunit (or domain) of imidazoleglycerolph | 80.4 |
| >d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: FMN-linked oxidoreductases family: FMN-linked oxidoreductases domain: Putative flavin oxidoreducatase TM0096 species: Thermotoga maritima [TaxId: 2336]
Probab=99.89 E-value=1.3e-24 Score=156.78 Aligned_cols=97 Identities=12% Similarity=0.169 Sum_probs=80.7
Q ss_pred CccCCCCCCCCCHHHHHHHHHhcCCCeeeeecccccCCCccCCCC-----C---CCCHH---HHHHHHHHHHHHhcCCCC
Q psy4403 1 MDPSGGSKEIVDYGGILKFKADTNASSVMIARAAQDNCSIFSPTK-----G---IQDIH---QMIKEYLRYCVDYDNSAP 69 (101)
Q Consensus 1 ~~aNGgsGDI~s~~d~~~~~~~tg~dgvMigRgAl~nP~iF~~~~-----~---~~~~~---~~~~~~l~~~~~~~~~~~ 69 (101)
+++|| ||+|++|+.+++++||||||||||||++|||||.++. + ..++. +++.+|++++.+++++..
T Consensus 182 vi~NG---dI~s~~d~~~~l~~tg~dgVMiGRgal~nP~if~~i~~~l~~~~~~~~~~~e~~~~~~~~~~~~~~~~g~~~ 258 (305)
T d1vhna_ 182 TFVSG---DIFTPEDAKRALEESGCDGLLVARGAIGRPWIFKQIKDFLRSGKYSEPSREEILRTFERHLELLIKTKGERK 258 (305)
T ss_dssp EEEES---SCCSHHHHHHHHHHHCCSEEEESGGGTTCTTHHHHHHHHHHHSCCCCCCHHHHHHHHHHHHHHHHHHHCHHH
T ss_pred hhccc---ccccHHHHHHHHHhcCCCeEehhHHHHHhhhHhhhhhhhhcCCCcccchhHHHHHhHHHHHHHHHHhcCcch
Confidence 35788 9999999999999999999999999999999998751 1 23343 567888888887765533
Q ss_pred ---cHHHHHHhhhCCCCC-hHHHHHHHhcCChhhh
Q psy4403 70 ---NSKYCVQSMLGSQQE-SPLGKKFLESQTLEQI 100 (101)
Q Consensus 70 ---~~k~~l~~~~~~~~~-~~~~~~i~~~~~~~e~ 100 (101)
.+|+|+.+|++++++ +++|+.|.+++|++++
T Consensus 259 ~l~~~rkhl~~~~kg~p~ak~~R~~l~~~~~~~el 293 (305)
T d1vhna_ 259 AVVEMRKFLAGYTKDLKGARRFREKVMKIEEVQIL 293 (305)
T ss_dssp HHHHHHTTHHHHTTTCTTHHHHHHHHTTCCCHHHH
T ss_pred HHHHHHHHHHHHHcCCCcHHHHHHHHHhCCCHHHH
Confidence 356788999999999 9999999999999886
|
| >d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1icpa_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Tomato (Lycopersicon esculentum), OPR1 [TaxId: 4081]} | Back information, alignment and structure |
|---|
| >d1gwja_ c.1.4.1 (A:) Morphinone reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} | Back information, alignment and structure |
|---|
| >d1juba_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1oyaa_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]} | Back information, alignment and structure |
|---|
| >d1q45a_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1f76a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d3ga_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2b4ga1 c.1.4.1 (A:2-313) Dihydroorotate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1p4ca_ c.1.4.1 (A:) Membrane-associated (S)-mandelate dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1piia2 c.1.2.4 (A:1-254) Indole-3-glycerophosphate synthase, IPGS {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1goxa_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vc4a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} | Back information, alignment and structure |
|---|
| >d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1i4na_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} | Back information, alignment and structure |
|---|
| >d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1hg3a_ c.1.1.1 (A:) Triosephosphate isomerase {Archaeon Pyrococcus woesei [TaxId: 2262]} | Back information, alignment and structure |
|---|
| >d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mo0a_ c.1.1.1 (A:) Triosephosphate isomerase {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1znna1 c.1.2.6 (A:18-271) Pyridoxal biosynthesis lyase PdxS {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1e0ta2 c.1.12.1 (A:1-69,A:168-344) Pyruvate kinase, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w0ma_ c.1.1.1 (A:) Triosephosphate isomerase {Thermoproteus tenax [TaxId: 2271]} | Back information, alignment and structure |
|---|
| >d1o5xa_ c.1.1.1 (A:) Triosephosphate isomerase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|