Psyllid ID: psy4493

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320---
MLPNYPWSDRVRSVLKSKFNLTDFRPNQLAAINIALLKKDAIIIMPTDYPWSDRVRSVLKSKFNLTDFRPNQLAAINIALLKKDAIIIMPTGKLLKKKKICLMTESSSLKLLYVSPEKLAKSKSFMTKLQKMYKAGCLARIAIDEVHCCSSWGHDFRPDYQYLSILKTMFPDVPILGLTATATTKVMLDVQKMLQIEDCVVIKAPFNRPNLFYEVRIKPAAQKDCLDELADLMSRRFRNQSGIIYTTSIKECEDLREELRNRGLRVSAYHAKLESNVSIAFGLGIDKPNVRFVIHHCLSKSMENFYQVSIAFGLGKHSFRSRY
ccccccccHHHHHHHHccccccccccHHHHHHHHHHccccEEEEccccccccccccEEccccHHHHHHHHHHHHHHcHHcHHHHHHHcccccHHHHHHHHHHHcccccccEEEEccccccccHHHHHHHHHHHHcccccEEEEEccccccccccccHHHHHHHHHHHHHcccccHHHHcccccHHHHHHHHHHccccccccccccccccccEEEEEEccccHHHHHHHHHHHHHHcccccccEEEEccccHHHHHHHHHHHccccccccccccccccEEEccccccccccEEEEEcccccccHHHHHHccccccccccccccc
ccccccccHHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEEcccccccccccHEEccccEEEEcHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHcccEEEEEEcHHHHHccHHHHHHHHHHHHccccEEEEEEcHHHHccccccccHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHHcccccEEEEEccccccEEEEEEcccccHHHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHccccEEEEccccccccEEEEccccccccEEEEEEccccccHHHHHHHcccccccccccHHcc
mlpnypwsdrVRSVLKSkfnltdfrpnQLAAINIALLKKdaiiimptdypwsdRVRSVLKSkfnltdfrpnQLAAINIALLKKDAIIIMPTGKLLKKKKICLMTessslkllyvspeklaKSKSFMTKLQKMYKAGCLARIaidevhccsswghdfrpdyqYLSILKtmfpdvpilgltatATTKVMLDVQKMLQIEDcvvikapfnrpnlfyevrikpaaqKDCLDELADLMSRRFRnqsgiiyttSIKECEDLREELRNRGLRVSAYHAKLESNVSIAfglgidkpnvRFVIHHCLSKSMENFYQVSIAFglgkhsfrsry
mlpnypwsdrVRSVLKSkfnltdfrpnQLAAINIALLKKDAIIIMPTDYPWSDRVRSVLKSkfnltdfrpnQLAAINIALLKKDAIIIMPTGKLLKKKKICLMTEssslkllyvspEKLAKSKSFMTKLQKMYKAGCLARIAIDEVHCCSSWGHDFRPDYQYLSILKTMFPDVPILGLTATATTKVMLDVQKMLQIEDCVVIKAPFNRPNLFYEVRIKPAAQKDCLDELADLMSRRfrnqsgiiyttsikecEDLREELRNRGLRVSAYHAKLESNVSIAFGLGIDKPNVRFVIHHCLSKSMENFYQVSIAfglgkhsfrsry
MLPNYPWSDRVRSVLKSKFNLTDFRPNQLAAINIALLKKDAIIIMPTDYPWSDRVRSVLKSKFNLTDFRPNQLAAINIALLKKDAIIIMPTGKLLKKKKICLMTESSSLKLLYVSPEKLAKSKSFMTKLQKMYKAGCLARIAIDEVHCCSSWGHDFRPDYQYLSILKTMFPDVPILGLTATATTKVMLDVQKMLQIEDCVVIKAPFNRPNLFYEVRIKPAAQKDCLDELADLMSRRFRNQSGIIYTTSIKECEDLREELRNRGLRVSAYHAKLESNVSIAFGLGIDKPNVRFVIHHCLSKSMENFYQVSIAFGLGKHSFRSRY
*********RVRSVLKSKFNLTDFRPNQLAAINIALLKKDAIIIMPTDYPWSDRVRSVLKSKFNLTDFRPNQLAAINIALLKKDAIIIMPTGKLLKKKKICLMTESSSLKLLYVSPEKLAKSKSFMTKLQKMYKAGCLARIAIDEVHCCSSWGHDFRPDYQYLSILKTMFPDVPILGLTATATTKVMLDVQKMLQIEDCVVIKAPFNRPNLFYEVRIKPAAQKDCLDELADLMSRRFRNQSGIIYTT******************VSAYHAKLESNVSIAFGLGIDKPNVRFVIHHCLSKSMENFYQVSIAFGLGK*******
***NYPWSDRVRSVLKSKFNLTDFRPNQLAAINIALLKKDAIIIMPTDYPWSDRVRSVLKSKFNLTDFRPNQLAAINIALLKKDAI*****************TESSSLKLLYVSPEKLAKSKSFMTKLQKMYKAGCLARIAIDEVHCCSSWGHDFRPDYQYLSILKTMFPDVPILGLTATATTKVMLDVQKMLQIEDCVVIKAPFNRPNLFYEVRIKPAAQKDCLDELADLMSRRFRNQSGIIYTTSIKECEDLREELRNRGLRVSAYHAKLESNVSIAFGLGIDKPNVRFVIHHCLSKSMENFYQVSIAFGLGK*****RY
MLPNYPWSDRVRSVLKSKFNLTDFRPNQLAAINIALLKKDAIIIMPTDYPWSDRVRSVLKSKFNLTDFRPNQLAAINIALLKKDAIIIMPTGKLLKKKKICLMTESSSLKLLYVSPEKLAKSKSFMTKLQKMYKAGCLARIAIDEVHCCSSWGHDFRPDYQYLSILKTMFPDVPILGLTATATTKVMLDVQKMLQIEDCVVIKAPFNRPNLFYEVRIKPAAQKDCLDELADLMSRRFRNQSGIIYTTSIKECEDLREELRNRGLRVSAYHAKLESNVSIAFGLGIDKPNVRFVIHHCLSKSMENFYQVSIAFGLGKHSFRSRY
*LPNYPWSDRVRSVLKSKFNLTDFRPNQLAAINIALLKKDAIIIMPTDYPWSDRVRSVLKSKFNLTDFRPNQLAAINIALLKKDAIIIMPTGKLLKKKKICLMTESSSLKLLYVSPEKLAKSKSFMTKLQKMYKAGCLARIAIDEVHCCSSWGHDFRPDYQYLSILKTMFPDVPILGLTATATTKVMLDVQKMLQIEDCVVIKAPFNRPNLFYEVRIKPAAQKDCLDELADLMSRRFRNQSGIIYTTSIKECEDLREELRNRGLRVSAYHAKLESNVSIAFGLGIDKPNVRFVIHHCLSKSMENFYQVSIA*****HSF****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLPNYPWSDRVRSVLKSKFNLTDFRPNQLAAINIALLKKDAIIIMPTDYPWSDRVRSVLKSKFNLTDFRPNQLAAINIALLKKDAIIIMPTGKLLKKKKICLMTESSSLKLLYVSPEKLAKSKSFMTKLQKMYKAGCLARIAIDEVHCCSSWGHDFRPDYQYLSILKTMFPDVPILGLTATATTKVMLDVQKMLQIEDCVVIKAPFNRPNLFYEVRIKPAAQKDCLDELADLMSRRFRNQSGIIYTTSIKECEDLREELRNRGLRVSAYHAKLESNVSIAFGLGIDKPNVRFVIHHCLSKSMENFYQVSIAFGLGKHSFRSRY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query323 2.2.26 [Sep-21-2011]
Q5RF63 649 ATP-dependent DNA helicas yes N/A 0.959 0.477 0.426 9e-75
P46063 649 ATP-dependent DNA helicas yes N/A 0.823 0.409 0.420 2e-73
Q6AYJ1 621 ATP-dependent DNA helicas yes N/A 0.823 0.428 0.423 4e-73
Q9Z129 648 ATP-dependent DNA helicas yes N/A 0.823 0.410 0.414 7e-72
A8WK63 618 Putative ATP-dependent DN N/A N/A 0.820 0.428 0.416 3e-67
Q9TXJ8 631 Putative ATP-dependent DN yes N/A 0.811 0.415 0.415 4e-67
Q9FT73 705 Mediator of RNA polymeras yes N/A 0.944 0.432 0.413 5e-66
Q09811 1328 ATP-dependent DNA helicas yes N/A 0.934 0.227 0.389 2e-55
Q8L840 1188 ATP-dependent DNA helicas no N/A 0.913 0.248 0.375 1e-54
P35187 1447 ATP-dependent helicase SG yes N/A 0.835 0.186 0.352 2e-54
>sp|Q5RF63|RECQ1_PONAB ATP-dependent DNA helicase Q1 OS=Pongo abelii GN=RECQL PE=2 SV=1 Back     alignment and function desciption
 Score =  280 bits (717), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 143/335 (42%), Positives = 203/335 (60%), Gaps = 25/335 (7%)

Query: 4   NYPWSDRVRSVLKSKFNLTDFRPNQLAAINIALLKKDAIIIMPTDYPWS--DRVRSVLKS 61
           ++PWS +V+ VL++ F L  FRP QL  IN+ +  K+  ++MPT        ++ ++   
Sbjct: 72  DFPWSGKVKDVLQNVFKLQKFRPLQLETINVTMAGKEVFLVMPTGGGKGLCYQLPALCSD 131

Query: 62  KFNLT-----DFRPNQLAAINIALLKKDAIIIMPTGKLLKKKKICLMTESSSLKLLYVSP 116
            F L          +QL  +    +    +    + + +K     ++ ++S LKL+YV+P
Sbjct: 132 GFTLVICPLISLMEDQLMVLKQLGISATMLNASSSKEHVKWVHAEMVNKNSELKLIYVTP 191

Query: 117 EKLAKSKSFMTKLQKMYKAGCLARIAIDEVHCCSSWGHDFRPDYQYLSILKTMFPDVPIL 176
           EK+AKSK FM++L+K Y+A    RIA+DEVHCCS WGHDFRPDY+ L ILK  FP+  ++
Sbjct: 192 EKIAKSKMFMSRLEKAYEARRFTRIAVDEVHCCSQWGHDFRPDYKALGILKRQFPNASLI 251

Query: 177 GLTATATTKVMLDVQKMLQIEDCVVIKAPFNRPNLFYEVRIKPAAQKDCLDELADLMSRR 236
           GLTATAT  V+ D QK+L IE C    A FNRPNL+YEVR KP+  +D ++++  L++ R
Sbjct: 252 GLTATATNHVLTDAQKILCIEKCFTFTASFNRPNLYYEVRQKPSNTEDFIEDIVKLINGR 311

Query: 237 FRNQSGIIYTTSIKECEDLREELRNRGLRVSAYHAKLESN------------------VS 278
           ++ QSGIIY  S K+ E +   LRN G+   AYHA LE                     +
Sbjct: 312 YKGQSGIIYCFSQKDSEQVTVSLRNLGIHAGAYHANLEPEDKTTVHRKWSANEIQVVVAT 371

Query: 279 IAFGLGIDKPNVRFVIHHCLSKSMENFYQVSIAFG 313
           +AFG+GIDKP+VRFVIHH +SKSMEN+YQ S   G
Sbjct: 372 VAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRAG 406
DNA helicase that may play a role in the repair of DNA that is damaged by ultraviolet light or other mutagens. Exhibits a magnesium-dependent ATP-dependent DNA-helicase activity that unwinds single- and double-stranded DNA in a 3'-5' direction.
Pongo abelii (taxid: 9601)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 2
>sp|P46063|RECQ1_HUMAN ATP-dependent DNA helicase Q1 OS=Homo sapiens GN=RECQL PE=1 SV=3 Back     alignment and function description
>sp|Q6AYJ1|RECQ1_RAT ATP-dependent DNA helicase Q1 OS=Rattus norvegicus GN=Recql PE=2 SV=1 Back     alignment and function description
>sp|Q9Z129|RECQ1_MOUSE ATP-dependent DNA helicase Q1 OS=Mus musculus GN=Recql PE=1 SV=2 Back     alignment and function description
>sp|A8WK63|RECQ1_CAEBR Putative ATP-dependent DNA helicase Q1 OS=Caenorhabditis briggsae GN=CBG24191 PE=3 SV=1 Back     alignment and function description
>sp|Q9TXJ8|RECQ1_CAEEL Putative ATP-dependent DNA helicase Q1 OS=Caenorhabditis elegans GN=K02F3.12 PE=3 SV=3 Back     alignment and function description
>sp|Q9FT73|MED34_ARATH Mediator of RNA polymerase II transcription subunit 34 OS=Arabidopsis thaliana GN=MED34 PE=1 SV=1 Back     alignment and function description
>sp|Q09811|HUS2_SCHPO ATP-dependent DNA helicase hus2/rqh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rqh1 PE=1 SV=1 Back     alignment and function description
>sp|Q8L840|RQL4A_ARATH ATP-dependent DNA helicase Q-like 4A OS=Arabidopsis thaliana GN=RECQL4A PE=2 SV=1 Back     alignment and function description
>sp|P35187|SGS1_YEAST ATP-dependent helicase SGS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGS1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query323
242022338 652 ATP-dependent DNA helicase Q1, putative 0.835 0.414 0.491 2e-84
193606281 599 PREDICTED: ATP-dependent DNA helicase Q1 0.823 0.444 0.491 3e-84
321475158 624 RecQ1-like protein [Daphnia pulex] 0.823 0.426 0.492 7e-84
443429393 632 ATP-dependent DNA helicase Q1-like prote 0.820 0.419 0.479 1e-81
261335969 632 putative RecQ Helicase [Heliconius melpo 0.820 0.419 0.482 3e-81
332027185 599 ATP-dependent DNA helicase Q1 [Acromyrme 0.959 0.517 0.468 2e-80
238859683 598 RecQ protein 1 [Nasonia vitripennis] 0.928 0.501 0.445 5e-79
383853399 597 PREDICTED: ATP-dependent DNA helicase Q1 0.953 0.515 0.474 2e-78
322779042 596 hypothetical protein SINV_80478 [Solenop 0.823 0.446 0.467 3e-78
340717015 596 PREDICTED: LOW QUALITY PROTEIN: ATP-depe 0.959 0.520 0.459 4e-76
>gi|242022338|ref|XP_002431597.1| ATP-dependent DNA helicase Q1, putative [Pediculus humanus corporis] gi|212516905|gb|EEB18859.1| ATP-dependent DNA helicase Q1, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  318 bits (816), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 167/340 (49%), Positives = 215/340 (63%), Gaps = 70/340 (20%)

Query: 49  YPWSDRVRSVLKSKFNLTDFRPNQLAAINIALLKKDAIIIMPTG---------------- 92
           +PWS +V ++LK  F +++FRP QL  IN  L K+D I+IMPTG                
Sbjct: 64  FPWSQKVDNLLKENFKISEFRPFQLEVINATLSKEDVILIMPTGGGKSLCYQLPALVDKG 123

Query: 93  --------------KLLKKKKI---CLMTESSS------------------LKLLYVSPE 117
                         +++  KKI    LM  ++S                   KL+YV+PE
Sbjct: 124 ITLVVSPLVSLMEDQVMALKKINYPALMLSANSSKEDVKLVTAALQDSCPKHKLIYVTPE 183

Query: 118 KLAKSKSFMTKLQKMYKAGCLARIAIDEVHCCSSWGHDFRPDYQYLSILKTMFPDVPILG 177
           KLAKSK FM++LQK ++ G   R+AIDEVHCCS+WGHDFRPDY YL ILK MFP VP+LG
Sbjct: 184 KLAKSKRFMSQLQKCHQQGRFTRLAIDEVHCCSTWGHDFRPDYNYLGILKDMFPGVPLLG 243

Query: 178 LTATATTKVMLDVQKMLQIEDCVVIKAPFNRPNLFYEVRIKPAAQKDCLDELADLMSRRF 237
           LTAT+T+KV  DVQKML I+ C+VIKA FNRPNL+YEV +KP++Q + LD L + +  +F
Sbjct: 244 LTATSTSKVTADVQKMLNIQGCLVIKATFNRPNLYYEVVLKPSSQSENLDLLENWLKNKF 303

Query: 238 RNQSGIIYTTSIKECEDLREELRNRGLRVSAYHAKLESNV------------------SI 279
            N+SGIIYTT+IKECE+L +ELR RG++   YHA L++ V                  ++
Sbjct: 304 SNKSGIIYTTAIKECEELTKELRKRGIKAGVYHAMLDAEVRSKMHTKWMSNEYQVIVATV 363

Query: 280 AFGLGIDKPNVRFVIHHCLSKSMENFYQVSIAFGL-GKHS 318
           AFG+GIDKP+VRFVIHH LSKSMENFYQ S   G  GK+S
Sbjct: 364 AFGMGIDKPDVRFVIHHSLSKSMENFYQESGRAGRDGKNS 403

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|193606281|ref|XP_001943152.1| PREDICTED: ATP-dependent DNA helicase Q1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|321475158|gb|EFX86121.1| RecQ1-like protein [Daphnia pulex] Back     alignment and taxonomy information
>gi|443429393|gb|AGC92678.1| ATP-dependent DNA helicase Q1-like protein [Heliconius erato] Back     alignment and taxonomy information
>gi|261335969|emb|CBH09254.1| putative RecQ Helicase [Heliconius melpomene] Back     alignment and taxonomy information
>gi|332027185|gb|EGI67277.1| ATP-dependent DNA helicase Q1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|238859683|ref|NP_001154966.1| RecQ protein 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383853399|ref|XP_003702210.1| PREDICTED: ATP-dependent DNA helicase Q1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|322779042|gb|EFZ09441.1| hypothetical protein SINV_80478 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|340717015|ref|XP_003396985.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent DNA helicase Q1-like [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query323
RGD|1311071 621 Recql "RecQ protein-like (DNA 0.839 0.436 0.428 2.9e-70
UNIPROTKB|Q6AYJ1 621 Recql "ATP-dependent DNA helic 0.839 0.436 0.428 2.9e-70
UNIPROTKB|F1NPI7 661 RECQL "Uncharacterized protein 0.842 0.411 0.412 3.7e-70
UNIPROTKB|P46063 649 RECQL "ATP-dependent DNA helic 0.839 0.417 0.428 2.6e-69
UNIPROTKB|F1SR01 649 RECQL "Uncharacterized protein 0.839 0.417 0.424 2.3e-68
MGI|MGI:103021 648 Recql "RecQ protein-like" [Mus 0.839 0.418 0.420 2.9e-68
UNIPROTKB|A0JN36 649 RECQL "Uncharacterized protein 0.839 0.417 0.420 6e-68
UNIPROTKB|F1PNP1 646 RECQL "Uncharacterized protein 0.839 0.419 0.413 2.3e-66
ZFIN|ZDB-GENE-050809-134 640 recql "RecQ protein-like (DNA 0.941 0.475 0.441 3.2e-65
WB|WBGene00019334 631 K02F3.12 [Caenorhabditis elega 0.826 0.423 0.414 8.7e-65
RGD|1311071 Recql "RecQ protein-like (DNA helicase Q1-like)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 593 (213.8 bits), Expect = 2.9e-70, Sum P(2) = 2.9e-70
 Identities = 119/278 (42%), Positives = 177/278 (63%)

Query:     4 NYPWSDRVRSVLKSKFNLTDFRPNQLAAINIALLKKDAIIIMPTDYPWS--DRVRSVLKS 61
             ++PWS +V+ VL+  F L  FRP QL  +N  + +KD  ++MPT    S   ++ ++   
Sbjct:    72 DFPWSGKVKHVLRDVFKLQKFRPLQLETVNATMARKDIFLVMPTGGGKSLCYQLPALCSD 131

Query:    62 KFNLTDFRPNQLAAINIALLKKDAIIIMPTGKLLKKKKI-CLMTE----SSSLKLLYVSP 116
              F L       L    + +L++  I          K+ + C+ TE    +S LKL+YV+P
Sbjct:   132 GFTLVICPLISLMEDQLMVLQQLGISATMLNSSSSKEHVKCVHTEMMNKNSHLKLIYVTP 191

Query:   117 EKLAKSKSFMTKLQKMYKAGCLARIAIDEVHCCSSWGHDFRPDYQYLSILKTMFPDVPIL 176
             EK+AKSK FM++L+K Y+AG L  +A+DEVHCCS WGHDFRPDY+ L ILK  FP++ ++
Sbjct:   192 EKIAKSKMFMSRLEKAYEAGRLTGVAVDEVHCCSQWGHDFRPDYKALGILKRQFPNISLI 251

Query:   177 GLTATATTKVMLDVQKMLQIEDCVVIKAPFNRPNLFYEVRIKPAAQKDCLDELADLMSRR 236
             GLTATAT  V+ D QK+L +E C+   A FNRPNL+YEVR KP++ +D ++ +A+L++ R
Sbjct:   252 GLTATATNHVLKDAQKILCVEKCLTFTASFNRPNLYYEVRQKPSSAEDFIENIANLINGR 311

Query:   237 FRNQSGIIYTTSIKECEDLREELRNRGLRVSAYHAKLE 274
             ++ +SGIIY  S K+ E +   L+  G+R   YHA +E
Sbjct:   312 YKGKSGIIYCFSQKDSEQVTISLQKLGVRAGTYHANME 349
GO:0000733 "DNA strand renaturation" evidence=IEA;ISO
GO:0003674 "molecular_function" evidence=ND
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0003678 "DNA helicase activity" evidence=ISO
GO:0005524 "ATP binding" evidence=IEA
GO:0005575 "cellular_component" evidence=ND
GO:0005634 "nucleus" evidence=IEA;ISO
GO:0006260 "DNA replication" evidence=IEA
GO:0006281 "DNA repair" evidence=IEA
GO:0006310 "DNA recombination" evidence=IEA
GO:0008150 "biological_process" evidence=ND
GO:0015630 "microtubule cytoskeleton" evidence=IEA;ISO
GO:0032508 "DNA duplex unwinding" evidence=ISO
GO:0043140 "ATP-dependent 3'-5' DNA helicase activity" evidence=IEA
GO:0005730 "nucleolus" evidence=ISO
UNIPROTKB|Q6AYJ1 Recql "ATP-dependent DNA helicase Q1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NPI7 RECQL "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P46063 RECQL "ATP-dependent DNA helicase Q1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SR01 RECQL "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:103021 Recql "RecQ protein-like" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|A0JN36 RECQL "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PNP1 RECQL "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050809-134 recql "RecQ protein-like (DNA helicase Q1-like)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00019334 K02F3.12 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.12LOW CONFIDENCE prediction!
3rd Layer3.6.40.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query323
TIGR00614 470 TIGR00614, recQ_fam, ATP-dependent DNA helicase, R 9e-89
COG0514 590 COG0514, RecQ, Superfamily II DNA helicase [DNA re 1e-72
PLN03137 1195 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4 7e-66
TIGR01389 591 TIGR01389, recQ, ATP-dependent DNA helicase RecQ 3e-59
PRK11057 607 PRK11057, PRK11057, ATP-dependent DNA helicase Rec 4e-56
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 7e-13
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 1e-10
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 8e-07
smart0049082 smart00490, HELICc, helicase superfamily c-termina 3e-06
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 3e-06
COG1202 830 COG1202, COG1202, Superfamily II helicase, archaea 1e-04
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 3e-04
PLN03137 1195 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4 0.002
COG0513 513 COG0513, SrmB, Superfamily II DNA and RNA helicase 0.002
>gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family Back     alignment and domain information 
 Score =  273 bits (699), Expect = 9e-89
 Identities = 121/323 (37%), Positives = 177/323 (54%), Gaps = 39/323 (12%)

Query: 13  SVLKSKFNLTDFRPNQLAAINIALLKKDAIIIMPT--------DYP--WSDRVRSVLKSK 62
           S+LK+ F L+ FRP QL  IN  LL +D  ++MPT          P   SD +  V+   
Sbjct: 1   SILKTVFGLSSFRPVQLEVINAVLLGRDCFVVMPTGGGKSLCYQLPALCSDGITLVISPL 60

Query: 63  FNLTDFRPNQLAAINIALLKKDAIIIMPTGKLLKKKKICLMTESSSLKLLYVSPEKLAKS 122
            +L + +  QL A  I      A  +  +    ++K +    +   +KLLYV+PEK + S
Sbjct: 61  ISLMEDQVLQLKASGIP-----ATFLNSSQSKEQQKNVLTDLKDGKIKLLYVTPEKCSAS 115

Query: 123 KSFMTKLQKMYKAGCLARIAIDEVHCCSSWGHDFRPDYQYLSILKTMFPDVPILGLTATA 182
              +  L++      +  IA+DE HC S WGHDFRPDY+ L  LK  FP+VPI+ LTATA
Sbjct: 116 NRLLQTLEERKG---ITLIAVDEAHCISQWGHDFRPDYKALGSLKQKFPNVPIMALTATA 172

Query: 183 TTKVMLDVQKMLQIEDCVVIKAPFNRPNLFYEVRIKPAAQKDCLDELADLMSRRFRNQSG 242
           +  V  D+ + L +++  +    F+RPNL+YEVR K       L++L   + + F+ +SG
Sbjct: 173 SPSVREDILRQLNLKNPQIFCTSFDRPNLYYEVRRKTP---KILEDLLRFIRKEFKGKSG 229

Query: 243 IIYTTSIKECEDLREELRNRGLRVSAYHAKLESNV------------------SIAFGLG 284
           IIY  S K+ E +   L+N G+   AYHA LE +                   ++AFG+G
Sbjct: 230 IIYCPSRKKSEQVTASLQNLGIAAGAYHAGLEISARDDVHHKFQRDEIQVVVATVAFGMG 289

Query: 285 IDKPNVRFVIHHCLSKSMENFYQ 307
           I+KP+VRFVIH+ L KSME++YQ
Sbjct: 290 INKPDVRFVIHYSLPKSMESYYQ 312

All proteins in this family for which functions are known are 3'-5' DNA-DNA helicases. These proteins are used for recombination, recombinational repair, and possibly maintenance of chromosome stability. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University) [DNA metabolism, DNA replication, recombination, and repair]. Length = 470
>gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|215597 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ Back     alignment and domain information
>gnl|CDD|182933 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|215597 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 323
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 100.0
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
KOG0353|consensus 695 100.0
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 100.0
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
KOG0351|consensus 941 100.0
KOG0352|consensus 641 100.0
KOG0331|consensus519 100.0
KOG0330|consensus476 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
PTZ00110545 helicase; Provisional 100.0
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 100.0
KOG0328|consensus400 100.0
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 100.0
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
KOG0342|consensus 543 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0333|consensus673 100.0
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 100.0
PTZ00424401 helicase 45; Provisional 100.0
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 100.0
KOG0345|consensus 567 100.0
KOG0343|consensus 758 100.0
KOG0338|consensus 691 100.0
KOG0340|consensus442 100.0
KOG0335|consensus482 100.0
KOG0346|consensus 569 100.0
KOG0326|consensus459 100.0
KOG0336|consensus629 100.0
PRK02362 737 ski2-like helicase; Provisional 100.0
COG1201 814 Lhr Lhr-like helicases [General function predictio 100.0
PRK13767 876 ATP-dependent helicase; Provisional 100.0
KOG0332|consensus477 100.0
KOG0348|consensus 708 100.0
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 100.0
KOG0341|consensus610 100.0
KOG0327|consensus397 100.0
PRK00254 720 ski2-like helicase; Provisional 100.0
KOG0347|consensus 731 100.0
KOG4284|consensus 980 100.0
PRK01172 674 ski2-like helicase; Provisional 100.0
KOG0339|consensus 731 100.0
PRK10689 1147 transcription-repair coupling factor; Provisional 100.0
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 100.0
TIGR00643630 recG ATP-dependent DNA helicase RecG. 100.0
KOG0334|consensus 997 100.0
PRK14701 1638 reverse gyrase; Provisional 100.0
PHA02653 675 RNA helicase NPH-II; Provisional 99.98
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.98
COG1202 830 Superfamily II helicase, archaea-specific [General 99.97
KOG0337|consensus 529 99.97
KOG0350|consensus620 99.97
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.97
PRK09401 1176 reverse gyrase; Reviewed 99.97
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.97
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.97
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.97
PHA02558501 uvsW UvsW helicase; Provisional 99.97
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.97
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.97
COG1204 766 Superfamily II helicase [General function predicti 99.96
KOG0344|consensus 593 99.96
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.96
COG1205 851 Distinct helicase family with a unique C-terminal 99.96
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.95
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.95
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.95
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.94
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 99.94
PRK13766 773 Hef nuclease; Provisional 99.94
KOG0952|consensus 1230 99.94
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.94
KOG0329|consensus387 99.94
PRK04914 956 ATP-dependent helicase HepA; Validated 99.94
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.93
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.93
KOG0354|consensus 746 99.93
PRK05580 679 primosome assembly protein PriA; Validated 99.92
PRK09694 878 helicase Cas3; Provisional 99.92
KOG0948|consensus 1041 99.92
TIGR00595 505 priA primosomal protein N'. All proteins in this f 99.9
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 99.9
KOG0951|consensus 1674 99.89
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.89
KOG0947|consensus 1248 99.89
KOG0950|consensus 1008 99.88
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.87
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.86
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.86
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.85
KOG0349|consensus 725 99.85
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.84
KOG0922|consensus 674 99.84
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.81
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.81
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 99.79
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.79
KOG0923|consensus 902 99.76
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.76
KOG0920|consensus 924 99.74
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.73
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.73
COG1198 730 PriA Primosomal protein N' (replication factor Y) 99.72
KOG0924|consensus 1042 99.71
KOG0926|consensus 1172 99.71
COG4096 875 HsdR Type I site-specific restriction-modification 99.7
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.69
KOG4150|consensus 1034 99.69
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 99.69
KOG0925|consensus 699 99.69
KOG0949|consensus 1330 99.69
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.66
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.66
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.65
PRK05298652 excinuclease ABC subunit B; Provisional 99.65
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.64
PRK12326 764 preprotein translocase subunit SecA; Reviewed 99.63
KOG0385|consensus 971 99.56
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 99.51
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.5
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.47
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.43
smart00487201 DEXDc DEAD-like helicases superfamily. 99.41
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 99.32
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.31
KOG0384|consensus 1373 99.3
CHL00122 870 secA preprotein translocase subunit SecA; Validate 99.29
smart0049082 HELICc helicase superfamily c-terminal domain. 99.29
KOG0390|consensus776 99.27
KOG0387|consensus 923 99.25
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 99.25
KOG1123|consensus 776 99.25
COG4889 1518 Predicted helicase [General function prediction on 99.22
KOG0953|consensus 700 99.22
KOG1000|consensus689 99.2
KOG0951|consensus 1674 99.15
KOG0389|consensus941 99.13
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.12
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 99.12
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 99.09
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.04
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 98.97
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 98.94
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 98.9
PRK14873 665 primosome assembly protein PriA; Provisional 98.84
KOG0386|consensus 1157 98.62
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 98.46
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 98.34
KOG0392|consensus 1549 98.32
KOG0330|consensus 476 98.32
KOG0952|consensus1230 98.29
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 98.01
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 97.93
PTZ00110 545 helicase; Provisional 97.93
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 97.84
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 97.82
KOG0921|consensus 1282 97.82
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 97.78
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 97.77
KOG1002|consensus791 97.77
PLN00206 518 DEAD-box ATP-dependent RNA helicase; Provisional 97.76
KOG1803|consensus 649 97.75
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 97.71
KOG4439|consensus901 97.7
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 97.7
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 97.68
TIGR01448 720 recD_rel helicase, putative, RecD/TraA family. Thi 97.63
TIGR01447 586 recD exodeoxyribonuclease V, alpha subunit. This f 97.6
PRK10875 615 recD exonuclease V subunit alpha; Provisional 97.59
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 97.58
KOG0331|consensus 519 97.57
KOG0338|consensus 691 97.56
PTZ00424401 helicase 45; Provisional 97.51
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 97.48
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 97.47
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 97.46
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 97.44
COG1201 814 Lhr Lhr-like helicases [General function predictio 97.41
KOG0348|consensus 708 97.39
COG0610 962 Type I site-specific restriction-modification syst 97.37
PRK02362 737 ski2-like helicase; Provisional 97.34
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 97.32
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 97.31
KOG1131|consensus 755 97.26
PRK15483 986 type III restriction-modification system StyLTI en 97.23
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 97.2
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 97.17
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 97.14
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 97.09
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 97.06
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 97.03
KOG0391|consensus 1958 97.02
KOG0334|consensus 997 96.96
KOG0345|consensus 567 96.94
KOG0336|consensus 629 96.88
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 96.87
KOG0388|consensus 1185 96.81
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 96.77
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 96.77
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 96.75
KOG1805|consensus 1100 96.75
TIGR02768 744 TraA_Ti Ti-type conjugative transfer relaxase TraA 96.72
PRK13889 988 conjugal transfer relaxase TraA; Provisional 96.7
KOG0391|consensus 1958 96.63
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 96.61
PRK01172 674 ski2-like helicase; Provisional 96.6
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 96.56
KOG0346|consensus 569 96.5
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 96.41
KOG0342|consensus 543 96.39
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.35
PRK04296190 thymidine kinase; Provisional 96.3
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 96.26
KOG0388|consensus1185 96.18
PRK06090319 DNA polymerase III subunit delta'; Validated 96.12
KOG0343|consensus 758 96.06
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 96.06
PRK13767 876 ATP-dependent helicase; Provisional 96.0
PRK13826 1102 Dtr system oriT relaxase; Provisional 95.96
PRK05707328 DNA polymerase III subunit delta'; Validated 95.95
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 95.89
KOG0339|consensus 731 95.85
KOG0353|consensus 695 95.84
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 95.8
KOG0326|consensus459 95.74
KOG2340|consensus698 95.71
PRK00254 720 ski2-like helicase; Provisional 95.67
PF1324576 AAA_19: Part of AAA domain 95.59
KOG1132|consensus 945 95.59
smart00488289 DEXDc2 DEAD-like helicases superfamily. 95.57
smart00489289 DEXDc3 DEAD-like helicases superfamily. 95.57
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 95.56
KOG0335|consensus 482 95.55
KOG1802|consensus 935 95.54
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 95.5
PRK08769319 DNA polymerase III subunit delta'; Validated 95.5
KOG0344|consensus 593 95.49
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 95.46
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 95.43
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 95.35
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 95.32
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 95.25
PRK09401 1176 reverse gyrase; Reviewed 95.25
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 95.14
PRK14701 1638 reverse gyrase; Provisional 95.14
PRK06871325 DNA polymerase III subunit delta'; Validated 95.13
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 95.11
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 95.08
PHA03368 738 DNA packaging terminase subunit 1; Provisional 95.06
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 94.96
PRK06964342 DNA polymerase III subunit delta'; Validated 94.96
KOG0352|consensus 641 94.92
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 94.8
COG1444 758 Predicted P-loop ATPase fused to an acetyltransfer 94.78
PLN03025319 replication factor C subunit; Provisional 94.72
TIGR00376 637 DNA helicase, putative. The gene product may repre 94.72
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 94.68
KOG1015|consensus 1567 94.61
PRK08727233 hypothetical protein; Validated 94.6
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 94.53
PHA03333 752 putative ATPase subunit of terminase; Provisional 94.51
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 94.47
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 94.46
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 94.41
PRK00440319 rfc replication factor C small subunit; Reviewed 94.41
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 94.4
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 94.38
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 94.32
KOG0340|consensus 442 94.23
KOG0948|consensus 1041 94.09
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 94.08
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 94.05
cd01124187 KaiC KaiC is a circadian clock protein primarily f 94.01
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 94.0
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 93.78
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 93.77
KOG0333|consensus 673 93.74
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 93.74
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 93.58
PRK07940394 DNA polymerase III subunit delta'; Validated 93.53
KOG0351|consensus 941 93.48
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 93.39
PHA02533 534 17 large terminase protein; Provisional 93.32
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 93.29
PRK06526254 transposase; Provisional 93.26
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 93.24
PRK14974336 cell division protein FtsY; Provisional 93.15
KOG1015|consensus 1567 93.06
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 93.06
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 93.05
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 93.05
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 93.05
KOG0991|consensus333 93.01
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 92.92
PRK10536262 hypothetical protein; Provisional 92.91
PRK07993334 DNA polymerase III subunit delta'; Validated 92.9
PRK05973237 replicative DNA helicase; Provisional 92.82
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 92.77
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 92.68
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 92.66
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 92.61
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 92.57
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 92.54
PRK06893229 DNA replication initiation factor; Validated 92.51
PHA02544316 44 clamp loader, small subunit; Provisional 92.42
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 92.41
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 92.34
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 92.3
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 92.25
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 92.18
PRK04195 482 replication factor C large subunit; Provisional 92.09
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 92.08
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 92.05
PRK08084235 DNA replication initiation factor; Provisional 92.01
PF00004132 AAA: ATPase family associated with various cellula 91.99
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 91.99
KOG0989|consensus346 91.96
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 91.91
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 91.84
KOG1133|consensus821 91.79
PTZ00293211 thymidine kinase; Provisional 91.77
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 91.74
COG1202 830 Superfamily II helicase, archaea-specific [General 91.73
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 91.65
KOG0347|consensus 731 91.61
PRK12422445 chromosomal replication initiation protein; Provis 91.41
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 91.33
KOG0354|consensus 746 91.24
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 91.18
PRK00149450 dnaA chromosomal replication initiation protein; R 91.13
KOG4284|consensus 980 91.1
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 91.1
PRK08116268 hypothetical protein; Validated 91.01
PF03354 477 Terminase_1: Phage Terminase ; InterPro: IPR005021 91.01
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 90.95
PRK14088440 dnaA chromosomal replication initiation protein; P 90.94
PRK08181269 transposase; Validated 90.8
PRK06835329 DNA replication protein DnaC; Validated 90.72
KOG0947|consensus 1248 90.64
PRK10689 1147 transcription-repair coupling factor; Provisional 90.57
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 90.55
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 90.54
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 90.46
smart00492141 HELICc3 helicase superfamily c-terminal domain. 90.34
PRK13342413 recombination factor protein RarA; Reviewed 90.21
PRK09112351 DNA polymerase III subunit delta'; Validated 90.18
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 90.17
TIGR00362405 DnaA chromosomal replication initiator protein Dna 90.11
PRK10865 857 protein disaggregation chaperone; Provisional 90.03
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 89.92
cd0152490 RHOD_Pyr_redox Member of the Rhodanese Homology Do 89.79
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 89.77
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 89.75
KOG1001|consensus 674 89.57
KOG0337|consensus 529 89.44
PRK06921266 hypothetical protein; Provisional 89.38
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 89.37
PHA02558 501 uvsW UvsW helicase; Provisional 89.35
PRK14087450 dnaA chromosomal replication initiation protein; P 89.34
KOG0327|consensus397 89.26
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 89.05
PRK05642234 DNA replication initiation factor; Validated 88.95
PRK13341 725 recombination factor protein RarA/unknown domain f 88.84
KOG0350|consensus 620 88.8
PRK08699325 DNA polymerase III subunit delta'; Validated 88.78
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 88.73
COG2256 436 MGS1 ATPase related to the helicase subunit of the 88.72
COG3587 985 Restriction endonuclease [Defense mechanisms] 88.34
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 88.32
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 88.11
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 87.91
PRK08903227 DnaA regulatory inactivator Hda; Validated 87.87
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 87.76
CHL00095 821 clpC Clp protease ATP binding subunit 87.71
COG1205 851 Distinct helicase family with a unique C-terminal 87.5
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 87.44
smart00491142 HELICc2 helicase superfamily c-terminal domain. 87.21
COG0470325 HolB ATPase involved in DNA replication [DNA repli 87.2
PRK08058329 DNA polymerase III subunit delta'; Validated 87.14
COG0553 866 HepA Superfamily II DNA/RNA helicases, SNF2 family 87.11
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 86.97
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 86.74
KOG0341|consensus 610 86.73
PRK07399314 DNA polymerase III subunit delta'; Validated 86.68
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 86.63
PF02456369 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR 86.54
KOG0701|consensus 1606 86.41
cd01523100 RHOD_Lact_B Member of the Rhodanese Homology Domai 86.3
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 86.25
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 86.25
KOG0328|consensus400 86.23
PRK07952244 DNA replication protein DnaC; Validated 86.2
COG4626 546 Phage terminase-like protein, large subunit [Gener 86.07
KOG0329|consensus387 86.04
PRK11054 684 helD DNA helicase IV; Provisional 85.77
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 85.66
PF00265176 TK: Thymidine kinase; InterPro: IPR001267 Thymidin 85.59
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 85.5
KOG2028|consensus 554 85.44
KOG2228|consensus408 85.32
PF00154322 RecA: recA bacterial DNA recombination protein; In 85.24
COG2874235 FlaH Predicted ATPases involved in biogenesis of a 85.2
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 84.83
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 84.76
PTZ001121164 origin recognition complex 1 protein; Provisional 84.72
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 84.56
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 84.51
cd0152996 4RHOD_Repeats Member of the Rhodanese Homology Dom 84.47
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 84.1
PHA00350 399 putative assembly protein 84.06
PRK06067234 flagellar accessory protein FlaH; Validated 84.05
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 84.02
PRK04841 903 transcriptional regulator MalT; Provisional 83.99
PRK14086617 dnaA chromosomal replication initiation protein; P 83.96
cd01518101 RHOD_YceA Member of the Rhodanese Homology Domain 83.81
KOG1016|consensus 1387 83.71
COG1484254 DnaC DNA replication protein [DNA replication, rec 83.58
TIGR02012321 tigrfam_recA protein RecA. This model describes or 83.53
PF13871 278 Helicase_C_4: Helicase_C-like 83.5
PRK13833323 conjugal transfer protein TrbB; Provisional 83.47
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 83.34
KOG0349|consensus 725 83.25
PRK11823 446 DNA repair protein RadA; Provisional 83.14
PF05876 557 Terminase_GpA: Phage terminase large subunit (GpA) 83.13
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 83.06
PRK12377248 putative replication protein; Provisional 83.0
KOG0741|consensus744 82.52
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 82.44
smart00450100 RHOD Rhodanese Homology Domain. An alpha beta fold 82.38
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 82.23
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 82.21
PRK00771437 signal recognition particle protein Srp54; Provisi 82.14
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 81.34
cd00983325 recA RecA is a bacterial enzyme which has roles in 81.27
PRK08760476 replicative DNA helicase; Provisional 81.25
cd01526122 RHOD_ThiF Member of the Rhodanese Homology Domain 81.18
PRK09354349 recA recombinase A; Provisional 81.11
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 80.9
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 80.65
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 80.52
COG2255332 RuvB Holliday junction resolvasome, helicase subun 80.47
COG1618179 Predicted nucleotide kinase [Nucleotide transport 80.42
PRK05595444 replicative DNA helicase; Provisional 80.41
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 80.34
cd0144496 GlpE_ST GlpE sulfurtransferase (ST) and homologs a 80.25
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 80.01
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information 
Probab=100.00  E-value=9.7e-55  Score=418.09  Aligned_cols=298  Identities=41%  Similarity=0.693  Sum_probs=258.8

Q ss_pred             CCCCCcHHHHHHHHHhcCCCCCChhHHHHHHHHhcCCCeEEEcCCCCCchHHHHHHHHhcCCCCCCCcchHHHHHHHhcC
Q psy4493           3 PNYPWSDRVRSVLKSKFNLTDFRPNQLAAINIALLKKDAIIIMPTDYPWSDRVRSVLKSKFNLTDFRPNQLAAINIALLK   82 (323)
Q Consensus         3 ~~~~~~~~~~~~l~~~~~~~~~~~~Q~~~~~~~~~~~~~~~~~~tg~gkt~~~~~~l~~~~g~~~~~~~Q~~~i~~~~~~   82 (323)
                      .+|||+.++...+++.||+..|||.|.++++.++.++|+++++|||+|||.+                +|   +|++..+
T Consensus       440 ~~fpw~~~L~~~lk~~FG~~sFRp~Q~eaI~aiL~GrDVLVimPTGSGKSLc----------------YQ---LPAL~~~  500 (1195)
T PLN03137        440 RNFPWTKKLEVNNKKVFGNHSFRPNQREIINATMSGYDVFVLMPTGGGKSLT----------------YQ---LPALICP  500 (1195)
T ss_pred             cCCCchHHHHHHHHHHcCCCCCCHHHHHHHHHHHcCCCEEEEcCCCccHHHH----------------HH---HHHHHcC
Confidence            3699999999999999999999999999999999999999999999999955                34   4455566


Q ss_pred             CcEEEEccchh-------hhhhcCee---e----------------eccCCCeeEEEEcccccccchhHHHHHHHHHhhC
Q psy4493          83 KDAIIIMPTGK-------LLKKKKIC---L----------------MTESSSLKLLYVSPEKLAKSKSFMTKLQKMYKAG  136 (323)
Q Consensus        83 ~~~lv~~pTgs-------~l~~~~i~---l----------------~~~~~~~~vii~Tp~~l~~~~~~~~~l~~~~~~~  136 (323)
                      .-+||++|+.+       .+...|+.   +                ....+.++|+|+|||++.....+...+.......
T Consensus       501 GiTLVISPLiSLmqDQV~~L~~~GI~Aa~L~s~~s~~eq~~ilr~l~s~~g~~~ILyvTPERL~~~d~ll~~L~~L~~~~  580 (1195)
T PLN03137        501 GITLVISPLVSLIQDQIMNLLQANIPAASLSAGMEWAEQLEILQELSSEYSKYKLLYVTPEKVAKSDSLLRHLENLNSRG  580 (1195)
T ss_pred             CcEEEEeCHHHHHHHHHHHHHhCCCeEEEEECCCCHHHHHHHHHHHHhcCCCCCEEEEChHHhhcchHHHHHHHhhhhcc
Confidence            77999999999       34455665   2                1122678999999999975444555555544456


Q ss_pred             CcceEEEeccccccccCCCchHHHHhHHHHHhhCCCCCEEEEeecCChhHHHHHHHHhCCCCcEEEecCCCCCCceeEEE
Q psy4493         137 CLARIAIDEVHCCSSWGHDFRPDYQYLSILKTMFPDVPILGLTATATTKVMLDVQKMLQIEDCVVIKAPFNRPNLFYEVR  216 (323)
Q Consensus       137 ~v~~vVvDEah~~~~~~~~~r~~~~~l~~l~~~~~~~~~i~lSAT~~~~~~~~i~~~l~~~~~~~~~~~~~~~~~~~~~~  216 (323)
                      .+.+|||||||++++||++||+.|..|..++..+++.|+++||||+++...+++.+.|++.++.++..+++++|+.|.+.
T Consensus       581 ~LslIVIDEAHcVSqWGhDFRpdYr~L~~Lr~~fp~vPilALTATAT~~V~eDI~~~L~l~~~~vfr~Sf~RpNL~y~Vv  660 (1195)
T PLN03137        581 LLARFVIDEAHCVSQWGHDFRPDYQGLGILKQKFPNIPVLALTATATASVKEDVVQALGLVNCVVFRQSFNRPNLWYSVV  660 (1195)
T ss_pred             ccceeccCcchhhhhcccchHHHHHHHHHHHHhCCCCCeEEEEecCCHHHHHHHHHHcCCCCcEEeecccCccceEEEEe
Confidence            79999999999999999999999999999999999999999999999999999999999999999999999999998877


Q ss_pred             ecCCchhHHHHHHHHHHHhhcCCCcEEEEeCChhHHHHHHHHHHhCCCeEEeecCCCCCCc------------------c
Q psy4493         217 IKPAAQKDCLDELADLMSRRFRNQSGIIYTTSIKECEDLREELRNRGLRVSAYHAKLESNV------------------S  278 (323)
Q Consensus       217 ~~~~~~~~~~~~l~~~l~~~~~~~~~iVF~~s~~~~~~l~~~L~~~~~~v~~~h~~~~~~~------------------T  278 (323)
                      ...   ......+.+++.....+.++||||+|+++|+.+++.|.+.|+++..|||+|++++                  |
T Consensus       661 ~k~---kk~le~L~~~I~~~~~~esgIIYC~SRke~E~LAe~L~~~Gika~~YHAGLs~eeR~~vqe~F~~Gei~VLVAT  737 (1195)
T PLN03137        661 PKT---KKCLEDIDKFIKENHFDECGIIYCLSRMDCEKVAERLQEFGHKAAFYHGSMDPAQRAFVQKQWSKDEINIICAT  737 (1195)
T ss_pred             ccc---hhHHHHHHHHHHhcccCCCceeEeCchhHHHHHHHHHHHCCCCeeeeeCCCCHHHHHHHHHHHhcCCCcEEEEe
Confidence            543   2234567777765445678999999999999999999999999999999999988                  9


Q ss_pred             eeeecccccCCccEEEEccCCCCHhHHHHHhccCCCCCCCCCCC
Q psy4493         279 IAFGLGIDKPNVRFVIHHCLSKSMENFYQVSIAFGLGKHSFRSR  322 (323)
Q Consensus       279 ~~~~~Gid~~~v~~Vi~~~~p~~~~~~~qr~GR~gR~g~~g~~~  322 (323)
                      +++++|||+|+|++|||||+|+++..|+||+|||||+|+.|.|+
T Consensus       738 dAFGMGIDkPDVR~VIHydlPkSiEsYyQriGRAGRDG~~g~cI  781 (1195)
T PLN03137        738 VAFGMGINKPDVRFVIHHSLPKSIEGYHQECGRAGRDGQRSSCV  781 (1195)
T ss_pred             chhhcCCCccCCcEEEEcCCCCCHHHHHhhhcccCCCCCCceEE
Confidence            99999999999999999999999999999999999999999987

>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>KOG1131|consensus Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG1805|consensus Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>KOG2340|consensus Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>KOG1132|consensus Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG1133|consensus Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>PF02456 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging [] Back     alignment and domain information
>KOG0701|consensus Back     alignment and domain information
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>COG4626 Phage terminase-like protein, large subunit [General function prediction only] Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00265 TK: Thymidine kinase; InterPro: IPR001267 Thymidine kinase (TK) (2 Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>KOG2228|consensus Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PHA00350 putative assembly protein Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>KOG1016|consensus Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>smart00450 RHOD Rhodanese Homology Domain Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query323
2v1x_A 591 Crystal Structure Of Human Recq-Like Dna Helicase L 3e-74
1oyy_A 523 Structure Of The Recq Catalytic Core Bound To Atp-G 3e-41
1oyw_A 523 Structure Of The Recq Catalytic Core Length = 523 3e-40
>pdb|2V1X|A Chain A, Crystal Structure Of Human Recq-Like Dna Helicase Length = 591 Back     alignment and structure 
Iteration: 1

 Score =  275 bits (702), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 141/335 (42%), Positives = 193/335 (57%), Gaps = 69/335 (20%)
Query: 48  DYPWSDRVRSVLKSKFNLTDFRPNQLAAINIALLKKDAIIIMPTGK-------------- 93
           D+PWS +V+ +L++ F L  FRP QL  IN+ +  K+  ++MPTG               
Sbjct: 25  DFPWSGKVKDILQNVFKLEKFRPLQLETINVTMAGKEVFLVMPTGGGKSLCYQLPALCSD 84
Query: 94  ------------------LLKKKKIC-------------------LMTESSSLKLLYVSP 116
                             +LK+  I                    ++ ++S LKL+YV+P
Sbjct: 85  GFTLVICPLISLMEDQLMVLKQLGISATMLNASSSKEHVKWVHAEMVNKNSELKLIYVTP 144
Query: 117 EKLAKSKSFMTKLQKMYKAGCLARIAIDEVHCCSSWGHDFRPDYQYLSILKTMFPDVPIL 176
           EK+AKSK FM++L+K Y+A    RIA+DEVHCCS WGHDFRPDY+ L ILK  FP+  ++
Sbjct: 145 EKIAKSKMFMSRLEKAYEARRFTRIAVDEVHCCSQWGHDFRPDYKALGILKRQFPNASLI 204
Query: 177 GLTATATTKVMLDVQKMLQIEDCVVIKAPFNRPNLFYEVRIKPAAQKDCLDELADLMSRR 236
           GLTATAT  V+ D QK+L IE C    A FNRPNL+YEVR KP+  +D ++++  L++ R
Sbjct: 205 GLTATATNHVLTDAQKILCIEKCFTFTASFNRPNLYYEVRQKPSNTEDFIEDIVKLINGR 264
Query: 237 FRNQSGIIYTTSIKECEDLREELRNRGLRVSAYHAKLESN------------------VS 278
           ++ QSGIIY  S K+ E +   L+N G+   AYHA LE                     +
Sbjct: 265 YKGQSGIIYCFSQKDSEQVTVSLQNLGIHAGAYHANLEPEDKTTVHRKWSANEIQVVVAT 324
Query: 279 IAFGLGIDKPNVRFVIHHCLSKSMENFYQVSIAFG 313
           +AFG+GIDKP+VRFVIHH +SKSMEN+YQ S   G
Sbjct: 325 VAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRAG 359
>pdb|1OYY|A Chain A, Structure Of The Recq Catalytic Core Bound To Atp-Gamma-S Length = 523 Back     alignment and structure
>pdb|1OYW|A Chain A, Structure Of The Recq Catalytic Core Length = 523 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query323
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 1e-132
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 6e-14
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 7e-84
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 5e-04
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Length = 591 Back     alignment and structure
 Score =  388 bits (998), Expect = e-132
 Identities = 141/330 (42%), Positives = 192/330 (58%), Gaps = 69/330 (20%)

Query: 47  TDYPWSDRVRSVLKSKFNLTDFRPNQLAAINIALLKKDAIIIMPT--GK----------- 93
            D+PWS +V+ +L++ F L  FRP QL  IN+ +  K+  ++MPT  GK           
Sbjct: 24  EDFPWSGKVKDILQNVFKLEKFRPLQLETINVTMAGKEVFLVMPTGGGKSLCYQLPALCS 83

Query: 94  ------------L-------LKKKKIC-------------------LMTESSSLKLLYVS 115
                       L       LK+  I                    ++ ++S LKL+YV+
Sbjct: 84  DGFTLVICPLISLMEDQLMVLKQLGISATMLNASSSKEHVKWVHAEMVNKNSELKLIYVT 143

Query: 116 PEKLAKSKSFMTKLQKMYKAGCLARIAIDEVHCCSSWGHDFRPDYQYLSILKTMFPDVPI 175
           PEK+AKSK FM++L+K Y+A    RIA+DEVHCCS WGHDFRPDY+ L ILK  FP+  +
Sbjct: 144 PEKIAKSKMFMSRLEKAYEARRFTRIAVDEVHCCSQWGHDFRPDYKALGILKRQFPNASL 203

Query: 176 LGLTATATTKVMLDVQKMLQIEDCVVIKAPFNRPNLFYEVRIKPAAQKDCLDELADLMSR 235
           +GLTATAT  V+ D QK+L IE C    A FNRPNL+YEVR KP+  +D ++++  L++ 
Sbjct: 204 IGLTATATNHVLTDAQKILCIEKCFTFTASFNRPNLYYEVRQKPSNTEDFIEDIVKLING 263

Query: 236 RFRNQSGIIYTTSIKECEDLREELRNRGLRVSAYHAKLESNV------------------ 277
           R++ QSGIIY  S K+ E +   L+N G+   AYHA LE                     
Sbjct: 264 RYKGQSGIIYCFSQKDSEQVTVSLQNLGIHAGAYHANLEPEDKTTVHRKWSANEIQVVVA 323

Query: 278 SIAFGLGIDKPNVRFVIHHCLSKSMENFYQ 307
           ++AFG+GIDKP+VRFVIHH +SKSMEN+YQ
Sbjct: 324 TVAFGMGIDKPDVRFVIHHSMSKSMENYYQ 353
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Length = 591 Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Length = 523 Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Length = 523 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query323
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 100.0
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 100.0
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 100.0
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 100.0
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 100.0
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 100.0
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 100.0
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 100.0
4gl2_A 699 Interferon-induced helicase C domain-containing P; 100.0
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 100.0
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 100.0
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 100.0
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 99.98
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.98
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.98
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.97
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.97
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.97
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.97
3h1t_A590 Type I site-specific restriction-modification syst 99.97
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.97
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.97
1yks_A 440 Genome polyprotein [contains: flavivirin protease 99.97
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.97
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.96
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 99.96
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 99.96
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.96
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.96
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 99.96
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.95
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.95
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.92
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 99.9
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.9
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.88
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.88
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.87
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.86
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.86
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.86
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.86
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.86
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.86
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.86
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.85
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.85
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.85
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.85
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.84
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.84
3bor_A237 Human initiation factor 4A-II; translation initiat 99.84
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.84
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.83
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.83
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.83
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 99.83
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.83
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.71
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.81
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.81
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.81
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.77
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.63
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.61
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.58
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.57
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.53
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.52
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.3
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.22
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 97.89
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 97.89
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 97.89
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 97.86
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 97.86
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 97.82
3bor_A237 Human initiation factor 4A-II; translation initiat 97.82
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 97.76
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 97.76
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 97.74
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 97.7
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.69
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 97.68
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 97.67
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 97.67
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 97.62
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 97.57
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 97.56
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 97.56
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 97.49
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 97.48
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 97.47
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.46
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 97.42
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 97.41
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 97.38
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 97.32
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 97.3
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 97.3
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 97.29
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 97.29
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 97.27
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 97.25
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 97.19
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 97.06
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 96.94
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 96.92
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 96.72
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 96.31
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 96.02
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 96.0
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 95.76
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 95.6
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 95.6
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 95.53
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 95.5
2chg_A226 Replication factor C small subunit; DNA-binding pr 95.44
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 95.43
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 95.42
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 95.4
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 95.4
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 95.29
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 95.14
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enz 95.12
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 95.02
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 94.92
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 94.9
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 94.76
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 94.56
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 94.29
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 94.23
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 94.14
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 93.94
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 93.82
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 93.8
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 93.49
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 93.23
3cpe_A 592 Terminase, DNA packaging protein GP17; large termi 93.16
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 93.02
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 92.99
3b6e_A216 Interferon-induced helicase C domain-containing P; 92.68
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 92.25
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 92.21
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 92.19
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 91.61
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 91.53
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 91.46
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 91.46
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 91.32
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 90.57
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 90.42
2kjq_A149 DNAA-related protein; solution structure, NESG, st 90.28
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 90.27
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 89.86
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 88.96
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 88.63
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 88.49
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 88.36
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 88.19
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 88.16
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 88.12
3bos_A242 Putative DNA replication factor; P-loop containing 87.99
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 87.83
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 87.67
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 87.48
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 87.3
2jtq_A85 Phage shock protein E; solution structure rhodanes 87.23
1xp8_A366 RECA protein, recombinase A; recombination, radior 86.96
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 86.95
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 86.8
3foj_A100 Uncharacterized protein; protein SSP1007, structur 86.62
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 86.48
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 86.36
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 86.03
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 85.8
4gl2_A 699 Interferon-induced helicase C domain-containing P; 85.79
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 85.72
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 85.61
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 85.43
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 85.3
2r6a_A454 DNAB helicase, replicative helicase; replication, 85.3
3iwh_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 85.05
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 84.88
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 83.64
3pvs_A 447 Replication-associated recombination protein A; ma 83.58
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 83.58
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 83.45
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 83.22
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 82.79
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 82.31
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 82.26
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 82.12
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 81.94
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 81.55
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 80.56
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 80.37
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 80.09
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
Probab=100.00  E-value=2.5e-52  Score=395.40  Aligned_cols=300  Identities=48%  Similarity=0.821  Sum_probs=268.8

Q ss_pred             CCCCcHHHHHHHHHhcCCCCCChhHHHHHHHHhcCCCeEEEcCCCCCchHHHHHHHHhcCCCCCCCcchHHHHHHHhcCC
Q psy4493           4 NYPWSDRVRSVLKSKFNLTDFRPNQLAAINIALLKKDAIIIMPTDYPWSDRVRSVLKSKFNLTDFRPNQLAAINIALLKK   83 (323)
Q Consensus         4 ~~~~~~~~~~~l~~~~~~~~~~~~Q~~~~~~~~~~~~~~~~~~tg~gkt~~~~~~l~~~~g~~~~~~~Q~~~i~~~~~~~   83 (323)
                      +|||+.++.+.|++.||+..|||.|.++++.++.++++++++|||+|||..                +|   +|++..+.
T Consensus        25 ~~~l~~~l~~~L~~~fg~~~~rp~Q~~~i~~il~g~d~lv~~pTGsGKTl~----------------~~---lpal~~~g   85 (591)
T 2v1x_A           25 DFPWSGKVKDILQNVFKLEKFRPLQLETINVTMAGKEVFLVMPTGGGKSLC----------------YQ---LPALCSDG   85 (591)
T ss_dssp             CSTTHHHHHHHHHHTSCCCSCCTTHHHHHHHHHTTCCEEEECCTTSCTTHH----------------HH---HHHHTSSS
T ss_pred             cCCCCHHHHHHHHHHhCCCCCCHHHHHHHHHHHcCCCEEEEECCCChHHHH----------------HH---HHHHHcCC
Confidence            589999999999999999999999999999999999999999999999954                22   44455566


Q ss_pred             cEEEEccchh-------hhhhcCeee-------------------eccCCCeeEEEEcccccccchhHHHHHHHHHhhCC
Q psy4493          84 DAIIIMPTGK-------LLKKKKICL-------------------MTESSSLKLLYVSPEKLAKSKSFMTKLQKMYKAGC  137 (323)
Q Consensus        84 ~~lv~~pTgs-------~l~~~~i~l-------------------~~~~~~~~vii~Tp~~l~~~~~~~~~l~~~~~~~~  137 (323)
                      .++|++||.+       .+...|+..                   ....+..+|+|+||++|..+..+.+.+.......+
T Consensus        86 ~~lVisP~~~L~~q~~~~l~~~gi~~~~l~~~~~~~~~~~~~~~l~~~~~~~~Ilv~Tpe~L~~~~~~~~~l~~~~~~~~  165 (591)
T 2v1x_A           86 FTLVICPLISLMEDQLMVLKQLGISATMLNASSSKEHVKWVHAEMVNKNSELKLIYVTPEKIAKSKMFMSRLEKAYEARR  165 (591)
T ss_dssp             EEEEECSCHHHHHHHHHHHHHHTCCEEECCSSCCHHHHHHHHHHHHCTTCCCCEEEECHHHHHSCHHHHHHHHHHHHTTC
T ss_pred             cEEEEeCHHHHHHHHHHHHHhcCCcEEEEeCCCCHHHHHHHHHHhhcccCCCCEEEEChhHhhccHHHHHHHHhhhhccC
Confidence            7999999999       555556651                   01356789999999999765577777777777789


Q ss_pred             cceEEEeccccccccCCCchHHHHhHHHHHhhCCCCCEEEEeecCChhHHHHHHHHhCCCCcEEEecCCCCCCceeEEEe
Q psy4493         138 LARIAIDEVHCCSSWGHDFRPDYQYLSILKTMFPDVPILGLTATATTKVMLDVQKMLQIEDCVVIKAPFNRPNLFYEVRI  217 (323)
Q Consensus       138 v~~vVvDEah~~~~~~~~~r~~~~~l~~l~~~~~~~~~i~lSAT~~~~~~~~i~~~l~~~~~~~~~~~~~~~~~~~~~~~  217 (323)
                      +++|||||||++.+||++|++.|..+..++..+++.++++||||+++...+++.+++++..+..+..+..++++.|.+..
T Consensus       166 i~~iViDEAH~is~~g~dfr~~~~~l~~l~~~~~~~~ii~lSAT~~~~v~~~i~~~l~~~~~~~~~~~~~r~nl~~~v~~  245 (591)
T 2v1x_A          166 FTRIAVDEVHCCSQWGHDFRPDYKALGILKRQFPNASLIGLTATATNHVLTDAQKILCIEKCFTFTASFNRPNLYYEVRQ  245 (591)
T ss_dssp             EEEEEEETGGGGSTTCTTCCGGGGGGGHHHHHCTTSEEEEEESSCCHHHHHHHHHHTTCCSCEEEECCCCCTTEEEEEEE
T ss_pred             CcEEEEECcccccccccccHHHHHHHHHHHHhCCCCcEEEEecCCCHHHHHHHHHHhCCCCcEEEecCCCCcccEEEEEe
Confidence            99999999999999999999999998889888899999999999999999999999999999989999999999999888


Q ss_pred             cCCchhHHHHHHHHHHHhhcCCCcEEEEeCChhHHHHHHHHHHhCCCeEEeecCCCCCCc------------------ce
Q psy4493         218 KPAAQKDCLDELADLMSRRFRNQSGIIYTTSIKECEDLREELRNRGLRVSAYHAKLESNV------------------SI  279 (323)
Q Consensus       218 ~~~~~~~~~~~l~~~l~~~~~~~~~iVF~~s~~~~~~l~~~L~~~~~~v~~~h~~~~~~~------------------T~  279 (323)
                      ......++...+.+++.....+.++||||+|++.|+.+++.|.+.|+.+..|||+|++++                  |+
T Consensus       246 ~~~~~~~~~~~l~~~l~~~~~~~~~IVf~~sr~~~e~la~~L~~~g~~~~~~h~~l~~~~R~~~~~~F~~g~~~VlVAT~  325 (591)
T 2v1x_A          246 KPSNTEDFIEDIVKLINGRYKGQSGIIYCFSQKDSEQVTVSLQNLGIHAGAYHANLEPEDKTTVHRKWSANEIQVVVATV  325 (591)
T ss_dssp             CCSSHHHHHHHHHHHHTTTTTTCEEEEECSSHHHHHHHHHHHHHTTCCEEEECTTSCHHHHHHHHHHHHTTSSSEEEECT
T ss_pred             CCCcHHHHHHHHHHHHHHhccCCCeEEEeCcHHHHHHHHHHHHHCCCCEEEecCCCCHHHHHHHHHHHHcCCCeEEEEec
Confidence            777677788899999876567889999999999999999999999999999999999887                  99


Q ss_pred             eeecccccCCccEEEEccCCCCHhHHHHHhccCCCCCCCCCCC
Q psy4493         280 AFGLGIDKPNVRFVIHHCLSKSMENFYQVSIAFGLGKHSFRSR  322 (323)
Q Consensus       280 ~~~~Gid~~~v~~Vi~~~~p~~~~~~~qr~GR~gR~g~~g~~~  322 (323)
                      ++++|+|+|+|++||++|+|.|...|+||+||+||.|++|.|+
T Consensus       326 a~~~GID~p~V~~VI~~~~p~s~~~y~Qr~GRaGR~G~~g~~i  368 (591)
T 2v1x_A          326 AFGMGIDKPDVRFVIHHSMSKSMENYYQESGRAGRDDMKADCI  368 (591)
T ss_dssp             TSCTTCCCSCEEEEEESSCCSSHHHHHHHHTTSCTTSSCEEEE
T ss_pred             hhhcCCCcccccEEEEeCCCCCHHHHHHHhccCCcCCCCceEE
Confidence            9999999999999999999999999999999999999999886
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 323
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 6e-25
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 1e-07
d1a1va2 299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 3e-07
d1oywa3200 c.37.1.19 (A:207-406) RecQ helicase domain {Escher 4e-07
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 1e-06
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 5e-06
d2fz4a1206 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Arc 0.002
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 0.004
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: RecQ helicase domain
species: Escherichia coli [TaxId: 562]

 Score = 97.8 bits (242), Expect = 6e-25
 Identities = 48/201 (23%), Positives = 83/201 (41%), Gaps = 10/201 (4%)

Query: 6   PWSDRVRSVLKSKFNLTDFRPNQLAAINIALLKKDAIIIMPT-----DYPWSDRVRSVLK 60
                 + VL+  F    FRP Q   I+  L  +D +++MPT            +     
Sbjct: 8   NLESGAKQVLQETFGYQQFRPGQEEIIDTVLSGRDCLVVMPTGGGKSLCYQIPALLLNGL 67

Query: 61  SKFNLTDFRPNQLAAINIALLKKDAIIIMPTGKLLKKKKICLMTESSSLKLLYVSPEKLA 120
           +          +     +      A  +  T    ++ ++     +  ++LLY++PE+L 
Sbjct: 68  TVVVSPLISLMKDQVDQLQANGVAAACLNSTQTREQQLEVMTGCRTGQIRLLYIAPERLM 127

Query: 121 KSKSFMTKLQKMYKAGCLARIAIDEVHCCSSWGHDFRPDYQYLSILKTMFPDVPILGLTA 180
                     +         +A+DE HC S WGHDFRP+Y  L  L+  FP +P + LTA
Sbjct: 128 LDNFL-----EHLAHWNPVLLAVDEAHCISQWGHDFRPEYAALGQLRQRFPTLPFMALTA 182

Query: 181 TATTKVMLDVQKMLQIEDCVV 201
           TA      D+ ++L + D ++
Sbjct: 183 TADDTTRQDIVRLLGLNDPLI 203
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 206 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query323
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.96
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.94
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.93
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.91
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.91
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.91
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.9
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.89
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.89
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.87
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.87
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.86
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.86
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.85
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.84
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.84
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.84
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.84
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.83
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.83
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.79
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.76
d1a1va2 299 HCV helicase domain {Human hepatitis C virus (HCV) 99.74
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.73
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.7
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.66
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.6
d1gkub2 248 Helicase-like "domain" of reverse gyrase {Archaeon 99.59
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.57
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.57
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.52
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.5
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.45
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.44
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.38
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.38
d1yksa2 299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.33
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 99.29
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.26
d1z3ix1 346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.14
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.1
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.85
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 98.83
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 98.7
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 98.65
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 98.62
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 98.61
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 98.46
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 98.44
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 98.4
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 98.17
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 98.16
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 98.16
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 98.09
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 97.97
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 97.93
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 97.21
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 96.03
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 95.73
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 95.16
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 95.09
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 94.98
d2qy9a2211 GTPase domain of the signal recognition particle r 94.92
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 94.74
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 94.35
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 94.21
d1okkd2207 GTPase domain of the signal recognition particle r 94.01
d1ls1a2207 GTPase domain of the signal sequence recognition p 93.74
d1vmaa2213 GTPase domain of the signal recognition particle r 93.62
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 93.33
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 93.3
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 93.23
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 92.84
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 92.8
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 92.71
d2eyqa2117 Transcription-repair coupling factor, TRCF {Escher 92.22
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 91.6
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 90.9
d1gmxa_108 Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 89.97
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 89.33
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 89.18
d1j8yf2211 GTPase domain of the signal sequence recognition p 88.84
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 88.8
d1yt8a4130 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 87.36
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 86.63
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 86.51
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 86.4
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 84.04
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 83.41
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 83.03
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 82.17
d1qxna_137 Polysulfide-sulfur transferase (sulfide dehydrogen 81.26
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 80.5
d1urha2120 3-mercaptopyruvate sulfurtransferase {Escherichia 80.49
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: Dengue virus helicase
species: Dengue virus type 2 [TaxId: 11060]

Probab=99.96  E-value=2e-30  Score=225.30  Aligned_cols=240  Identities=15%  Similarity=0.084  Sum_probs=157.5

Q ss_pred             hcCCCeEEEcCCCCCchHHHHHHHHhcCCCCCCCcchHHHHHHHhcCCcEEEEccchh-------hhhhcCeee------
Q psy4493          36 LLKKDAIIIMPTDYPWSDRVRSVLKSKFNLTDFRPNQLAAINIALLKKDAIIIMPTGK-------LLKKKKICL------  102 (323)
Q Consensus        36 ~~~~~~~~~~~tg~gkt~~~~~~l~~~~g~~~~~~~Q~~~i~~~~~~~~~lv~~pTgs-------~l~~~~i~l------  102 (323)
                      .++++.++.+|||+|||..+...+..            .+   +..+..+++++||.+       .+...++..      
T Consensus         7 ~~~~~~lv~~~TGsGKT~~~l~~~~~------------~~---~~~~~~~lvi~Ptr~La~q~~~~l~~~~~~~~~~~~~   71 (305)
T d2bmfa2           7 RKKRLTIMDLHPGAGKTKRYLPAIVR------------EA---IKRGLRTLILAPTRVVAAEMEEALRGLPIRYQTPAIR   71 (305)
T ss_dssp             STTCEEEECCCTTSSTTTTHHHHHHH------------HH---HHHTCCEEEEESSHHHHHHHHHHTTTSCCBCCC----
T ss_pred             hcCCcEEEEECCCCCHHHHHHHHHHH------------HH---HhcCCEEEEEccHHHHHHHHHHHHhcCCcceeeeEEe
Confidence            36788899999999999654322211            11   235778999999999       444444441      


Q ss_pred             eccCCCeeEEEEcccccccchhHHHHHHHHHhhCCcceEEEeccccccccCCCchHHHHhHHHHHhhCCCCCEEEEeecC
Q psy4493         103 MTESSSLKLLYVSPEKLAKSKSFMTKLQKMYKAGCLARIAIDEVHCCSSWGHDFRPDYQYLSILKTMFPDVPILGLTATA  182 (323)
Q Consensus       103 ~~~~~~~~vii~Tp~~l~~~~~~~~~l~~~~~~~~v~~vVvDEah~~~~~~~~~r~~~~~l~~l~~~~~~~~~i~lSAT~  182 (323)
                      ........++++||+.+..      .+.......+++++|+||||++..|+..++..   +..+.. .+..+++++|||+
T Consensus        72 ~~~~~~~~i~~~t~~~l~~------~~~~~~~~~~~~~vViDE~H~~~~~~~~~~~~---l~~~~~-~~~~~~v~~SAT~  141 (305)
T d2bmfa2          72 AEHTGREIVDLMCHATFTM------RLLSPIRVPNYNLIIMDEAHFTDPASIAARGY---ISTRVE-MGEAAGIFMTATP  141 (305)
T ss_dssp             ----CCCSEEEEEHHHHHH------HHTSSSCCCCCSEEEEESTTCCSHHHHHHHHH---HHHHHH-HTSCEEEEECSSC
T ss_pred             ecccCccccccCCcHHHHH------HHhcCccccceeEEEeeeeeecchhhHHHHHH---HHHhhc-cccceEEEeecCC
Confidence            2334567899999987752      33333445689999999999998765333322   222222 2478999999998


Q ss_pred             ChhHHHHHHHHhCCCCcEEEecCCCCCCceeEEEecCC-chhHHHHHHHHHHHhhcCCCcEEEEeCChhHHHHHHHHHHh
Q psy4493         183 TTKVMLDVQKMLQIEDCVVIKAPFNRPNLFYEVRIKPA-AQKDCLDELADLMSRRFRNQSGIIYTTSIKECEDLREELRN  261 (323)
Q Consensus       183 ~~~~~~~i~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~l~~~l~~~~~~~~~iVF~~s~~~~~~l~~~L~~  261 (323)
                      +.....    .. .....+...          ...... ....    ....+..  .+++++|||+++++|+.+++.|++
T Consensus       142 ~~~~~~----~~-~~~~~~~~~----------~~~~~~~~~~~----~~~~~~~--~~~~~lvf~~~~~~~~~l~~~L~~  200 (305)
T d2bmfa2         142 PGSRDP----FP-QSNAPIMDE----------EREIPERSWNS----GHEWVTD--FKGKTVWFVPSIKAGNDIAACLRK  200 (305)
T ss_dssp             TTCCCS----SC-CCSSCEEEE----------ECCCCCSCCSS----CCHHHHS--SCSCEEEECSCHHHHHHHHHHHHH
T ss_pred             Ccceee----ec-ccCCcceEE----------EEeccHHHHHH----HHHHHHh--hCCCEEEEeccHHHHHHHHHHHHh
Confidence            764310    10 111111111          000000 0010    1112222  568999999999999999999999


Q ss_pred             CCCeEEeecCCCCCCc--------------ceeeecccccCCccEEEE----------cc----------CCCCHhHHHH
Q psy4493         262 RGLRVSAYHAKLESNV--------------SIAFGLGIDKPNVRFVIH----------HC----------LSKSMENFYQ  307 (323)
Q Consensus       262 ~~~~v~~~h~~~~~~~--------------T~~~~~Gid~~~v~~Vi~----------~~----------~p~~~~~~~q  307 (323)
                      .|+++..+||++.+.+              |+++++|+|++ ++.||.          +|          .|.|..+|+|
T Consensus       201 ~~~~~~~l~~~~~~~~~~~~~~~~~~~lvaT~~~~~G~~~~-~~~Vi~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~Q  279 (305)
T d2bmfa2         201 NGKKVIQLSRKTFDSEYIKTRTNDWDFVVTTDISEMGANFK-AERVIDPRRCMKPVILTDGEERVILAGPMPVTHSSAAQ  279 (305)
T ss_dssp             HTCCCEECCTTCHHHHGGGGGTSCCSEEEECGGGGTTCCCC-CSEEEECCEEEEEEEECSSSCEEEEEEEEECCHHHHHH
T ss_pred             CCCCEEEeCCcChHHHHhhhhccchhhhhhhHHHHhcCCCC-ccEEEEcCCceeeeEecCCCCceEEeccccCCHHHHhh
Confidence            9999999999987665              99999999995 666553          33          3568899999


Q ss_pred             HhccCCCCCCCCCCC
Q psy4493         308 VSIAFGLGKHSFRSR  322 (323)
Q Consensus       308 r~GR~gR~g~~g~~~  322 (323)
                      |+||+||.|+.+...
T Consensus       280 r~GR~GR~~~~~~~~  294 (305)
T d2bmfa2         280 RRGRVGRNPKNENDQ  294 (305)
T ss_dssp             HHTTSSCSSSCCCEE
T ss_pred             hhcCcCcCCCCceEE
Confidence            999999999887653
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2eyqa2 c.37.1.19 (A:349-465) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure