Psyllid ID: psy4510


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810--
MNSVHLNSCPALEASNDIVDNDSDEDMEQGEESKDKTKPDESKEEKEKKTRKVYLPGTPLDKGESLVYDPSAYVMLHEAQTGAPCLSFDIIKDELGDERTAYPQTLYAVAGTQSKKFNFNRLIVMKMSNLTSTEEDNERELEDDENDPFQLAEHNKKRGKGPGIPTPPLFSFSGHLTEGFAMDWSSTEPGVLATGDCKRNIHIWTPREAGAWQVDQKPLGGHTNSAEDLQWSDLKTALQTVDDPFQLAEHNKKRGKGPGIPTPPLFSFSGHLTEGFAMDWSSTEPGVLATGDCKRNIHIWTPREAGAWQVDQKPLVGHTNSVEDLQWSPGEKRVLASCSVDLSIRIWDTRVINTKSCMLTLPNAHTSDVNVISWNRTEPLIVSGGDDGCIHVWDLRRFKKGSSVATFKHHTAPVTTVEWHPTESSTFASGGADDQIALWDLAVERDSEIEQREAELKDLPSQLLFIHLGQKEIKELHWHPQLPGTIISTANSGFNIFRTISDLPSQLLFIHLGQKEIKELHWHPQLPGTIISTANSGFNIFRTISMSNLTSTEEDNERELEDDESEGSGDEDRRKDPVMNSYFIRHRGCINRVRTCQYGSTTLAGVWGEVGKVGIWDLKTALQTVDDPFQLAEHNKKRGKGPGIPTPPLFSFSGHLTEGFAMDWSSTEPGVLATGDCKRNIHIWTPREAGAWSVYLYTNRFGVLATGDCKRNIHIWTPREAGAWQVDQKPLVGHTNSVEDLQWSPGEKRVLASCSVDRSNRIGARRDMLYCFFVSLVHCIFVWLKYQLFVDVYYWAFVDLVYYIFPDLHYFF
ccccccccccccccccccccccccccccccccccccccccHHHHHHccccccEEcccccccccccccccccHHEEEccccccccEEEEEEEccccccccccccccEEEEEEcccccccccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccEEEEcccccEEEEEEccccccEEEEEEccccEEEEcccccccccccccccccccccEEEEEEcccccEEEEEccccEEEEEcccccccccccccccEEEEcccccEEEEEEccccccEEEEEEccccEEEEccccccccEEcccccccccccEEEEEEccccccEEEEEEccccEEEEEccccccccccccccccccccEEEEEEcccccEEEEEEccccEEEEEccccccccEEEEcccccccEEEEEEccccccEEEEEEccccEEEEEccccccHHHHHHHHHHcccccEEEEEEcccccEEEEEEEcccccEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEEEcccccEEEEEcccccEEEEEcccccccccccccccccccccccccccccccccccccEEEEcccccEEEEEEEEccccEEEEEEcccccEEEEEccccccccccccHHHHccccccccccccccccEEEccccccEEEEEEccccccEEEEEEccccEEEEcccccccEEEEEEcccccEEEEEEccccEEEEEcccccccEEcccccccccccEEEEEEccccccEEEEEEccccEEEEEcccccccEEEEEEEEEEEEEcccccccEEEEEcccEEEEEcccccccc
ccccEHHHccccccccccccccccccccHHHHHHHcccccccccccccccccEEEEEEEEcccccEEEccccccccccEEEccccEEEEEcccccccEEEEcccccEEEEEccccEEEEEEcccccEEEEcccccccEEEEEEcccccEEEEEccccEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEEcccccEccEEEcccccccccEEEEEEcccccEEEEEccccEEEEEEccccccccccccEEEEEccccccEEEEEEccccccEEEEEccccEEEEEEcccccccccEcEEEccccccEEEEEEccccccEEEEEccccEEEEEEcccccccccEEEEcccccccEEEEEEcccccEEEEEccccEEEEEEccccccccEEEEEccccccEEEEEEccccccEEEEEccccEEEEEEcccccEccccccccccccccccEEEEccccccEEEEEEcccccEEEEEccccEEEEEEccccccEEEEEEccccccEEEEEEcccccEEEEEEEEccccEEEEEEccccccccccccEEEEEEcccccEEEEEccccEEEEEEccccccEEEEEEEcccccEEEEEEccccEEEEEEcccccccccccEEEEEccccEEEEEcccccEEEEEccccccEEEEEEccccccEEEEEccccEEEEEEcccccEEEEEEEcccccEEEEcccccEEEEEEcccccEccEcccccccccccEEEEEEcccccEEEEEEccccEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEEEHEEEEEccccHccc
mnsvhlnscpaleasndivdndsdedmeqgeeskdktkpdeskeekekktrkvylpgtpldkgeslvydpsayvmlheaqtgapclsfdiikdelgdertaypqTLYAVAGTQSKKFNFNRLIVMKMsnltsteednereleddendpfqlaehnkkrgkgpgiptpplfsfsghltegfamdwsstepgvlatgdckrnihiwtpreagawqvdqkplgghtnsaedlQWSDLKTAlqtvddpfqlaehnkkrgkgpgiptpplfsfsghltegfamdwsstepgvlatgdckrnihiwtpreagawqvdqkplvghtnsvedlqwspgekrvLASCSVDLSIRIWDTRVINtkscmltlpnahtsdvnviswnrteplivsggddgcihvwdlrrfkkgssvatfkhhtapvttvewhptesstfasggaddQIALWDLAVERDSEIEQREAELKDLPSQLLFIHLGQKEIkelhwhpqlpgtiistansgfnifrtisdlpsqLLFIHLGQKEIkelhwhpqlpgtiistansgFNIFRTISmsnltsteednereleddesegsgdedrrkdpvmnsyfirhrgcinrvrtcqygsttlagvwgevGKVGIWDLKTalqtvddpfqlaehnkkrgkgpgiptpplfsfsghltegfamdwsstepgvlatgdckrnihiwtpreagAWSVYLYTNRfgvlatgdckrnihiwtpreagawqvdqkplvghtnsvedlqwspgekrvLASCSVdrsnrigarRDMLYCFFVSLVHCIFVWLKYQLFVDVYYWAFVDLVYyifpdlhyff
mnsvhlnscpaleasndivdndsdedmeqgeeskdktkpdeskeekekktrkvylpgtpldkgesLVYDPSAYVMLHEAQTGAPCLSFDIIKDELGDERTAYPQTLYavagtqskkfnfNRLIVMKMSNLTSTEEDNERELEDDENDPFQLAEhnkkrgkgpgipTPPLFSFSGHLTEGFAMDWSSTEPGVLATGDCKRNIHIWTPREAGAWQVDQKPLGGHTNSAEDLQWSDLKTALQTVDDPFQLAEhnkkrgkgpgipTPPLFSFSGHLTEGFAMDWSSTEPGVLATGDCKRNIHIWTPREAGAWQVDQKPLVGHTNSvedlqwspgekrVLASCSVDLSIRIWDTRVINTKSCMltlpnahtsdvnviSWNRTEPLIVSGGDDGCIHVWDLRRFKKGssvatfkhhtapvttvewhpTESSTFASGGADDQIALWDLAVERDSEIEQREAELKDLPSQLLFIHLGQKEIKELHWHPQLPGTIISTANSGFNIFRTISDLPSQLLFIHLGQKEIKELHWHPQLPGTIISTANSGFNIFRTISMSnltsteednereleddesegsgdedrrkdpvmnsyfirhrgcinrvRTCQYGSTTLAGVWGEVGKVGIWDLKTALQTVDDPFQLAEhnkkrgkgpgipTPPLFSFSGHLTEGFAMDWSSTEPGVLATGDCKRNIHIWTPREAGAWSVYLYTNRFGVLATGDCKRNIHIWTPREAGAWQVDQKPLVGHTnsvedlqwspgekrvlasCSVDRSNRIGARRDMLYCFFVSLVHCIFVWLKYQLFVDVYYWAFVDLVYYIFPDLHYFF
MNSVHLNSCPALEASNDIVDNDSDEDMEQGeeskdktkpdeskeekekktRKVYLPGTPLDKGESLVYDPSAYVMLHEAQTGAPCLSFDIIKDELGDERTAYPQTLYAVAGTQSKKFNFNRLIVMKMSNLTSTeednereleddendPFQLAEHNKKRGKGPGIPTPPLFSFSGHLTEGFAMDWSSTEPGVLATGDCKRNIHIWTPREAGAWQVDQKPLGGHTNSAEDLQWSDLKTALQTVDDPFQLAEHNKKRGKGPGIPTPPLFSFSGHLTEGFAMDWSSTEPGVLATGDCKRNIHIWTPREAGAWQVDQKPLVGHTNSVEDLQWSPGEKRVLASCSVDLSIRIWDTRVINTKSCMLTLPNAHTSDVNVISWNRTEPLIVSGGDDGCIHVWDLRRFKKGSSVATFKHHTAPVTTVEWHPTESSTFASGGADDQIALWDLAVERDSEIEQREAELKDLPSQLLFIHLGQKEIKELHWHPQLPGTIISTANSGFNIFRTISDLPSQLLFIHLGQKEIKELHWHPQLPGTIISTANSGFNIFRTISMSNLTSTeednereleddesegsgdedrRKDPVMNSYFIRHRGCINRVRTCQYGSTTLAGVWGEVGKVGIWDLKTALQTVDDPFQLAEHNKKRGKGPGIPTPPLFSFSGHLTEGFAMDWSSTEPGVLATGDCKRNIHIWTPREAGAWSVYLYTNRFGVLATGDCKRNIHIWTPREAGAWQVDQKPLVGHTNSVEDLQWSPGEKRVLASCSVDRSNRIGARRDMLYCFFVSLVHCIFVWLKYQLFVDVYYWAFVDLVYYIFPDLHYFF
***************************************************************ESLVYDPSAYVMLHEAQTGAPCLSFDIIKDELGDERTAYPQTLYAVAGTQSKKFNFNRLIVMK******************************************LFSFSGHLTEGFAMDWSSTEPGVLATGDCKRNIHIWTPREAGAWQVDQ**************WSDLKTAL**************************LFSFSGHLTEGFAMDWSSTEPGVLATGDCKRNIHIWTPREAGAWQVDQKPLVGHTNSVEDLQWSPGEKRVLASCSVDLSIRIWDTRVINTKSCMLTLPNAHTSDVNVISWNRTEPLIVSGGDDGCIHVWDLRRFKKGSSVATFKHHTAPVTTVEWHPTESSTFASGGADDQIALWDLAVE*************DLPSQLLFIHLGQKEIKELHWHPQLPGTIISTANSGFNIFRTISDLPSQLLFIHLGQKEIKELHWHPQLPGTIISTANSGFNIFRTIS*********************************MNSYFIRHRGCINRVRTCQYGSTTLAGVWGEVGKVGIWDLKTALQTVDDPFQL*****************LFSFSGHLTEGFAMDWSSTEPGVLATGDCKRNIHIWTPREAGAWSVYLYTNRFGVLATGDCKRNIHIWTPREAGAWQVDQKPLVGHTNSVEDLQWSPGEKRVLASCSVDRSNRIGARRDMLYCFFVSLVHCIFVWLKYQLFVDVYYWAFVDLVYYIFPDLHYF*
******************************************************LPGTPLDKGESLVYDPSAYVMLHEAQTGAPCLSFDIIKDELGDERTAYPQTLYAVAGTQSKKFNFNRLIVMKMSNL*******************************PGIPTPPLFSFSGHLTEGFAMDWSSTEPGVLATGDCKRNIHIWTPREAGAWQVDQKPLGGHTNSAEDLQWSDLKTALQTVDDPFQLAEHNKKRGKGPGIPTPPLFSFSGHLTEGFAMDWSSTEPGVLATGDCKRNIHIWTPREAGAWQVDQKPLVGHTNSVEDLQWSPGEKRVLASCSVDLSIRIWDTRVINTKSCMLTLPNAHTSDVNVISWNRTEPLIVSGGDDGCIHVWDLRRFKKGSSVATFKHHTAPVTTVEWHPTESSTFASGGADDQIALWDLAVERDS*********KDLPSQLLFIHLGQKEIKELHWHPQLPGTIISTANSGFNIFRTISDLPSQLLFIHLGQKEIKELHWHPQLPGTIISTANSGFNIFRTISMSNLTSTEEDNERELEDDESEGSGDEDRRKDPVMNSYFIRHRGCINRVRTCQYGSTTLAGVWGEVGKVGIWDLKTALQTVDDPFQLAE*NKKR*KGPGIPTPPLFSFSGHLTEGFAMDWSSTEPGVLATGDCKRNIHIWTPREAGAWSVYLYTNRFGVLATGDCKRNIHIWTPREAGAWQVDQKPLVGHTNSVEDLQWSPGEKRVLASCSVDRSNRIGARRDMLYCFFVSLVHCIFVWLKYQLFVDVYYWAFVDLVYYIFPDLHYFF
MNSVHLNSCPALEASNDIVDND*****************************KVYLPGTPLDKGESLVYDPSAYVMLHEAQTGAPCLSFDIIKDELGDERTAYPQTLYAVAGTQSKKFNFNRLIVMKMSNLT***************DPFQLAEHNKKRGKGPGIPTPPLFSFSGHLTEGFAMDWSSTEPGVLATGDCKRNIHIWTPREAGAWQVDQKPLGGHTNSAEDLQWSDLKTALQTVDDPFQLAEHNKKRGKGPGIPTPPLFSFSGHLTEGFAMDWSSTEPGVLATGDCKRNIHIWTPREAGAWQVDQKPLVGHTNSVEDLQWSPGEKRVLASCSVDLSIRIWDTRVINTKSCMLTLPNAHTSDVNVISWNRTEPLIVSGGDDGCIHVWDLRRFKKGSSVATFKHHTAPVTTVEWHPTESSTFASGGADDQIALWDLAVERDSEIEQREAELKDLPSQLLFIHLGQKEIKELHWHPQLPGTIISTANSGFNIFRTISDLPSQLLFIHLGQKEIKELHWHPQLPGTIISTANSGFNIFRTISMSNL*************************KDPVMNSYFIRHRGCINRVRTCQYGSTTLAGVWGEVGKVGIWDLKTALQTVDDPFQLAEHNKKRGKGPGIPTPPLFSFSGHLTEGFAMDWSSTEPGVLATGDCKRNIHIWTPREAGAWSVYLYTNRFGVLATGDCKRNIHIWTPREAGAWQVDQKPLVGHTNSVEDLQWSPGEKRVLASCSVDRSNRIGARRDMLYCFFVSLVHCIFVWLKYQLFVDVYYWAFVDLVYYIFPDLHYFF
*************ASNDIVDN******E*GE****KTKPDESKEEKEKKTRKVYLPGTPLDKGESLVYDPSAYVMLHEAQTGAPCLSFDIIKDELGDERTAYPQTLYAVAGTQSKKFNFNRLIVMKMSNLTSTEEDNERELEDDENDPFQLAEHNKKRGKGPGIPTPPLFSFSGHLTEGFAMDWSSTEPGVLATGDCKRNIHIWTPREAGAWQVDQKPLGGHTNSAEDLQWSDLKTALQTVDDPFQLAEHNKKRGKGPGIPTPPLFSFSGHLTEGFAMDWSSTEPGVLATGDCKRNIHIWTPREAGAWQVDQKPLVGHTNSVEDLQWSPGEKRVLASCSVDLSIRIWDTRVINTKSCMLTLPNAHTSDVNVISWNRTEPLIVSGGDDGCIHVWDLRRFKKGSSVATFKHHTAPVTTVEWHPTESSTFASGGADDQIALWDLAVERDSEIEQREAELKDLPSQLLFIHLGQKEIKELHWHPQLPGTIISTANSGFNIFRTISDLPSQLLFIHLGQKEIKELHWHPQLPGTIISTANSGFNIFRTISMSNLTSTEEDNERELEDDESEGSGDEDRRKDPVMNSYFIRHRGCINRVRTCQYGSTTLAGVWGEVGKVGIWDLKTALQTVDDPFQLAEHNKKRGKGPGIPTPPLFSFSGHLTEGFAMDWSSTEPGVLATGDCKRNIHIWTPREAGAWSVYLYTNRFGVLATGDCKRNIHIWTPREAGAWQVDQKPLVGHTNSVEDLQWSPGEKRVLASCSVDRSNRIGARRDMLYCFFVSLVHCIFVWLKYQLFVDVYYWAFVDLVYYIFPDLHYFF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHi
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSVHLNSCPALEASNDIVDNDSDEDMEQGEESKDKTKPDESKEEKEKKTRKVYLPGTPLDKGESLVYDPSAYVMLHEAQTGAPCLSFDIIKDELGDERTAYPQTLYAVAGTQSKKFNFNRLIVMKxxxxxxxxxxxxxxxxxxxxxPFQLAEHNKKRGKGPGIPTPPLFSFSGHLTEGFAMDWSSTEPGVLATGDCKRNIHIWTPREAGAWQVDQKPLGGHTNSAEDLQWSDLKTALQTVDDPFQLAEHNKKRGKGPGIPTPPLFSFSGHLTEGFAMDWSSTEPGVLATGDCKRNIHIWTPREAGAWQVDQKPLVGHTNSVEDLQWSPGEKRVLASCSVDLSIRIWDTRVINTKSCMLTLPNAHTSDVNVISWNRTEPLIVSGGDDGCIHVWDLRRFKKGSSVATFKHHTAPVTTVEWHPTESSTFASGGADDQIALWDLAVERDSEIEQREAELKDLPSQLLFIHLGQKEIKELHWHPQLPGTIISTANSGFNIFRTISDLPSQLLFIHLGQKEIKELHWHPQLPGTIISTANSGFNIFRTISxxxxxxxxxxxxxxxxxxxxxGSGDEDRRKDPVMNSYFIRHRGCINRVRTCQYGSTTLAGVWGEVGKVGIWDLKTALQTVDDPFQLAEHNKKRGKGPGIPTPPLFSFSGHLTEGFAMDWSSTEPGVLATGDCKRNIHIWTPREAGAWSVYLYTNRFGVLATGDCKRNIHIWTPREAGAWQVDQKPLVGHTNSVEDLQWSPGEKRVLASCSVDRSNRIGARRDMLYCFFVSLVHCIFVWLKYQLFVDVYYWAFVDLVYYIFPDLHYFF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query812 2.2.26 [Sep-21-2011]
Q1JQD2446 Glutamate-rich WD repeat- yes N/A 0.516 0.939 0.489 1e-116
Q5XI13445 Glutamate-rich WD repeat- yes N/A 0.501 0.914 0.490 1e-114
Q810D6446 Glutamate-rich WD repeat- yes N/A 0.346 0.630 0.573 2e-93
Q9BQ67446 Glutamate-rich WD repeat- yes N/A 0.349 0.636 0.568 8e-93
Q9P783480 Ribosome assembly protein yes N/A 0.502 0.85 0.401 7e-84
Q54ED4482 Glutamate-rich WD repeat- yes N/A 0.498 0.840 0.398 4e-78
Q04225511 Ribosome assembly protein yes N/A 0.295 0.469 0.396 3e-42
Q7S7N3446 Histone acetyltransferase N/A N/A 0.310 0.565 0.304 1e-26
Q4WEI5436 Histone acetyltransferase no N/A 0.290 0.541 0.309 2e-25
Q2UA71436 Histone acetyltransferase no N/A 0.290 0.541 0.309 9e-25
>sp|Q1JQD2|GRWD1_BOVIN Glutamate-rich WD repeat-containing protein 1 OS=Bos taurus GN=GRWD1 PE=2 SV=1 Back     alignment and function desciption
 Score =  419 bits (1078), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 229/468 (48%), Positives = 284/468 (60%), Gaps = 49/468 (10%)

Query: 41  ESKEEKEKKTRKVYLPGT--PLDKGESLVYDPSAYVMLHEAQTGAPCLSFDIIKDELGDE 98
           ES+E   K   +VYLPG   PL +GE LV D  AYV+ H AQTGAPCLSFDI++D LGD 
Sbjct: 20  ESQETGSKGQAQVYLPGRGPPLREGEELVMDEEAYVLYHRAQTGAPCLSFDIVRDHLGDN 79

Query: 99  RTAYPQTLYAVAGTQSKKFNFNRLIVMKMSNLTSTEEDNERELEDDENDPFQLAEHNKKR 158
           RT  P TLY  AGTQ++    NRL++++M NL                       H  K 
Sbjct: 80  RTELPLTLYLCAGTQAESSQSNRLMMLRMHNL-----------------------HGTK- 115

Query: 159 GKGPGIPTPPLFSFSGHLTEGFAMDWSSTEPGVLATGDCKRNIHIWTPREAGAWQVDQKP 218
                 P PP  S      +    +        LA       I+    R   +W + ++P
Sbjct: 116 ------PPPPEGSDDEEEEDDEEDEEERKPQLELAMVPHYGGIN----RVRVSW-LGEEP 164

Query: 219 LGGHTNSAEDLQWSDLKTALQTVDDPFQLA---EHNKKRGKGPGIPTPPLFSFSGHLTEG 275
           + G  +    ++   L+  LQ VDDP  LA      + R K       P+F+FSGH+ EG
Sbjct: 165 VAGVWSEKGQVEVFALRRLLQVVDDPQALATFLRDEQTRMK-------PIFAFSGHMGEG 217

Query: 276 FAMDWSSTEPGVLATGDCKRNIHIWTPREAGAWQVDQKPLVGHTNSVEDLQWSPGEKRVL 335
           FA+DWS   PG L TGDC++NIH+WTP + G+W VDQ+P VGHT SVEDLQWSP E  V 
Sbjct: 218 FALDWSPRVPGRLLTGDCQKNIHLWTPTDGGSWHVDQRPFVGHTRSVEDLQWSPTEDTVF 277

Query: 336 ASCSVDLSIRIWDTRVINTKSCMLTLPNAHTSDVNVISWNRTEPLIVSGGDDGCIHVWDL 395
           ASCS D SIRIWD R   +K+CMLT   AH  DVNVI+W+  EP ++SGGDDG + VWDL
Sbjct: 278 ASCSADASIRIWDIRAAPSKACMLTTATAHDGDVNVINWSHREPFLLSGGDDGALKVWDL 337

Query: 396 RRFKKGSSVATFKHHTAPVTTVEWHPTESSTFASGGADDQIALWDLAVERDSEIEQREAE 455
           R+FK GS VATFK H APVT+VEWHP +S  FA+ GAD+QI  WDLAVERD E    E +
Sbjct: 338 RQFKSGSPVATFKQHVAPVTSVEWHPQDSGVFAASGADNQITQWDLAVERDPEAGDAETD 397

Query: 456 --LKDLPSQLLFIHLGQKEIKELHWHPQLPGTIISTANSGFNIFRTIS 501
             L DLP QLLF+H G+ ++KELHWHPQ PG ++STA SGF +FRTIS
Sbjct: 398 PGLADLPQQLLFVHQGETDLKELHWHPQCPGVLVSTALSGFTVFRTIS 445





Bos taurus (taxid: 9913)
>sp|Q5XI13|GRWD1_RAT Glutamate-rich WD repeat-containing protein 1 OS=Rattus norvegicus GN=Grwd1 PE=2 SV=1 Back     alignment and function description
>sp|Q810D6|GRWD1_MOUSE Glutamate-rich WD repeat-containing protein 1 OS=Mus musculus GN=Grwd1 PE=2 SV=2 Back     alignment and function description
>sp|Q9BQ67|GRWD1_HUMAN Glutamate-rich WD repeat-containing protein 1 OS=Homo sapiens GN=GRWD1 PE=1 SV=1 Back     alignment and function description
>sp|Q9P783|RRB1_SCHPO Ribosome assembly protein rrb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrb1 PE=1 SV=1 Back     alignment and function description
>sp|Q54ED4|GRWD1_DICDI Glutamate-rich WD repeat-containing protein 1 OS=Dictyostelium discoideum GN=grwd1 PE=3 SV=1 Back     alignment and function description
>sp|Q04225|RRB1_YEAST Ribosome assembly protein RRB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRB1 PE=1 SV=1 Back     alignment and function description
>sp|Q7S7N3|HAT2_NEUCR Histone acetyltransferase type B subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hat-2 PE=3 SV=2 Back     alignment and function description
>sp|Q4WEI5|HAT2_ASPFU Histone acetyltransferase type B subunit 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hat2 PE=3 SV=1 Back     alignment and function description
>sp|Q2UA71|HAT2_ASPOR Histone acetyltransferase type B subunit 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=hat2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query812
312385620465 hypothetical protein AND_00555 [Anophele 0.546 0.954 0.496 1e-124
195384625464 GJ22462 [Drosophila virilis] gi|19414581 0.541 0.948 0.503 1e-123
195455404457 GK23014 [Drosophila willistoni] gi|19417 0.523 0.929 0.509 1e-122
195028201468 GH20229 [Drosophila grimshawi] gi|193902 0.535 0.929 0.508 1e-122
194864182458 GG23179 [Drosophila erecta] gi|190662678 0.536 0.951 0.511 1e-122
157136915464 wd-repeat protein [Aedes aegypti] gi|108 0.518 0.907 0.514 1e-121
195120556460 GI19400 [Drosophila mojavensis] gi|19390 0.532 0.939 0.498 1e-121
157124910463 wd-repeat protein [Aedes aegypti] gi|108 0.518 0.909 0.514 1e-120
195580844456 GD10383 [Drosophila simulans] gi|1941922 0.508 0.905 0.518 1e-120
58376463458 AGAP007125-PA [Anopheles gambiae str. PE 0.5 0.886 0.522 1e-120
>gi|312385620|gb|EFR30067.1| hypothetical protein AND_00555 [Anopheles darlingi] Back     alignment and taxonomy information
 Score =  451 bits (1160), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 241/485 (49%), Positives = 305/485 (62%), Gaps = 41/485 (8%)

Query: 21  NDSDEDMEQGEESKDKTKPDESKEEKEKKTRKVYLPGTPLDKGESLVYDPSAYVMLHEAQ 80
           N  D  +E   + +DK +         +   KVYLPG  LD  E LV D SAY+MLH+A 
Sbjct: 17  NIEDAILEDASDEEDKEETTNGGGGGGRSKAKVYLPGQALDNDEELVCDESAYIMLHQAH 76

Query: 81  TGAPCLSFDIIKDELGDERTAYPQTLYAVAGTQSKKFNFNRLIVMKMSNLTSTEEDNERE 140
           TGAPCLSFD+++D LGD+R  +P T + VAGTQ+ + + N +IVMKMSN+  T+    RE
Sbjct: 77  TGAPCLSFDVVQDPLGDDREEFPLTAFLVAGTQAARTHVNGVIVMKMSNMNRTQ----RE 132

Query: 141 LEDDENDPFQLAEHNKKRGKGPGIPT--PPLFSFSGHLTEGFAMDWSSTEPGVLATGDCK 198
            +DDE++       ++  G     P     L   +G +       ++ T+   +A+    
Sbjct: 133 KDDDESEDSGEESDDEDVGGDGKTPNLNCALIKHAGCVNRLRVTTFNGTQ--YVASWSEM 190

Query: 199 RNIHIWTPREAGAWQVDQKPLGGHTNSAEDLQWSDLKTALQTVDDPFQLAEHNKKRGKGP 258
             +HI+   E                             L  VDD      + + +  G 
Sbjct: 191 GRVHIYNINEQ----------------------------LAAVDDNHACRTYQQNK-VGD 221

Query: 259 GIPTPPLFSFSGHLTEGFAMDWSSTEPGVLATGDCKRNIHIWTPREAGAWQVDQKPLVGH 318
           G+   P F+FSGH  EGFA+DW  T  G+LATGDC+R+IHIW P + G+W VDQ+PLVGH
Sbjct: 222 GVK--PDFTFSGHQKEGFAIDWCPTTRGMLATGDCRRDIHIWRPNDKGSWNVDQRPLVGH 279

Query: 319 TNSVEDLQWSPGEKRVLASCSVDLSIRIWDTRVINTKSCMLTLPNAHTSDVNVISWNRTE 378
           T+SVED+QWSP E  VLASCSVD SIRIWD R   +K+CMLT  N H SDVNVISWNR E
Sbjct: 280 TDSVEDIQWSPNEANVLASCSVDKSIRIWDCRAAPSKACMLTADNVHESDVNVISWNRNE 339

Query: 379 PLIVSGGDDGCIHVWDLRRFKKGSSVATFKHHTAPVTTVEWHPTESSTFASGGADDQIAL 438
           PLI SGGDDG +H+WDLR+F+  + VATFKHHT  +TTVEWHP ES+  ASGG DDQIAL
Sbjct: 340 PLIASGGDDGVLHIWDLRQFQTKTPVATFKHHTDHITTVEWHPKESTILASGGDDDQIAL 399

Query: 439 WDLAVERD-SEIEQR-EAELKDLPSQLLFIHLGQKEIKELHWHPQLPGTIISTANSGFNI 496
           WDL+VE+D +E E   +  LK+LP QLLFIH GQKEIKELHWHPQL G I+STA+SGFN+
Sbjct: 400 WDLSVEKDEAEAEMNDDPNLKELPPQLLFIHQGQKEIKELHWHPQLKGVILSTAHSGFNV 459

Query: 497 FRTIS 501
           FRTIS
Sbjct: 460 FRTIS 464




Source: Anopheles darlingi

Species: Anopheles darlingi

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195384625|ref|XP_002051015.1| GJ22462 [Drosophila virilis] gi|194145812|gb|EDW62208.1| GJ22462 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195455404|ref|XP_002074708.1| GK23014 [Drosophila willistoni] gi|194170793|gb|EDW85694.1| GK23014 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195028201|ref|XP_001986965.1| GH20229 [Drosophila grimshawi] gi|193902965|gb|EDW01832.1| GH20229 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|194864182|ref|XP_001970811.1| GG23179 [Drosophila erecta] gi|190662678|gb|EDV59870.1| GG23179 [Drosophila erecta] Back     alignment and taxonomy information
>gi|157136915|ref|XP_001663860.1| wd-repeat protein [Aedes aegypti] gi|108869822|gb|EAT34047.1| AAEL013685-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|195120556|ref|XP_002004790.1| GI19400 [Drosophila mojavensis] gi|193909858|gb|EDW08725.1| GI19400 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|157124910|ref|XP_001660583.1| wd-repeat protein [Aedes aegypti] gi|108873823|gb|EAT38048.1| AAEL010035-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|195580844|ref|XP_002080244.1| GD10383 [Drosophila simulans] gi|194192253|gb|EDX05829.1| GD10383 [Drosophila simulans] Back     alignment and taxonomy information
>gi|58376463|ref|XP_308636.2| AGAP007125-PA [Anopheles gambiae str. PEST] gi|55245729|gb|EAA04110.2| AGAP007125-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query812
FB|FBgn0022288456 l(2)09851 "lethal (2) 09851" [ 0.342 0.609 0.604 1.8e-118
UNIPROTKB|F1RL85445 GRWD1 "Uncharacterized protein 0.352 0.642 0.573 4.2e-115
UNIPROTKB|Q1JQD2446 GRWD1 "Glutamate-rich WD repea 0.352 0.641 0.563 4.8e-114
MGI|MGI:2141989446 Grwd1 "glutamate-rich WD repea 0.352 0.641 0.576 6.1e-114
UNIPROTKB|E2RBY0440 GRWD1 "Uncharacterized protein 0.352 0.65 0.552 5.5e-113
RGD|1310649445 Grwd1 "glutamate-rich WD repea 0.352 0.642 0.573 4.3e-92
UNIPROTKB|Q9BQ67446 GRWD1 "Glutamate-rich WD repea 0.352 0.641 0.566 7e-92
ZFIN|ZDB-GENE-030131-9844452 grwd1 "glutamate-rich WD repea 0.321 0.577 0.579 1.2e-83
TAIR|locus:2050388469 AT2G19540 "AT2G19540" [Arabido 0.315 0.545 0.494 8.3e-83
ASPGD|ASPL0000069856492 AN7205 [Emericella nidulans (t 0.295 0.487 0.447 2.3e-74
FB|FBgn0022288 l(2)09851 "lethal (2) 09851" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 918 (328.2 bits), Expect = 1.8e-118, Sum P(2) = 1.8e-118
 Identities = 171/283 (60%), Positives = 207/283 (73%)

Query:   224 NSAEDLQWSDL-KTALQTVDDPFQLAEHNKKRGKGPGIPTPPLFSFSGHLTEGFAMDWSS 282
             NS     WS+L +  +  +  P Q  E+ +   +       P+F+F GH  EGFA+DWS 
Sbjct:   173 NSVYAASWSELGRVNIWDLTQPLQAVENAQLAKQYEQSEARPVFTFGGHQQEGFAIDWSP 232

Query:   283 TEPGVLATGDCKRNIHIWTPREAGAWQVDQKPLVGHTNSVEDLQWSPGEKRVLASCSVDL 342
             +  GVLATGDC+R+IH+WTP E G W+VDQ+PL GH+ SVEDLQWSP E+ VLASCSVD 
Sbjct:   233 SADGVLATGDCRRDIHVWTPVEDGTWKVDQRPLAGHSQSVEDLQWSPNERSVLASCSVDK 292

Query:   343 SIRIWDTRVINTKSCMLTLPNAHTSDVNVISWNRTEPLIVSGGDDGCIHVWDLRRFKKGS 402
             +IRIWD R    K+CMLT  +AH SDVNVISWNR EP I SGGDDG +H+WDLR+F+   
Sbjct:   293 TIRIWDCRASPQKACMLTCEDAHQSDVNVISWNRNEPFIASGGDDGYLHIWDLRQFQSKK 352

Query:   403 SVATFKHHTAPVTTVEWHPTESSTFASGGADDQIALWDLAVERDSE--IE--QREAELKD 458
              +ATFKHHT  +TTVEW P E++  ASGG DDQIALWDLAVE+D +  ++  Q E  L  
Sbjct:   353 PIATFKHHTDHITTVEWSPAEATVLASGGDDDQIALWDLAVEKDIDQAVDPAQNEDVLNK 412

Query:   459 LPSQLLFIHLGQKEIKELHWHPQLPGTIISTANSGFNIFRTIS 501
             LP QLLFIH GQKEIKELHWHPQLPG ++STA+SGFNIFRTIS
Sbjct:   413 LPPQLLFIHQGQKEIKELHWHPQLPGVLLSTAHSGFNIFRTIS 455


GO:0005575 "cellular_component" evidence=ND
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
UNIPROTKB|F1RL85 GRWD1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q1JQD2 GRWD1 "Glutamate-rich WD repeat-containing protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:2141989 Grwd1 "glutamate-rich WD repeat containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RBY0 GRWD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1310649 Grwd1 "glutamate-rich WD repeat containing 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BQ67 GRWD1 "Glutamate-rich WD repeat-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-9844 grwd1 "glutamate-rich WD repeat containing 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2050388 AT2G19540 "AT2G19540" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000069856 AN7205 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q810D6GRWD1_MOUSENo assigned EC number0.57330.34600.6300yesN/A
Q9BQ67GRWD1_HUMANNo assigned EC number0.56890.34970.6367yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query812
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-27
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-23
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 9e-20
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-19
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-18
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-18
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-14
pfam1226573 pfam12265, CAF1C_H4-bd, Histone-binding protein RB 1e-13
PTZ00420568 PTZ00420, PTZ00420, coronin; Provisional 6e-11
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 3e-10
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-08
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 2e-06
smart0032040 smart00320, WD40, WD40 repeats 2e-06
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 3e-06
smart0032040 smart00320, WD40, WD40 repeats 3e-06
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-05
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-05
smart0032040 smart00320, WD40, WD40 repeats 5e-05
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 9e-05
PTZ00421493 PTZ00421, PTZ00421, coronin; Provisional 0.001
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
 Score =  113 bits (284), Expect = 1e-27
 Identities = 47/128 (36%), Positives = 67/128 (52%), Gaps = 9/128 (7%)

Query: 315 LVGHTNSVEDLQWSPGEKRVLASCSVDLSIRIWDTRVINTKSCMLTLPNAHTSDVNVISW 374
           L GHT+ V  + +SP + R+L+S S D +I++WD     T  C+ TL   HT  VN +++
Sbjct: 89  LTGHTSYVSSVAFSP-DGRILSSSSRDKTIKVWDVE---TGKCLTTL-RGHTDWVNSVAF 143

Query: 375 NRTEPLIVSGGDDGCIHVWDLRRFKKGSSVATFKHHTAPVTTVEWHPTESSTFASGGADD 434
           +     + S   DG I +WDLR    G  VAT   HT  V +V + P       S  +D 
Sbjct: 144 SPDGTFVASSSQDGTIKLWDLR---TGKCVATLTGHTGEVNSVAFSPDGEK-LLSSSSDG 199

Query: 435 QIALWDLA 442
            I LWDL+
Sbjct: 200 TIKLWDLS 207


Length = 289

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|221499 pfam12265, CAF1C_H4-bd, Histone-binding protein RBBP4 or subunit C of CAF1 complex Back     alignment and domain information
>gnl|CDD|240412 PTZ00420, PTZ00420, coronin; Provisional Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|173611 PTZ00421, PTZ00421, coronin; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 812
KOG0302|consensus440 100.0
KOG0271|consensus480 100.0
KOG0271|consensus480 100.0
KOG0318|consensus603 100.0
KOG0319|consensus 775 100.0
KOG0264|consensus422 100.0
KOG0319|consensus 775 100.0
KOG0318|consensus603 100.0
KOG0306|consensus 888 100.0
KOG0291|consensus 893 100.0
KOG0306|consensus 888 100.0
KOG0272|consensus459 100.0
KOG0291|consensus 893 100.0
KOG0272|consensus459 100.0
KOG0286|consensus343 100.0
KOG0286|consensus343 100.0
KOG0296|consensus399 100.0
KOG0273|consensus524 100.0
KOG0276|consensus 794 100.0
KOG1408|consensus 1080 100.0
KOG0645|consensus312 100.0
KOG1539|consensus 910 100.0
KOG0279|consensus315 100.0
KOG0315|consensus311 100.0
KOG0292|consensus 1202 100.0
KOG0284|consensus464 100.0
KOG0279|consensus315 100.0
KOG2106|consensus626 100.0
KOG1063|consensus764 100.0
KOG1063|consensus764 100.0
KOG0645|consensus312 100.0
KOG0265|consensus338 100.0
KOG0273|consensus524 100.0
KOG0315|consensus311 100.0
KOG0263|consensus707 100.0
KOG0265|consensus338 100.0
KOG0296|consensus399 100.0
KOG1539|consensus 910 100.0
KOG0285|consensus460 100.0
KOG0295|consensus406 100.0
KOG0284|consensus464 100.0
KOG0285|consensus460 100.0
KOG0263|consensus707 100.0
KOG0295|consensus406 100.0
KOG0772|consensus641 100.0
KOG0316|consensus307 100.0
KOG0277|consensus311 100.0
KOG0276|consensus 794 100.0
KOG0282|consensus503 100.0
KOG0282|consensus503 100.0
KOG0281|consensus499 100.0
KOG2106|consensus626 100.0
KOG0292|consensus 1202 100.0
KOG0281|consensus499 100.0
KOG2048|consensus691 100.0
KOG0293|consensus519 100.0
KOG0293|consensus519 100.0
KOG0266|consensus456 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0266|consensus456 100.0
PLN00181793 protein SPA1-RELATED; Provisional 100.0
KOG1408|consensus 1080 100.0
KOG0313|consensus423 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0277|consensus311 100.0
PLN00181793 protein SPA1-RELATED; Provisional 100.0
KOG0299|consensus479 99.98
KOG0310|consensus487 99.97
KOG0643|consensus327 99.97
KOG0316|consensus307 99.97
KOG0313|consensus423 99.97
KOG0275|consensus508 99.97
KOG0640|consensus430 99.97
KOG0278|consensus334 99.97
KOG1445|consensus 1012 99.97
KOG0308|consensus735 99.97
PTZ00421493 coronin; Provisional 99.97
KOG0268|consensus433 99.97
KOG0641|consensus350 99.96
KOG0772|consensus641 99.96
KOG0640|consensus430 99.96
KOG0264|consensus422 99.96
KOG0305|consensus484 99.96
KOG0268|consensus433 99.96
KOG0275|consensus508 99.96
KOG0300|consensus481 99.96
KOG0288|consensus459 99.96
KOG0300|consensus481 99.96
KOG1407|consensus313 99.96
KOG1407|consensus313 99.96
KOG0294|consensus362 99.96
KOG1332|consensus299 99.96
KOG0973|consensus 942 99.96
KOG2048|consensus 691 99.96
KOG1446|consensus311 99.96
PTZ00420568 coronin; Provisional 99.96
KOG0283|consensus712 99.96
KOG0310|consensus487 99.96
KOG0647|consensus347 99.96
KOG0278|consensus334 99.96
KOG0288|consensus459 99.95
KOG0305|consensus484 99.95
KOG0643|consensus327 99.95
KOG1445|consensus 1012 99.95
KOG0973|consensus 942 99.95
KOG1446|consensus311 99.95
KOG2055|consensus514 99.95
KOG0274|consensus537 99.95
KOG0641|consensus350 99.95
KOG0289|consensus506 99.95
KOG1332|consensus299 99.95
KOG0274|consensus537 99.95
PTZ00421493 coronin; Provisional 99.95
KOG0308|consensus 735 99.95
KOG0269|consensus 839 99.95
KOG0302|consensus440 99.95
PTZ00420568 coronin; Provisional 99.94
KOG0299|consensus479 99.94
KOG0283|consensus712 99.94
KOG0270|consensus463 99.94
KOG0301|consensus 745 99.94
KOG0289|consensus506 99.94
KOG1007|consensus370 99.94
KOG2096|consensus420 99.94
KOG0301|consensus 745 99.94
KOG4283|consensus397 99.94
KOG0647|consensus347 99.94
KOG0270|consensus463 99.94
KOG0639|consensus705 99.93
KOG0290|consensus364 99.93
KOG0269|consensus 839 99.93
KOG1036|consensus323 99.93
KOG1036|consensus323 99.92
KOG2096|consensus420 99.92
KOG2445|consensus361 99.92
KOG1963|consensus 792 99.92
KOG4328|consensus498 99.92
KOG0267|consensus 825 99.92
KOG0321|consensus 720 99.92
KOG0294|consensus362 99.92
KOG0639|consensus705 99.92
KOG0321|consensus 720 99.91
KOG1273|consensus405 99.91
KOG1274|consensus 933 99.91
KOG0646|consensus476 99.91
KOG1273|consensus405 99.91
KOG4283|consensus397 99.91
KOG1007|consensus370 99.91
KOG0646|consensus476 99.9
KOG0267|consensus 825 99.9
KOG0307|consensus 1049 99.9
KOG0650|consensus733 99.9
KOG4328|consensus498 99.89
KOG2055|consensus514 99.89
KOG2445|consensus361 99.89
KOG0650|consensus733 99.89
KOG0307|consensus 1049 99.89
KOG4378|consensus673 99.89
KOG4378|consensus673 99.88
KOG1310|consensus 758 99.88
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.88
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.88
KOG1034|consensus385 99.88
KOG1538|consensus 1081 99.87
KOG1274|consensus 933 99.87
KOG1034|consensus385 99.86
KOG1538|consensus 1081 99.86
KOG2919|consensus406 99.86
KOG1963|consensus 792 99.86
KOG1009|consensus434 99.85
COG2319466 FOG: WD40 repeat [General function prediction only 99.85
COG2319466 FOG: WD40 repeat [General function prediction only 99.85
KOG1188|consensus376 99.85
KOG2919|consensus406 99.85
KOG4227|consensus609 99.85
KOG1009|consensus434 99.84
KOG0322|consensus323 99.84
KOG0303|consensus472 99.84
KOG0290|consensus364 99.83
KOG1524|consensus 737 99.83
KOG0644|consensus 1113 99.83
KOG1587|consensus555 99.82
KOG1188|consensus376 99.82
KOG1587|consensus555 99.82
KOG1523|consensus361 99.82
KOG0642|consensus577 99.82
KOG0322|consensus323 99.82
KOG4227|consensus609 99.8
KOG1523|consensus361 99.8
KOG1310|consensus758 99.8
KOG4497|consensus447 99.79
KOG1334|consensus559 99.79
KOG0303|consensus472 99.78
KOG1240|consensus1431 99.77
KOG0644|consensus 1113 99.77
KOG1524|consensus737 99.76
KOG1517|consensus1387 99.76
KOG0649|consensus325 99.75
KOG4497|consensus447 99.75
KOG1334|consensus559 99.74
KOG1517|consensus1387 99.74
KOG0642|consensus577 99.74
KOG1240|consensus1431 99.72
PRK11028330 6-phosphogluconolactonase; Provisional 99.67
PF1226574 CAF1C_H4-bd: Histone-binding protein RBBP4 or subu 99.67
PRK01742429 tolB translocation protein TolB; Provisional 99.66
KOG0771|consensus398 99.65
KOG0649|consensus325 99.64
KOG1272|consensus545 99.64
KOG2041|consensus 1189 99.64
PRK11028330 6-phosphogluconolactonase; Provisional 99.63
KOG2321|consensus703 99.63
PRK01742429 tolB translocation protein TolB; Provisional 99.62
KOG0771|consensus398 99.62
KOG2139|consensus445 99.61
KOG2139|consensus445 99.6
KOG3881|consensus412 99.6
KOG1272|consensus545 99.58
KOG1409|consensus404 99.58
KOG2110|consensus391 99.58
KOG1354|consensus433 99.57
KOG2394|consensus636 99.56
KOG1912|consensus 1062 99.56
KOG2394|consensus 636 99.56
KOG0974|consensus 967 99.55
KOG2111|consensus346 99.53
PRK03629429 tolB translocation protein TolB; Provisional 99.53
KOG2110|consensus391 99.53
KOG1912|consensus 1062 99.53
PRK05137435 tolB translocation protein TolB; Provisional 99.53
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.51
PRK02889427 tolB translocation protein TolB; Provisional 99.5
PRK03629429 tolB translocation protein TolB; Provisional 99.5
PRK04922433 tolB translocation protein TolB; Provisional 99.5
KOG0974|consensus 967 99.49
KOG2111|consensus346 99.48
PRK02889427 tolB translocation protein TolB; Provisional 99.47
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.47
KOG1354|consensus433 99.47
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.45
KOG2315|consensus566 99.45
PRK04922433 tolB translocation protein TolB; Provisional 99.44
PRK05137435 tolB translocation protein TolB; Provisional 99.43
KOG0280|consensus339 99.42
KOG2321|consensus703 99.39
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.38
KOG2041|consensus 1189 99.36
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.36
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.34
KOG0280|consensus339 99.34
KOG2315|consensus 566 99.33
KOG3881|consensus412 99.33
KOG1409|consensus404 99.33
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.32
PRK01029428 tolB translocation protein TolB; Provisional 99.31
PRK04792448 tolB translocation protein TolB; Provisional 99.31
KOG0309|consensus 1081 99.3
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.29
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.29
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.29
PRK01029428 tolB translocation protein TolB; Provisional 99.29
KOG0309|consensus 1081 99.29
PRK00178430 tolB translocation protein TolB; Provisional 99.26
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.26
KOG1064|consensus2439 99.25
KOG2314|consensus698 99.25
KOG4547|consensus541 99.24
KOG1064|consensus2439 99.24
PRK00178430 tolB translocation protein TolB; Provisional 99.22
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.22
PRK04792448 tolB translocation protein TolB; Provisional 99.2
COG4946668 Uncharacterized protein related to the periplasmic 99.2
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.2
KOG4547|consensus541 99.16
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.13
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 99.11
KOG2314|consensus698 99.1
KOG4532|consensus344 99.1
KOG4190|consensus1034 99.09
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.99
KOG4532|consensus344 98.96
COG4946668 Uncharacterized protein related to the periplasmic 98.96
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.96
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.92
KOG4714|consensus319 98.9
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.88
KOG2695|consensus425 98.85
KOG3914|consensus390 98.84
PRK04043419 tolB translocation protein TolB; Provisional 98.8
KOG3914|consensus390 98.8
KOG4714|consensus319 98.79
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.79
KOG4190|consensus1034 98.77
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.73
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.72
KOG1920|consensus 1265 98.69
KOG1832|consensus1516 98.68
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.68
PRK04043419 tolB translocation protein TolB; Provisional 98.65
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.55
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.53
KOG1645|consensus463 98.53
KOG3617|consensus 1416 98.52
KOG1008|consensus 783 98.5
KOG2695|consensus425 98.48
KOG1645|consensus463 98.48
KOG3617|consensus 1416 98.47
KOG2066|consensus 846 98.44
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 98.43
KOG1275|consensus 1118 98.43
KOG2114|consensus 933 98.42
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.41
KOG1832|consensus1516 98.4
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.37
KOG3621|consensus726 98.32
KOG0882|consensus558 98.28
KOG1275|consensus 1118 98.26
KOG2066|consensus 846 98.25
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.25
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.24
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.22
KOG1008|consensus 783 98.2
KOG0882|consensus558 98.2
KOG1920|consensus 1265 98.17
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.16
KOG2114|consensus 933 98.13
KOG3621|consensus 726 98.0
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.0
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.99
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 97.96
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.93
KOG4649|consensus354 97.9
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 97.84
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.79
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.75
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.71
KOG2395|consensus644 97.68
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 97.66
KOG4649|consensus354 97.62
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.54
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 97.5
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.5
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.5
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.49
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.34
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.33
PRK02888 635 nitrous-oxide reductase; Validated 97.31
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.2
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.19
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.17
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.14
KOG1897|consensus1096 97.06
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.06
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.0
KOG4640|consensus 665 96.97
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 96.94
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.93
PRK13616591 lipoprotein LpqB; Provisional 96.92
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 96.89
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.87
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 96.87
KOG4640|consensus665 96.85
PRK13616591 lipoprotein LpqB; Provisional 96.85
COG3204316 Uncharacterized protein conserved in bacteria [Fun 96.85
COG3391381 Uncharacterized conserved protein [Function unknow 96.8
COG3490366 Uncharacterized protein conserved in bacteria [Fun 96.72
KOG1897|consensus 1096 96.71
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 96.65
KOG2444|consensus238 96.63
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 96.61
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 96.57
COG3204316 Uncharacterized protein conserved in bacteria [Fun 96.55
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.48
COG3391381 Uncharacterized conserved protein [Function unknow 96.44
KOG2444|consensus238 96.28
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 96.24
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 96.22
PRK02888635 nitrous-oxide reductase; Validated 96.2
PRK10115686 protease 2; Provisional 96.17
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 96.09
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 95.99
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 95.95
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 95.95
KOG2079|consensus 1206 95.84
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 95.76
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 95.71
KOG2079|consensus 1206 95.71
COG3490366 Uncharacterized protein conserved in bacteria [Fun 95.66
KOG4441|consensus571 95.44
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 95.31
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 95.29
PF15390671 DUF4613: Domain of unknown function (DUF4613) 95.22
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 95.14
COG3386307 Gluconolactonase [Carbohydrate transport and metab 95.14
PF15390671 DUF4613: Domain of unknown function (DUF4613) 95.13
KOG2395|consensus644 95.08
PF14727418 PHTB1_N: PTHB1 N-terminus 95.07
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 95.05
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 94.75
KOG3630|consensus 1405 94.74
KOG1916|consensus 1283 94.73
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 94.67
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 94.64
PF14727418 PHTB1_N: PTHB1 N-terminus 94.42
PHA02713557 hypothetical protein; Provisional 94.33
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 94.08
KOG4499|consensus310 94.06
PHA02713557 hypothetical protein; Provisional 94.0
KOG1916|consensus 1283 93.95
PRK13684334 Ycf48-like protein; Provisional 93.89
COG5276370 Uncharacterized conserved protein [Function unknow 93.88
KOG3630|consensus 1405 93.82
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 93.72
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 93.7
KOG2377|consensus657 93.41
COG5167776 VID27 Protein involved in vacuole import and degra 93.41
KOG2280|consensus 829 93.36
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 93.15
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 93.13
KOG2280|consensus 829 93.05
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 92.99
COG5167776 VID27 Protein involved in vacuole import and degra 92.98
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 92.78
COG5276370 Uncharacterized conserved protein [Function unknow 92.66
PRK10115686 protease 2; Provisional 92.49
KOG4441|consensus571 92.45
PF10214 765 Rrn6: RNA polymerase I-specific transcription-init 92.31
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 92.3
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 91.8
KOG2377|consensus 657 91.52
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 91.31
KOG2247|consensus615 91.14
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 91.13
KOG1900|consensus 1311 91.08
KOG2247|consensus615 90.83
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 90.67
PHA03098534 kelch-like protein; Provisional 90.23
PF03066149 Nucleoplasmin: Nucleoplasmin; InterPro: IPR004301 90.14
PRK13684334 Ycf48-like protein; Provisional 90.05
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 89.44
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 89.21
KOG4499|consensus310 88.84
PF10214765 Rrn6: RNA polymerase I-specific transcription-init 88.75
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 88.75
KOG1900|consensus 1311 86.55
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 86.39
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 86.32
PHA03098534 kelch-like protein; Provisional 85.37
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 83.95
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 82.97
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 82.94
PF10446458 DUF2457: Protein of unknown function (DUF2457); In 82.83
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 82.43
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 82.0
PF13449326 Phytase-like: Esterase-like activity of phytase 81.27
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 80.6
KOG1983|consensus 993 80.06
>KOG0302|consensus Back     alignment and domain information
Probab=100.00  E-value=3.3e-74  Score=541.26  Aligned_cols=400  Identities=50%  Similarity=0.895  Sum_probs=348.1

Q ss_pred             CeeeeCCc--cCCCCCeeeeChhHHhhhhccCCCCCeeeEEEEecCCCCCcccCcceEEEEeecCCCCCCCCeEEEEEec
Q psy4510          51 RKVYLPGT--PLDKGESLVYDPSAYVMLHEAQTGAPCLSFDIIKDELGDERTAYPQTLYAVAGTQSKKFNFNRLIVMKMS  128 (812)
Q Consensus        51 ~~~~~~~~--~~~~~~~~~~d~~~y~~~~~~~~~~p~ls~~~~~d~~~~~~~~~~~~~~~~~gt~~~~~~~n~l~~~~~~  128 (812)
                      +++|+||+  +|+++|||++||+||.|+|.++++|||||||++||.++.+|+.||+++|+++|||+.+...|.|+||++.
T Consensus        36 ~~~~lpg~~~~l~~~EeL~~DpsaYe~lH~~~~gwPcLsfDVi~D~LG~eR~e~P~~~Ylv~gtQa~~~~~N~l~vlkl~  115 (440)
T KOG0302|consen   36 AQVYLPGMSRPLGDDEELVADPSAYEMLHNFNSGWPCLSFDVIPDRLGDERTEFPHTAYLVAGTQALDAPDNELMVLKLS  115 (440)
T ss_pred             ceeeccCCCCCCCCCceEecCHHHHHHhhcccCCCcccceeeecCCCCcccccCchHhhhhhhhhccccccCceEEEEee
Confidence            66999995  5999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCcccccCCCCccchhhhcccCCCCCCCCCCCccCcCCCCCceEEEEeCCCCCCeEEEecCCCcEEEEccCC
Q psy4510         129 NLTSTEEDNERELEDDENDPFQLAEHNKKRGKGPGIPTPPLFSFSGHLTEGFAMDWSSTEPGVLATGDCKRNIHIWTPRE  208 (812)
Q Consensus       129 ~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~i~~~~gh~~~i~~~~~sp~~~~~lat~~~dg~v~iwd~~~  208 (812)
                      ||.++..+++.+.+++++|++   ++     .+|++..+.|.|. |..++|....+.  +..+.|+=+..|.|+||++..
T Consensus       116 nl~~t~~~~~gd~~~~~edde---dD-----~~P~~~~~~i~h~-g~~NRvr~~~~~--~~~~~aswse~G~V~Vw~l~~  184 (440)
T KOG0302|consen  116 NLHKTRNPNDGDGEDEEEDDE---DD-----RKPQIEMKSIPHY-GGINRVRVSRLG--NEVLCASWSENGRVQVWDLAP  184 (440)
T ss_pred             eeecccCCccCCCCCccccch---hh-----ccccccccccccc-cccceeeecccC--CcceeeeecccCcEEEEEchh
Confidence            999998874433222222222   22     6799999999999 888887766542  456777888999999997654


Q ss_pred             CCcccccccccCCCCCCeeeeeEcCCCCcEEEeeCCCceEEeeCCCCCCCCCCCCCceEEcCCCCcEEEEEecCCCCCEE
Q psy4510         209 AGAWQVDQKPLGGHTNSAEDLQWSDLKTALQTVDDPFQLAEHNKKRGKGPGIPTPPLFSFSGHLTEGFAMDWSSTEPGVL  288 (812)
Q Consensus       209 ~~~~~~~~~~l~~h~~~V~~l~~s~~~~~l~s~~~d~~i~vwd~~~~~~~~~~~~~~~~~~~h~~~v~~l~~sp~~~~~l  288 (812)
                      .                            |-+.+.++...-.   .      ..+|++++.+|.++.++|+|||-..+.|
T Consensus       185 ~----------------------------l~~l~~~~~~~~~---s------~~~Pl~t~~ghk~EGy~LdWSp~~~g~L  227 (440)
T KOG0302|consen  185 H----------------------------LNALSEPGLEVKD---S------EFRPLFTFNGHKGEGYGLDWSPIKTGRL  227 (440)
T ss_pred             h----------------------------hhhhcCccccccc---c------ccCceEEecccCccceeeeccccccccc
Confidence            2                            1122222211111   1      3599999999999999999999777889


Q ss_pred             EEEeCCCcEEEEeCCCCCcceeccccccCCCCCEEEEEEcCCCCeEEEEEECCCeEEEEECCCCCcccceeecCCcCCCC
Q psy4510         289 ATGDCKRNIHIWTPREAGAWQVDQKPLVGHTNSVEDLQWSPGEKRVLASCSVDLSIRIWDTRVINTKSCMLTLPNAHTSD  368 (812)
Q Consensus       289 ~sg~~dg~i~vwd~~~~~~~~~~~~~~~~h~~~v~~~~~~p~~~~~l~s~~~dg~i~iwd~~~~~~~~~~~~~~~~~~~~  368 (812)
                      ++|++-+.|++|.+.+ +.|.+...++.+|+.+|.+++|+|....+|+|||.||+|+|||+|.+....++.+  .+|.+.
T Consensus       228 lsGDc~~~I~lw~~~~-g~W~vd~~Pf~gH~~SVEDLqWSptE~~vfaScS~DgsIrIWDiRs~~~~~~~~~--kAh~sD  304 (440)
T KOG0302|consen  228 LSGDCVKGIHLWEPST-GSWKVDQRPFTGHTKSVEDLQWSPTEDGVFASCSCDGSIRIWDIRSGPKKAAVST--KAHNSD  304 (440)
T ss_pred             ccCccccceEeeeecc-CceeecCccccccccchhhhccCCccCceEEeeecCceEEEEEecCCCccceeEe--eccCCc
Confidence            9999999999999998 5799999999999999999999999999999999999999999998877777766  799999


Q ss_pred             eEEEEEcCCCCEEEEEeCCCcEEEEecCCCCCCCceEEcccCCCCEEEEEEccCCCcEEEEEECCCCEEEEEcCCCCchh
Q psy4510         369 VNVISWNRTEPLIVSGGDDGCIHVWDLRRFKKGSSVATFKHHTAPVTTVEWHPTESSTFASGGADDQIALWDLAVERDSE  448 (812)
Q Consensus       369 v~~l~~~~~~~~l~sg~~dg~i~iwd~~~~~~~~~~~~~~~h~~~v~~v~~~p~~~~~l~s~~~dg~v~iwd~~~~~~~~  448 (812)
                      |+.|+|+....+||+|+.||+++|||+|+++.++++..|+.|..+|++|.|+|.....|+++|.|.+|.+||+......+
T Consensus       305 VNVISWnr~~~lLasG~DdGt~~iwDLR~~~~~~pVA~fk~Hk~pItsieW~p~e~s~iaasg~D~QitiWDlsvE~D~e  384 (440)
T KOG0302|consen  305 VNVISWNRREPLLASGGDDGTLSIWDLRQFKSGQPVATFKYHKAPITSIEWHPHEDSVIAASGEDNQITIWDLSVEADEE  384 (440)
T ss_pred             eeeEEccCCcceeeecCCCceEEEEEhhhccCCCcceeEEeccCCeeEEEeccccCceEEeccCCCcEEEEEeeccCChh
Confidence            99999999989999999999999999999999999999999999999999999998999999999999999999987754


Q ss_pred             HH--HhhhhhccCCCceEEeecCCCceeEEEEcCCCCCEEEEEeCCCeEEEEeCC
Q psy4510         449 IE--QREAELKDLPSQLLFIHLGQKEIKELHWHPQLPGTIISTANSGFNIFRTIS  501 (812)
Q Consensus       449 ~~--~~~~~~~~~~~~~~~~~~~~~~v~~~~~~p~~~~~~~~~~~~~~~~~~~~~  501 (812)
                      +.  .....+.++|||++|+|++++.++.++||++.|+++++++.+|+++|++++
T Consensus       385 e~~~~a~~~L~dlPpQLLFVHqGQke~KevhWH~QiPG~lvsTa~dGfnVfktIs  439 (440)
T KOG0302|consen  385 EIDQEAAEGLQDLPPQLLFVHQGQKEVKEVHWHRQIPGLLVSTAIDGFNVFKTIS  439 (440)
T ss_pred             hhccccccchhcCCceeEEEecchhHhhhheeccCCCCeEEEecccceeEEEecc
Confidence            43  222336789999999999999999999999999999999999999998865



>KOG0271|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF12265 CAF1C_H4-bd: Histone-binding protein RBBP4 or subunit C of CAF1 complex; InterPro: IPR022052 The CAF-1 complex is a conserved heterotrimeric protein complex that promotes histone H3 and H4 deposition onto newly synthesized DNA during replication or DNA repair; specifically it facilitates replication-dependent nucleosome assembly with the major histone H3 (H3 Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG1900|consensus Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF03066 Nucleoplasmin: Nucleoplasmin; InterPro: IPR004301 The nucleophosmin/nucleoplasmin family of chaperones includes nucleophosmin, nucleoplasmin and nucleoplasmin-like proteins Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>KOG1900|consensus Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PF10446 DUF2457: Protein of unknown function (DUF2457); InterPro: IPR018853 This entry represents a family of uncharacterised proteins Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>KOG1983|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query812
3cfs_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 2e-25
3cfv_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 3e-25
2yba_A422 Crystal Structure Of Nurf55 In Complex With Histone 2e-14
2yba_A422 Crystal Structure Of Nurf55 In Complex With Histone 3e-14
3c99_A432 Structural Basis Of Histone H4 Recognition By P55 L 2e-14
3c99_A432 Structural Basis Of Histone H4 Recognition By P55 L 4e-14
2xyi_A430 Crystal Structure Of Nurf55 In Complex With A H4 Pe 2e-14
2xyi_A430 Crystal Structure Of Nurf55 In Complex With A H4 Pe 4e-14
3gfc_A425 Crystal Structure Of Histone-Binding Protein Rbbp4 4e-14
3gfc_A425 Crystal Structure Of Histone-Binding Protein Rbbp4 2e-13
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 3e-10
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 4e-10
2h9l_A329 Wdr5delta23 Length = 329 4e-10
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 5e-10
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 5e-10
2g9a_A311 Structural Basis For The Specific Recognition Of Me 5e-10
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 5e-10
2g99_A308 Structural Basis For The Specific Recognition Of Me 5e-10
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 6e-10
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 6e-10
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 6e-10
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 6e-10
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 6e-10
2gnq_A336 Structure Of Wdr5 Length = 336 7e-10
2ynp_A604 Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 7e-10
3mkq_A 814 Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subco 7e-10
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 7e-10
2yno_A310 Yeast Betaprime Cop 1-304h6 Length = 310 7e-10
2ynn_A304 Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 7e-10
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 7e-10
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 9e-10
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 4e-09
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 2e-04
4aez_A401 Crystal Structure Of Mitotic Checkpoint Complex Len 4e-09
3fm0_A345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 5e-09
2pm9_A416 Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT O 3e-08
2hes_X330 Cytosolic Iron-sulphur Assembly Protein- 1 Length = 9e-08
2pbi_B354 The Multifunctional Nature Of Gbeta5RGS9 REVEALED F 3e-07
4aow_A340 Crystal Structure Of The Human Rack1 Protein At A R 4e-07
2aq5_A402 Crystal Structure Of Murine Coronin-1 Length = 402 5e-07
2aq5_A402 Crystal Structure Of Murine Coronin-1 Length = 402 5e-05
2zkq_a317 Structure Of A Mammalian Ribosomal 40s Subunit With 5e-07
4a11_B408 Structure Of The Hsddb1-Hscsa Complex Length = 408 6e-07
4i79_A399 Crystal Structure Of Human Nup43 Length = 399 7e-07
2b4e_A402 Crystal Structure Of Murine Coronin-1: Monoclinic F 1e-06
2b4e_A402 Crystal Structure Of Murine Coronin-1: Monoclinic F 6e-05
3jro_A 753 Nup84-Nup145c-Sec13 Edge Element Of The Npc Lattice 2e-06
2ymu_A577 Structure Of A Highly Repetitive Propeller Structur 2e-06
4ggd_A431 Structural Analysis Of Human Cdc20 Supports Multisi 3e-06
3jrp_A379 Sec13 With Nup145c (Aa109-179) Insertion Blade Leng 3e-06
4gga_A420 Structural Analysis Of Human Cdc20 Supports Multi-S 3e-06
2pm6_B297 Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF 3e-06
3zey_7318 High-resolution Cryo-electron Microscopy Structure 3e-06
3izb_a319 Localization Of The Small Subunit Ribosomal Protein 4e-06
3frx_A319 Crystal Structure Of The Yeast Orthologue Of Rack1, 4e-06
3rfg_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 4e-06
3jyv_R313 Structure Of The 40s Rrna And Proteins And PE TRNA 4e-06
1trj_A314 Homology Model Of Yeast Rack1 Protein Fitted Into 1 4e-06
2pm9_B297 Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT O 4e-06
3rfh_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 4e-06
4ggc_A318 Structural Analysis Of Human Cdc20 Supports Multi-S 6e-06
3mks_B464 Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH 7e-06
2xzm_R343 Crystal Structure Of The Eukaryotic 40s Ribosomal S 1e-05
4gqb_B344 Crystal Structure Of The Human Prmt5:mep50 Complex 1e-05
2pm7_B297 Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF 1e-05
3bg0_A316 Architecture Of A Coat For The Nuclear Pore Membran 3e-05
3bg0_A316 Architecture Of A Coat For The Nuclear Pore Membran 3e-05
2ovp_B445 Structure Of The Skp1-Fbw7 Complex Length = 445 3e-05
1p22_A435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 1e-04
1nex_B464 Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp 1e-04
3shf_A1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 2e-04
3sfz_A1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 2e-04
3dm0_A694 Maltose Binding Protein Fusion With Rack1 From A. T 2e-04
3iza_B1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 4e-04
1nr0_A611 Two Seven-Bladed Beta-Propeller Domains Revealed By 4e-04
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 6e-04
>pdb|3CFS|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure

Iteration: 1

Score = 114 bits (285), Expect = 2e-25, Method: Compositional matrix adjust. Identities = 80/247 (32%), Positives = 121/247 (48%), Gaps = 20/247 (8%) Query: 256 KGPGIPTP-----PLFSFSGHLTEGFAMDWSSTEPGVLATGDCKRNIHIWT----PREAG 306 K P P P P GH EG+ + W+S G L + + +W P+E Sbjct: 158 KHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGK 217 Query: 307 AWQVDQKPL-VGHTNSVEDLQWSPGEKRVLASCSVDLSIRIWDTRVINTKSCMLTLPNAH 365 VD K + GH+ VED+ W + + S + D + IWDTR NT S L +AH Sbjct: 218 I--VDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRS-NTTSKPSHLVDAH 274 Query: 366 TSDVNVISWN-RTEPLIVSGGDDGCIHVWDLRRFKKGSSVATFKHHTAPVTTVEWHPTES 424 T++VN +S+N +E ++ +G D + +WDLR K + TF+ H + V W P Sbjct: 275 TAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKL--KLHTFESHKDEIFQVHWSPHNE 332 Query: 425 STFASGGADDQIALWDLAVERDSEIEQREAELKDLPSQLLFIHLGQ-KEIKELHWHPQLP 483 + AS G D ++ +WDL+ + EQ + +D P +LLFIH G +I + W+P P Sbjct: 333 TILASSGTDRRLNVWDLSKIGE---EQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEP 389 Query: 484 GTIISTA 490 I S + Sbjct: 390 WVICSVS 396
>pdb|3CFV|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|2YBA|A Chain A, Crystal Structure Of Nurf55 In Complex With Histone H3 Length = 422 Back     alignment and structure
>pdb|2YBA|A Chain A, Crystal Structure Of Nurf55 In Complex With Histone H3 Length = 422 Back     alignment and structure
>pdb|3C99|A Chain A, Structural Basis Of Histone H4 Recognition By P55 Length = 432 Back     alignment and structure
>pdb|3C99|A Chain A, Structural Basis Of Histone H4 Recognition By P55 Length = 432 Back     alignment and structure
>pdb|2XYI|A Chain A, Crystal Structure Of Nurf55 In Complex With A H4 Peptide Length = 430 Back     alignment and structure
>pdb|2XYI|A Chain A, Crystal Structure Of Nurf55 In Complex With A H4 Peptide Length = 430 Back     alignment and structure
>pdb|3GFC|A Chain A, Crystal Structure Of Histone-Binding Protein Rbbp4 Length = 425 Back     alignment and structure
>pdb|3GFC|A Chain A, Crystal Structure Of Histone-Binding Protein Rbbp4 Length = 425 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2YNP|A Chain A, Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 604 Back     alignment and structure
>pdb|3MKQ|A Chain A, Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subcomplex Of The Copi Vesicular Coat Length = 814 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|2YNO|A Chain A, Yeast Betaprime Cop 1-304h6 Length = 310 Back     alignment and structure
>pdb|2YNN|A Chain A, Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 304 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|4AEZ|A Chain A, Crystal Structure Of Mitotic Checkpoint Complex Length = 401 Back     alignment and structure
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure
>pdb|2PM9|A Chain A, Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT OF THE Copii Vesicular Coat Length = 416 Back     alignment and structure
>pdb|2HES|X Chain X, Cytosolic Iron-sulphur Assembly Protein- 1 Length = 330 Back     alignment and structure
>pdb|2PBI|B Chain B, The Multifunctional Nature Of Gbeta5RGS9 REVEALED FROM ITS CRYSTAL Structure Length = 354 Back     alignment and structure
>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution Of 2.45 Angstrom Length = 340 Back     alignment and structure
>pdb|2AQ5|A Chain A, Crystal Structure Of Murine Coronin-1 Length = 402 Back     alignment and structure
>pdb|2AQ5|A Chain A, Crystal Structure Of Murine Coronin-1 Length = 402 Back     alignment and structure
>pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 Back     alignment and structure
>pdb|4A11|B Chain B, Structure Of The Hsddb1-Hscsa Complex Length = 408 Back     alignment and structure
>pdb|4I79|A Chain A, Crystal Structure Of Human Nup43 Length = 399 Back     alignment and structure
>pdb|2B4E|A Chain A, Crystal Structure Of Murine Coronin-1: Monoclinic Form Length = 402 Back     alignment and structure
>pdb|2B4E|A Chain A, Crystal Structure Of Murine Coronin-1: Monoclinic Form Length = 402 Back     alignment and structure
>pdb|3JRO|A Chain A, Nup84-Nup145c-Sec13 Edge Element Of The Npc Lattice Length = 753 Back     alignment and structure
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure
>pdb|4GGD|A Chain A, Structural Analysis Of Human Cdc20 Supports Multisite Degron Recognition By ApcC. Length = 431 Back     alignment and structure
>pdb|3JRP|A Chain A, Sec13 With Nup145c (Aa109-179) Insertion Blade Length = 379 Back     alignment and structure
>pdb|4GGA|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 420 Back     alignment and structure
>pdb|2PM6|B Chain B, Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF THE Copii Vesicular Coat, Native Version Length = 297 Back     alignment and structure
>pdb|3ZEY|7 Chain 7, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 318 Back     alignment and structure
>pdb|3IZB|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 319 Back     alignment and structure
>pdb|3FRX|A Chain A, Crystal Structure Of The Yeast Orthologue Of Rack1, Asc1. Length = 319 Back     alignment and structure
>pdb|3RFG|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P63 Length = 319 Back     alignment and structure
>pdb|3JYV|R Chain R, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 313 Back     alignment and structure
>pdb|1TRJ|A Chain A, Homology Model Of Yeast Rack1 Protein Fitted Into 11.7a Cryo-em Map Of Yeast 80s Ribosome Length = 314 Back     alignment and structure
>pdb|2PM9|B Chain B, Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT OF THE Copii Vesicular Coat Length = 297 Back     alignment and structure
>pdb|3RFH|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P21 Length = 319 Back     alignment and structure
>pdb|4GGC|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 318 Back     alignment and structure
>pdb|3MKS|B Chain B, Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH AN ALLOSTERIC Inhibitor Scf-I2 Length = 464 Back     alignment and structure
>pdb|2XZM|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 343 Back     alignment and structure
>pdb|4GQB|B Chain B, Crystal Structure Of The Human Prmt5:mep50 Complex Length = 344 Back     alignment and structure
>pdb|2PM7|B Chain B, Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF THE Copii Vesicular Coat, Selenomethionine Version Length = 297 Back     alignment and structure
>pdb|3BG0|A Chain A, Architecture Of A Coat For The Nuclear Pore Membrane Length = 316 Back     alignment and structure
>pdb|3BG0|A Chain A, Architecture Of A Coat For The Nuclear Pore Membrane Length = 316 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure
>pdb|1NEX|B Chain B, Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Complex Length = 464 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana Length = 694 Back     alignment and structure
>pdb|1NR0|A Chain A, Two Seven-Bladed Beta-Propeller Domains Revealed By The Structure Of A C. Elegans Homologue Of Yeast Actin Interacting Protein 1 (Aip1). Length = 611 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query812
2xyi_A430 Probable histone-binding protein CAF1; transcripti 1e-103
2xyi_A 430 Probable histone-binding protein CAF1; transcripti 7e-30
2xyi_A430 Probable histone-binding protein CAF1; transcripti 9e-10
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 6e-28
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 3e-26
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 7e-26
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 1e-24
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 3e-15
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 1e-14
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 7e-28
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 2e-22
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 2e-21
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 2e-19
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 5e-07
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 5e-07
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 1e-04
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 2e-04
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 3e-27
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 6e-22
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 8e-22
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 1e-11
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 1e-11
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 4e-09
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 1e-05
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 3e-04
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 3e-27
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 1e-24
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 4e-23
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 8e-21
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 2e-04
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 6e-04
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 7e-27
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 2e-23
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 6e-22
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 6e-05
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 9e-27
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 4e-20
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 1e-19
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 9e-19
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 6e-18
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 5e-17
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 1e-14
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 2e-12
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 7e-08
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 5e-07
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 2e-26
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 1e-23
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 2e-15
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 2e-13
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 5e-26
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 1e-23
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 1e-22
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 2e-22
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 3e-22
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 3e-22
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 4e-22
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 6e-14
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 4e-05
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 5e-05
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 3e-04
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 5e-26
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 4e-21
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 6e-20
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 3e-13
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 3e-06
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 6e-04
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 7e-04
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 6e-26
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 6e-26
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 2e-24
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 7e-20
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 1e-09
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 2e-09
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 2e-05
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 6e-04
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 8e-26
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 3e-19
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 2e-18
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 1e-12
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 2e-10
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 3e-04
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 1e-25
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 7e-24
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 1e-19
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 1e-08
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 1e-07
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 8e-05
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 2e-04
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 3e-25
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 2e-24
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 8e-20
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 3e-04
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 6e-04
3jrp_A379 Fusion protein of protein transport protein SEC13 7e-25
3jrp_A379 Fusion protein of protein transport protein SEC13 8e-24
3jrp_A379 Fusion protein of protein transport protein SEC13 3e-21
3jrp_A379 Fusion protein of protein transport protein SEC13 1e-20
3jrp_A379 Fusion protein of protein transport protein SEC13 5e-14
3jrp_A379 Fusion protein of protein transport protein SEC13 3e-06
2pm7_B297 Protein transport protein SEC13, protein transport 8e-25
2pm7_B297 Protein transport protein SEC13, protein transport 2e-21
2pm7_B297 Protein transport protein SEC13, protein transport 4e-21
2pm7_B297 Protein transport protein SEC13, protein transport 4e-20
2pm7_B297 Protein transport protein SEC13, protein transport 2e-07
2pm7_B297 Protein transport protein SEC13, protein transport 4e-06
4e54_B435 DNA damage-binding protein 2; beta barrel, double 2e-24
4e54_B435 DNA damage-binding protein 2; beta barrel, double 3e-20
4e54_B435 DNA damage-binding protein 2; beta barrel, double 8e-18
4e54_B435 DNA damage-binding protein 2; beta barrel, double 2e-14
4e54_B435 DNA damage-binding protein 2; beta barrel, double 2e-12
4e54_B435 DNA damage-binding protein 2; beta barrel, double 2e-07
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 4e-04
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 6e-24
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 6e-22
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 3e-21
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 1e-20
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 2e-04
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 2e-23
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 6e-22
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 1e-17
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 6e-14
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 5e-04
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 9e-04
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 2e-23
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 1e-21
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 4e-19
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 7e-18
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 6e-14
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 2e-23
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 5e-21
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 2e-20
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 3e-20
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 6e-17
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 4e-23
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 8e-21
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 3e-18
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 7e-16
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 2e-13
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 7e-04
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 6e-23
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 7e-21
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 5e-20
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 8e-20
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 4e-13
3jro_A 753 Fusion protein of protein transport protein SEC13 1e-22
3jro_A753 Fusion protein of protein transport protein SEC13 9e-22
3jro_A 753 Fusion protein of protein transport protein SEC13 1e-19
3jro_A 753 Fusion protein of protein transport protein SEC13 1e-19
3jro_A753 Fusion protein of protein transport protein SEC13 1e-09
3jro_A 753 Fusion protein of protein transport protein SEC13 3e-06
3iz6_A305 40S ribosomal protein SA (S2P); eukaryotic ribosom 2e-22
3iz6_A305 40S ribosomal protein SA (S2P); eukaryotic ribosom 3e-20
3iz6_A305 40S ribosomal protein SA (S2P); eukaryotic ribosom 3e-20
3iz6_A305 40S ribosomal protein SA (S2P); eukaryotic ribosom 1e-18
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 4e-22
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 2e-20
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 2e-20
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 1e-18
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 5e-17
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 5e-22
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 3e-21
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 2e-19
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 6e-18
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 1e-21
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 2e-21
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 6e-21
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 2e-20
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 2e-19
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 2e-19
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 9e-12
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 2e-04
3ow8_A321 WD repeat-containing protein 61; structural genomi 1e-21
3ow8_A321 WD repeat-containing protein 61; structural genomi 1e-21
3ow8_A321 WD repeat-containing protein 61; structural genomi 2e-21
3ow8_A321 WD repeat-containing protein 61; structural genomi 4e-21
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 1e-21
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 7e-20
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 1e-18
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 5e-04
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 1e-21
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 8e-17
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 3e-11
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 3e-06
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 2e-21
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 4e-19
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 9e-18
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 3e-15
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 4e-13
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 8e-11
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 3e-21
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 3e-21
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 4e-21
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 5e-19
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 5e-12
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 2e-05
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 4e-21
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 3e-18
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 4e-17
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 3e-07
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 2e-05
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 6e-21
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 5e-19
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 4e-17
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 2e-15
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 4e-14
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 4e-11
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 9e-21
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 1e-18
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 3e-12
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 5e-06
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 1e-20
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 8e-20
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 5e-19
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 3e-16
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 3e-08
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 1e-20
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 3e-20
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 8e-20
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 1e-10
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 2e-20
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 1e-19
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 4e-19
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 3e-12
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 3e-20
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 8e-20
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 1e-16
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 7e-14
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 9e-10
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 5e-20
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 2e-19
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 1e-17
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 3e-17
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 5e-09
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 5e-05
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 6e-20
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 9e-17
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 1e-10
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 7e-10
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 6e-09
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 1e-19
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 4e-19
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 1e-14
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 1e-14
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 1e-13
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 3e-08
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 6e-19
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 1e-18
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 1e-13
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 8e-09
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 1e-05
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 2e-18
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 2e-18
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 1e-16
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 7e-14
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 6e-07
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 4e-17
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 2e-16
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 3e-15
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 4e-15
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 7e-17
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 2e-15
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 2e-13
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 5e-12
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 2e-10
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 1e-16
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 3e-13
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 2e-07
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 2e-06
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 2e-16
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 7e-11
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 2e-09
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 4e-04
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 7e-04
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 1e-15
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 4e-13
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 1e-09
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 1e-05
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 5e-15
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 2e-12
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 8e-05
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 5e-04
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 9e-13
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 2e-07
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 4e-06
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 6e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Length = 430 Back     alignment and structure
 Score =  324 bits (832), Expect = e-103
 Identities = 88/427 (20%), Positives = 154/427 (36%), Gaps = 65/427 (15%)

Query: 70  PSAYVMLHEAQTGAPCLSFDIIKDELGDERTAYPQTLYAVAGTQSKKFNFNRLIVMKMSN 129
           P  Y ++       P L+   + D    +   Y      + GT +     N L++  +  
Sbjct: 33  PFLYDLVMTHALEWPSLTAQWLPDVTKQDGKDYSVH-RLILGTHTSDEQ-NHLLIASVQL 90

Query: 130 LTSTEEDNERELEDDENDPFQLAEHNKKRGKGPGIPTPPLFSFSGHLTEGFAMDWSSTEP 189
            +   + +    ++++ +         K      I          H  E     +     
Sbjct: 91  PSEDAQFDGSHYDNEKGEFGGFGSVCGKIEIEIKI---------NHEGEVNRARYMPQNA 141

Query: 190 GVLATGDCKRNIHIWTPREAGAWQVDQKPLGGHTNSAEDLQWSDLKTALQTVDDPFQLAE 249
            V+AT     ++ ++                            D        +   +   
Sbjct: 142 CVIATKTPSSDVLVF----------------------------DYTKHPSKPEPSGE--- 170

Query: 250 HNKKRGKGPGIPTPPLFSFSGHLTEGFAMDWSSTEPGVLATGDCKRNIHIW---TPREAG 306
                         P     GH  EG+ + W+    G L +      I +W      +  
Sbjct: 171 ------------CQPDLRLRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEH 218

Query: 307 AWQVDQKPLVGHTNSVEDLQWSPGEKRVLASCSVDLSIRIWDTRVINTKSCMLTLPNAHT 366
                +    GHT  VED+ W    + +  S + D  + IWDTR  NT     T+  AHT
Sbjct: 219 RVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVD-AHT 277

Query: 367 SDVNVISWNR-TEPLIVSGGDDGCIHVWDLRRFKKGSSVATFKHHTAPVTTVEWHPTESS 425
           ++VN +S+N  +E ++ +G  D  + +WDLR  K    + +F+ H   +  V+W P   +
Sbjct: 278 AEVNCLSFNPYSEFILATGSADKTVALWDLRNLK--LKLHSFESHKDEIFQVQWSPHNET 335

Query: 426 TFASGGADDQIALWDLAVERDSEIEQREAELKDLPSQLLFIHLGQKE-IKELHWHPQLPG 484
             AS G D ++ +WDL+   +   EQ   + +D P +LLFIH G    I +  W+P  P 
Sbjct: 336 ILASSGTDRRLHVWDLSKIGE---EQSTEDAEDGPPELLFIHGGHTAKISDFSWNPNEPW 392

Query: 485 TIISTAN 491
            I S + 
Sbjct: 393 IICSVSE 399


>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Length = 430 Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Length = 430 Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Length = 416 Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Length = 416 Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Length = 416 Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Length = 416 Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Length = 416 Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Length = 416 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Length = 383 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Length = 383 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Length = 383 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Length = 383 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Length = 383 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Length = 383 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Length = 383 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Length = 383 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 377 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 377 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 377 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 377 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 377 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 377 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 377 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 377 Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Length = 316 Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Length = 316 Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Length = 316 Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Length = 316 Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Length = 316 Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Length = 316 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Length = 814 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Length = 814 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Length = 814 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Length = 814 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Length = 401 Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Length = 401 Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Length = 401 Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Length = 401 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Length = 351 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Length = 351 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Length = 351 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Length = 351 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Length = 351 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Length = 351 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Length = 351 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Length = 345 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Length = 345 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Length = 345 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Length = 345 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Length = 345 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Length = 345 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Length = 345 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Length = 345 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Length = 408 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Length = 408 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Length = 408 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Length = 408 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Length = 408 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Length = 408 Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Length = 402 Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Length = 402 Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Length = 402 Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Length = 402 Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Length = 402 Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Length = 402 Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Length = 402 Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Length = 330 Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Length = 330 Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Length = 330 Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Length = 330 Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Length = 330 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Length = 379 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Length = 379 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Length = 379 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Length = 379 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Length = 379 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Length = 379 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Length = 297 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Length = 297 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Length = 297 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Length = 297 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Length = 297 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Length = 297 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Length = 435 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Length = 435 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Length = 435 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Length = 435 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Length = 435 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Length = 435 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Length = 435 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A 2h13_A 3p4f_A 4a7j_A* 2h9l_A ... Length = 312 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A 2h13_A 3p4f_A 4a7j_A* 2h9l_A ... Length = 312 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A 2h13_A 3p4f_A 4a7j_A* 2h9l_A ... Length = 312 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A 2h13_A 3p4f_A 4a7j_A* 2h9l_A ... Length = 312 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A 2h13_A 3p4f_A 4a7j_A* 2h9l_A ... Length = 312 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Length = 372 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Length = 372 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Length = 372 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Length = 372 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Length = 372 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Length = 372 Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Length = 410 Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Length = 410 Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Length = 410 Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Length = 410 Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Length = 410 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Length = 354 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Length = 354 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Length = 354 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Length = 354 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Length = 354 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Length = 340 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Length = 340 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Length = 340 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Length = 340 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Length = 340 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Length = 340 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Length = 340 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Length = 340 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Length = 340 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Length = 340 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Length = 340 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, ER-golgi transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Length = 753 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, ER-golgi transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Length = 753 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, ER-golgi transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Length = 753 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, ER-golgi transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Length = 753 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, ER-golgi transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Length = 753 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, ER-golgi transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Length = 753 Back     alignment and structure
>3iz6_A 40S ribosomal protein SA (S2P); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Length = 305 Back     alignment and structure
>3iz6_A 40S ribosomal protein SA (S2P); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Length = 305 Back     alignment and structure
>3iz6_A 40S ribosomal protein SA (S2P); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Length = 305 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Length = 420 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Length = 420 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Length = 420 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Length = 420 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Length = 420 Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Length = 357 Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Length = 357 Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Length = 357 Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Length = 357 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Length = 321 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Length = 321 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Length = 321 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Length = 321 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Length = 366 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Length = 366 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Length = 366 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Length = 366 Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Length = 524 Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Length = 524 Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Length = 524 Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Length = 524 Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Length = 393 Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Length = 393 Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Length = 393 Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Length = 393 Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Length = 393 Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Length = 393 Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Length = 425 Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Length = 425 Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Length = 425 Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Length = 425 Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Length = 425 Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Length = 425 Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Length = 437 Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Length = 437 Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Length = 437 Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Length = 437 Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Length = 437 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Length = 337 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Length = 337 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Length = 337 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Length = 337 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Length = 337 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Length = 337 Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Length = 450 Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Length = 450 Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Length = 450 Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Length = 450 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Length = 319 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Length = 319 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Length = 319 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Length = 319 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Length = 319 Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Length = 313 Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Length = 313 Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Length = 313 Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Length = 313 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Length = 445 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Length = 445 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Length = 445 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Length = 445 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Length = 368 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Length = 368 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Length = 368 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Length = 368 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Length = 368 Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Length = 343 Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Length = 343 Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Length = 343 Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Length = 343 Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Length = 343 Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Length = 343 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Length = 397 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Length = 397 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Length = 397 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Length = 397 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Length = 397 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Length = 369 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Length = 369 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Length = 369 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Length = 369 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Length = 369 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Length = 369 Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Length = 694 Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Length = 694 Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Length = 694 Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Length = 694 Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Length = 694 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Length = 435 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Length = 435 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Length = 435 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Length = 435 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Length = 435 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Length = 464 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Length = 464 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Length = 464 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Length = 464 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Length = 342 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Length = 342 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Length = 342 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Length = 342 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Length = 342 Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Length = 902 Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Length = 902 Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Length = 902 Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Length = 902 Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Length = 447 Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Length = 447 Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Length = 447 Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Length = 447 Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Length = 447 Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 343 Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 343 Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 343 Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 343 Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Length = 434 Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Length = 434 Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Length = 434 Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Length = 434 Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Length = 355 Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Length = 355 Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Length = 355 Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Length = 355 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query812
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
2xyi_A430 Probable histone-binding protein CAF1; transcripti 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
3jrp_A379 Fusion protein of protein transport protein SEC13 100.0
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
2xyi_A430 Probable histone-binding protein CAF1; transcripti 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 100.0
1k32_A 1045 Tricorn protease; protein degradation, substrate g 100.0
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.98
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.98
3jrp_A379 Fusion protein of protein transport protein SEC13 99.98
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.98
3jro_A753 Fusion protein of protein transport protein SEC13 99.97
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.97
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.97
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.97
3jro_A 753 Fusion protein of protein transport protein SEC13 99.97
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.97
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.97
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.96
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.96
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.96
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.96
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.96
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.96
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.96
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.96
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.95
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.95
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.94
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.93
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.93
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.92
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.91
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.9
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.89
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.89
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.88
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.87
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.87
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.87
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.87
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.86
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.85
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.85
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.85
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.85
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.84
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.83
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.82
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.82
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.82
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.82
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.81
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.81
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.81
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.81
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.8
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.79
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.77
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.77
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.77
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.74
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.73
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.71
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.7
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.69
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.68
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.67
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.67
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.66
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.64
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.63
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.58
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.58
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.56
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.56
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.56
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.56
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.56
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.55
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.55
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.54
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.53
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.51
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.5
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.48
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.48
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.47
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.43
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.41
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.39
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.37
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.36
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.36
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.36
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.35
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.34
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.32
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.31
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.28
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.27
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.26
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.26
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.24
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.24
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.22
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.21
4a2l_A 795 BT_4663, two-component system sensor histidine kin 99.21
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.21
4a2l_A 795 BT_4663, two-component system sensor histidine kin 99.18
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.16
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.14
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.13
3v9f_A 781 Two-component system sensor histidine kinase/RESP 99.12
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.11
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.09
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.08
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.06
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.04
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.04
3v9f_A781 Two-component system sensor histidine kinase/RESP 99.03
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.98
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.97
2qe8_A343 Uncharacterized protein; structural genomics, join 98.9
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 98.84
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.82
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.79
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.78
2qe8_A343 Uncharacterized protein; structural genomics, join 98.75
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.63
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.62
2ece_A462 462AA long hypothetical selenium-binding protein; 98.61
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.55
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.54
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 98.53
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 98.52
2ece_A462 462AA long hypothetical selenium-binding protein; 98.5
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.48
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.48
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.47
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.45
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.43
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.41
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 98.37
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.32
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.3
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.29
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 98.26
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.26
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.24
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.24
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.21
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.19
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 98.19
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.15
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.15
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.14
3v65_B386 Low-density lipoprotein receptor-related protein; 98.1
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.09
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.09
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 98.09
3v65_B386 Low-density lipoprotein receptor-related protein; 98.07
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.02
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.99
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.96
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 97.94
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.92
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.92
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 97.89
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.89
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.89
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.87
2p4o_A306 Hypothetical protein; putative lactonase, structur 97.86
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 97.86
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 97.85
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.83
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.82
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 97.81
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.77
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 97.77
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 97.73
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 97.72
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 97.71
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 97.71
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.68
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 97.68
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 97.68
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 97.55
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 97.54
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 97.48
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 97.47
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.46
3kya_A496 Putative phosphatase; structural genomics, joint c 97.45
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 97.44
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 97.38
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 97.26
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.24
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 97.17
3kya_A496 Putative phosphatase; structural genomics, joint c 97.15
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.13
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.1
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 97.08
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 97.07
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.07
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 96.97
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 96.92
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 96.9
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 96.73
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 96.43
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 96.41
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 96.18
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 96.1
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 96.02
2cn3_A 737 Xyloglucanase, beta-1,4-xyloglucan hydrolase; glyc 95.95
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 95.71
3ott_A 758 Two-component system sensor histidine kinase; beta 95.58
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 95.41
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 95.18
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 94.94
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 94.92
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 94.86
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 94.77
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 94.71
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 94.41
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 94.39
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 94.34
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 94.27
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 93.78
2cn3_A737 Xyloglucanase, beta-1,4-xyloglucan hydrolase; glyc 93.73
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 93.23
3ott_A758 Two-component system sensor histidine kinase; beta 92.58
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 92.13
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 91.98
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 91.86
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 91.43
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 91.28
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 91.2
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 90.88
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 90.48
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 89.01
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 87.51
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 84.29
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 83.33
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 83.26
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 81.64
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 80.87
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
Probab=100.00  E-value=8e-60  Score=538.75  Aligned_cols=525  Identities=14%  Similarity=0.165  Sum_probs=391.4

Q ss_pred             CCCCceEEEEeCCCCCCeEEEecCCCcEEEEccCCCCcccccccccCCCCCCeeeeeEcCCCCcEEEeeCCCceEEeeCC
Q psy4510         174 GHLTEGFAMDWSSTEPGVLATGDCKRNIHIWTPREAGAWQVDQKPLGGHTNSAEDLQWSDLKTALQTVDDPFQLAEHNKK  253 (812)
Q Consensus       174 gh~~~i~~~~~sp~~~~~lat~~~dg~v~iwd~~~~~~~~~~~~~l~~h~~~V~~l~~s~~~~~l~s~~~d~~i~vwd~~  253 (812)
                      .+.+.+.+++|+| +|++||+++ ++.|+||++.++.    ....+.+|...|++++|+|+|++||+|+.|++|+|||+.
T Consensus        16 ~~~g~~~~~~~sp-dg~~l~~~~-~~~v~l~~~~~~~----~~~~~~~h~~~v~~~~~spdg~~lasg~~d~~v~lWd~~   89 (611)
T 1nr0_A           16 TARGTAVVLGNTP-AGDKIQYCN-GTSVYTVPVGSLT----DTEIYTEHSHQTTVAKTSPSGYYCASGDVHGNVRIWDTT   89 (611)
T ss_dssp             CCTTCCCCCEECT-TSSEEEEEE-TTEEEEEETTCSS----CCEEECCCSSCEEEEEECTTSSEEEEEETTSEEEEEESS
T ss_pred             cccCceeEEeeCC-CCCEEEeCC-CCEEEEecCCCcc----cCeEecCCCCceEEEEECCCCcEEEEEeCCCCEEEeECC
Confidence            3567788899999 999999998 5699999998766    667789999999999999999999999999999999997


Q ss_pred             CCCCCCCCCCCceEEcCCCCcEEEEEecCCCCCEEEEEeCC----CcEEEEeCCCCCcceeccccccCCCCCEEEEEEcC
Q psy4510         254 RGKGPGIPTPPLFSFSGHLTEGFAMDWSSTEPGVLATGDCK----RNIHIWTPREAGAWQVDQKPLVGHTNSVEDLQWSP  329 (812)
Q Consensus       254 ~~~~~~~~~~~~~~~~~h~~~v~~l~~sp~~~~~l~sg~~d----g~i~vwd~~~~~~~~~~~~~~~~h~~~v~~~~~~p  329 (812)
                      ++     .......+.+|.+.|.+++|+|++ .+|++++.+    +.|++||.  +.    ....+.+|...|++++|+|
T Consensus        90 ~~-----~~~~~~~~~~~~~~v~~v~fs~dg-~~l~~~~~~~~~~~~v~~wd~--~~----~~~~l~gh~~~v~~v~f~p  157 (611)
T 1nr0_A           90 QT-----THILKTTIPVFSGPVKDISWDSES-KRIAAVGEGRERFGHVFLFDT--GT----SNGNLTGQARAMNSVDFKP  157 (611)
T ss_dssp             ST-----TCCEEEEEECSSSCEEEEEECTTS-CEEEEEECCSSCSEEEEETTT--CC----BCBCCCCCSSCEEEEEECS
T ss_pred             CC-----cceeeEeecccCCceEEEEECCCC-CEEEEEECCCCceeEEEEeeC--CC----CcceecCCCCCceEEEECC
Confidence            64     224456788999999999999999 688877764    47888874  33    3567889999999999999


Q ss_pred             CCCeEEEEEECCCeEEEEECCCCCcccceeecCCcCCCCeEEEEEcCCCCEEEEEeCCCcEEEEecCCCCCCCceEEcc-
Q psy4510         330 GEKRVLASCSVDLSIRIWDTRVINTKSCMLTLPNAHTSDVNVISWNRTEPLIVSGGDDGCIHVWDLRRFKKGSSVATFK-  408 (812)
Q Consensus       330 ~~~~~l~s~~~dg~i~iwd~~~~~~~~~~~~~~~~~~~~v~~l~~~~~~~~l~sg~~dg~i~iwd~~~~~~~~~~~~~~-  408 (812)
                      +++..|++|+.|++|++||.+.   ..+...+ .+|...|++++|+|++++|++|+.|+.|++||++   .++.+..+. 
T Consensus       158 ~~~~~l~s~s~D~~v~lwd~~~---~~~~~~l-~~H~~~V~~v~fspdg~~las~s~D~~i~lwd~~---~g~~~~~~~~  230 (611)
T 1nr0_A          158 SRPFRIISGSDDNTVAIFEGPP---FKFKSTF-GEHTKFVHSVRYNPDGSLFASTGGDGTIVLYNGV---DGTKTGVFED  230 (611)
T ss_dssp             SSSCEEEEEETTSCEEEEETTT---BEEEEEE-CCCSSCEEEEEECTTSSEEEEEETTSCEEEEETT---TCCEEEECBC
T ss_pred             CCCeEEEEEeCCCeEEEEECCC---CeEeeee-ccccCceEEEEECCCCCEEEEEECCCcEEEEECC---CCcEeeeecc
Confidence            9986799999999999999873   4455566 7899999999999999999999999999999997   466677773 


Q ss_pred             ------cCCCCEEEEEEccCCCcEEEEEECCCCEEEEEcCCCCchhHHHhhhhhc-------------------------
Q psy4510         409 ------HHTAPVTTVEWHPTESSTFASGGADDQIALWDLAVERDSEIEQREAELK-------------------------  457 (812)
Q Consensus       409 ------~h~~~v~~v~~~p~~~~~l~s~~~dg~v~iwd~~~~~~~~~~~~~~~~~-------------------------  457 (812)
                            +|.+.|.+++|+|++ .+|++++.|++|++||+.+.+............                         
T Consensus       231 ~~~~~~~h~~~V~~v~~spdg-~~l~s~s~D~~v~lWd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~s~s~d~~i~~~  309 (611)
T 1nr0_A          231 DSLKNVAHSGSVFGLTWSPDG-TKIASASADKTIKIWNVATLKVEKTIPVGTRIEDQQLGIIWTKQALVSISANGFINFV  309 (611)
T ss_dssp             TTSSSCSSSSCEEEEEECTTS-SEEEEEETTSEEEEEETTTTEEEEEEECCSSGGGCEEEEEECSSCEEEEETTCCEEEE
T ss_pred             ccccccccCCCEEEEEECCCC-CEEEEEeCCCeEEEEeCCCCceeeeecCCCCccceeEEEEEcCCEEEEEeCCCcEEEE
Confidence                  799999999999997 699999999999999998764321000000000                         


Q ss_pred             c-CCCce-EEeecCCCceeEEEEcCCCCCEEEEEeCCC-eEEEEeCCCCCcccEEeecCCCCeeEEEEcCCCCCeEEEee
Q psy4510         458 D-LPSQL-LFIHLGQKEIKELHWHPQLPGTIISTANSG-FNIFRTISDLPSQLLFIHLGQKEIKELHWHPQLPGTIISTA  534 (812)
Q Consensus       458 ~-~~~~~-~~~~~~~~~v~~~~~~p~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~p~~~~~~i~~~  534 (812)
                      + ..... .....+...|.+++|+|++. .+++++.++ +.+|+..... ........+...|.+++|+++  +.+++.+
T Consensus       310 ~~~~~~~~~~~~gh~~~v~~l~~spdg~-~l~s~s~D~~v~~Wd~~~~~-~~~~~~~~h~~~v~~~~~s~~--~~l~s~s  385 (611)
T 1nr0_A          310 NPELGSIDQVRYGHNKAITALSSSADGK-TLFSADAEGHINSWDISTGI-SNRVFPDVHATMITGIKTTSK--GDLFTVS  385 (611)
T ss_dssp             ETTTTEEEEEECCCSSCEEEEEECTTSS-EEEEEETTSCEEEEETTTCC-EEECSSCSCSSCEEEEEECTT--SCEEEEE
T ss_pred             eCCCCCcceEEcCCCCCEEEEEEeCCCC-EEEEEeCCCcEEEEECCCCc-eeeecccCCcceEEEEEECCC--CcEEEEE
Confidence            0 00011 12223455899999999986 455555554 5666544332 222222345678999999987  5666666


Q ss_pred             CCCceEEEEeecccCccccccccc----ccc------cccCCC------CCCccccCCCccceEEecccceEEEEEEecc
Q psy4510         535 NSGFNIFRTISMSNLTSTEEDNER----ELE------DDESEG------SGDEDRRKDPVMNSYFIRHRGCINRVRTCQY  598 (812)
Q Consensus       535 ~~~~~~~~~~~~~~l~~~~~~~~~----~~~------~~~~~~------~~~~~~~~~~~~~~~~~~h~~~v~~l~~s~~  598 (812)
                      .++.     +.+|++.........    .+.      ....++      ............ .....|...+.+++|+|+
T Consensus       386 ~d~~-----v~~w~~~~~~~~~~~~~~~~~~~~~~~~~~s~dg~~~~~~~~~~v~~~~~~~-~~~~~~~~~v~~va~spd  459 (611)
T 1nr0_A          386 WDDH-----LKVVPAGGSGVDSSKAVANKLSSQPLGLAVSADGDIAVAACYKHIAIYSHGK-LTEVPISYNSSCVALSND  459 (611)
T ss_dssp             TTTE-----EEEECSSSSSSCTTSCCEEECSSCEEEEEECTTSSCEEEEESSEEEEEETTE-EEEEECSSCEEEEEECTT
T ss_pred             cCCc-----eEEeecCCccccccceeeeecCCCCcEEEEeCCCcEEEEEeCceEEEEeCCc-eeeeecCCCceEEEEeCC
Confidence            5532     223332221110000    000      000000      000000000000 112246778999999999


Q ss_pred             CCeEEEEeecCcceEEEEeccccccccCCcccccccccccCCCCCCCCCCeeeecCCCCceEEEEeCCCCCCeEEecCCC
Q psy4510         599 GSTTLAGVWGEVGKVGIWDLKTALQTVDDPFQLAEHNKKRGKGPGIPTPPLFSFSGHLTEGFAMDWSSTEPGVLATGDCK  678 (812)
Q Consensus       599 g~~l~~~~~~~dg~I~iwd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gh~~~V~~l~~sp~~~~~las~s~D  678 (812)
                      |++|++|  +.|++|++|++.+....                       .+.. .+|...|++++|+| ++++|++++.|
T Consensus       460 g~~lasg--s~D~~v~lwd~~~~~~~-----------------------~~~~-~~h~~~v~~v~fsp-dg~~las~s~d  512 (611)
T 1nr0_A          460 KQFVAVG--GQDSKVHVYKLSGASVS-----------------------EVKT-IVHPAEITSVAFSN-NGAFLVATDQS  512 (611)
T ss_dssp             SCEEEEE--ETTSEEEEEEEETTEEE-----------------------EEEE-EECSSCEEEEEECT-TSSEEEEEETT
T ss_pred             CCEEEEe--CCCCeEEEEEccCCcee-----------------------eeec-cCCCCceEEEEECC-CCCEEEEEcCC
Confidence            9999999  89999999999875310                       2233 68999999999999 89999999999


Q ss_pred             ceEEEEecCC-Cc------------eeEEEEecCCCCEEEeecCCCeEEEeecCCCCCccccc-ccccCC-CcceeEeEE
Q psy4510         679 RNIHIWTPRE-AG------------AWSVYLYTNRFGVLATGDCKRNIHIWTPREAGAWQVDQ-KPLVGH-TNSVEDLQW  743 (812)
Q Consensus       679 g~v~iWd~~~-~~------------~~~~~~~s~dg~~lasgs~dg~i~iwd~~~~~~~~~~~-~~~~gH-~~~V~~l~f  743 (812)
                      ++|++|++.+ ++            .+..++|+|||++||+|+.|++|++|++.++..   .. ..+.+| ...|++++|
T Consensus       513 ~~v~~w~~~~~~~~~~~~~~~~H~~~V~~v~fspdg~~lasgs~D~~v~lW~~~~~~~---~~~~~~~~h~~~~v~~v~f  589 (611)
T 1nr0_A          513 RKVIPYSVANNFELAHTNSWTFHTAKVACVSWSPDNVRLATGSLDNSVIVWNMNKPSD---HPIIIKGAHAMSSVNSVIW  589 (611)
T ss_dssp             SCEEEEEGGGTTEESCCCCCCCCSSCEEEEEECTTSSEEEEEETTSCEEEEETTCTTS---CCEEETTSSTTSCEEEEEE
T ss_pred             CCEEEEEcCCCCceeeeeeeeecccceeEEEECCCCCEEEEEECCCcEEEEECCCccc---ccchhhccCcccCeeEEEE
Confidence            9999999975 21            244567999999999999999999999988763   23 567899 899999999


Q ss_pred             ecCCceeEEeeccCCceEEeeec
Q psy4510         744 SPGEKRVLASCSVDRSNRIGARR  766 (812)
Q Consensus       744 s~dg~~~L~s~s~Dg~i~iWd~~  766 (812)
                      +|+++  |+|+|.|++|++|++.
T Consensus       590 s~d~~--l~s~~~D~~i~lW~~~  610 (611)
T 1nr0_A          590 LNETT--IVSAGQDSNIKFWNVP  610 (611)
T ss_dssp             EETTE--EEEEETTSCEEEEECC
T ss_pred             cCCCE--EEEecCCCCEEEEecc
Confidence            99996  9999999999999973



>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 812
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 8e-21
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 7e-14
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 9e-08
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 6e-06
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 0.001
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-20
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-09
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-07
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-19
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 3e-14
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 5e-12
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 1e-13
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 1e-11
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 8e-09
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-05
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-04
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 4e-04
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 3e-12
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 2e-07
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 2e-05
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 2e-11
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 3e-08
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 4e-07
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 4e-04
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 3e-11
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 3e-08
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 1e-07
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 5e-11
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-10
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-05
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-05
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 9e-11
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 3e-04
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 0.003
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 0.004
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 7e-10
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 2e-08
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 0.002
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 1e-09
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 3e-09
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 6e-08
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 4e-09
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 1e-07
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 0.001
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 5e-08
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 2e-05
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-04
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 2e-07
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 2e-04
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-07
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 3e-07
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 9e-07
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-06
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-06
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-06
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-05
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-04
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 5e-04
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 9e-05
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 2e-04
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 1e-04
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 3e-04
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-04
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 6e-04
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 0.003
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 6e-04
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: beta1-subunit of the signal-transducing G protein heterotrimer
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 92.5 bits (228), Expect = 8e-21
 Identities = 30/163 (18%), Positives = 62/163 (38%), Gaps = 11/163 (6%)

Query: 278 MDWSSTEPGVLATGDCKRNIHIWTPREAGAWQVDQKPLVGHTNSVEDLQWSPGEKRVLAS 337
               + +  +  +G C  +  +W  RE    Q       GH + +  + + P      A+
Sbjct: 189 SLSLAPDTRLFVSGACDASAKLWDVREGMCRQT----FTGHESDINAICFFPNGNA-FAT 243

Query: 338 CSVDLSIRIWDTRVINTKSCMLTLPNAHTSDVNVISWNRTEPLIVSGGDDGCIHVWDLRR 397
            S D + R++D R            +     +  +S++++  L+++G DD   +VWD   
Sbjct: 244 GSDDATCRLFDLRADQELMTYS--HDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDAL- 300

Query: 398 FKKGSSVATFKHHTAPVTTVEWHPTESSTFASGGADDQIALWD 440
             K         H   V+ +     +    A+G  D  + +W+
Sbjct: 301 --KADRAGVLAGHDNRVSCLGVTD-DGMAVATGSWDSFLKIWN 340


>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query812
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.97
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.97
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.97
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.96
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.96
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.96
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.96
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.96
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.96
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.96
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.95
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.95
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.95
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.93
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.93
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.92
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.86
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.83
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.81
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.8
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.8
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.78
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.78
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.76
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.76
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.72
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.64
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.62
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.59
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.46
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.35
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.3
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.27
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.25
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.13
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.07
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.02
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.01
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.01
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.96
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.94
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.83
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.77
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.71
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.68
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.66
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.64
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.58
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.53
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.42
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.39
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.05
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.58
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.52
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.28
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 96.92
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 96.85
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 96.84
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 96.67
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 96.51
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 96.44
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 96.35
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 96.12
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 96.07
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 95.66
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 94.78
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 94.34
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 94.2
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 93.31
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 93.29
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 93.1
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 92.9
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 92.89
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 91.72
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 90.54
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 89.46
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 87.09
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 84.98
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 82.09
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00  E-value=3.9e-37  Score=317.95  Aligned_cols=310  Identities=22%  Similarity=0.394  Sum_probs=244.7

Q ss_pred             CCceEEcCCCCcEEEEEecCCCCCEEEEEeCCCcEEEEeCCCCCcceeccccccCCCCCEEEEEEcCCCCeEEEEEECCC
Q psy4510         263 PPLFSFSGHLTEGFAMDWSSTEPGVLATGDCKRNIHIWTPREAGAWQVDQKPLVGHTNSVEDLQWSPGEKRVLASCSVDL  342 (812)
Q Consensus       263 ~~~~~~~~h~~~v~~l~~sp~~~~~l~sg~~dg~i~vwd~~~~~~~~~~~~~~~~h~~~v~~~~~~p~~~~~l~s~~~dg  342 (812)
                      ...++++||.+.|++|+|+|++ .+|+||+.||+|+|||+.++.    ....+.+|...|.+++|+|++. ++++++.++
T Consensus         8 ~~~~~L~GH~~~I~~l~~sp~~-~~l~s~s~Dg~i~iWd~~~~~----~~~~~~~h~~~V~~~~~~~~~~-~~~~~~~~~   81 (317)
T d1vyhc1           8 PEKYALSGHRSPVTRVIFHPVF-SVMVSASEDATIKVWDYETGD----FERTLKGHTDSVQDISFDHSGK-LLASCSADM   81 (317)
T ss_dssp             SCSCEEECCSSCEEEEEECSSS-SEEEEEESSSCEEEEETTTCC----CCEEECCCSSCEEEEEECTTSS-EEEEEETTS
T ss_pred             CccEEEcCCCCCeEEEEEcCCC-CEEEEEeCCCeEEEEECCCCC----EEEEEeCCCCcEEEEeeecccc-ccccccccc
Confidence            4567899999999999999998 799999999999999999887    5778889999999999999998 699999999


Q ss_pred             eEEEEECCCCCcccceeecCCcCCCCeEEEEEcCCCCEEEEEeCCCcEEEEecCCCCCCCceEEcccCCCCEEEEEEccC
Q psy4510         343 SIRIWDTRVINTKSCMLTLPNAHTSDVNVISWNRTEPLIVSGGDDGCIHVWDLRRFKKGSSVATFKHHTAPVTTVEWHPT  422 (812)
Q Consensus       343 ~i~iwd~~~~~~~~~~~~~~~~~~~~v~~l~~~~~~~~l~sg~~dg~i~iwd~~~~~~~~~~~~~~~h~~~v~~v~~~p~  422 (812)
                      .+.+|+....   .....+ ..|...+.++.|+++++.+++++.|+.+++||++   .+..+..+..|...+.+++|+|+
T Consensus        82 ~~~~~~~~~~---~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~  154 (317)
T d1vyhc1          82 TIKLWDFQGF---ECIRTM-HGHDHNVSSVSIMPNGDHIVSASRDKTIKMWEVQ---TGYCVKTFTGHREWVRMVRPNQD  154 (317)
T ss_dssp             CCCEEETTSS---CEEECC-CCCSSCEEEEEECSSSSEEEEEETTSEEEEEETT---TCCEEEEEECCSSCEEEEEECTT
T ss_pred             cccccccccc---cccccc-ccccccceeeeccCCCceEEeeccCcceeEeecc---cceeeeEEccCCCcceeeecccC
Confidence            9999998743   333333 7889999999999999999999999999999998   56788899999999999999998


Q ss_pred             CCcEEEEEECCCCEEEEEcCCCCchhHHHhhhhhccCCCceEEeecCCCceeEEEEcCCCCCEEEEEeCCCeEEEEeCCC
Q psy4510         423 ESSTFASGGADDQIALWDLAVERDSEIEQREAELKDLPSQLLFIHLGQKEIKELHWHPQLPGTIISTANSGFNIFRTISD  502 (812)
Q Consensus       423 ~~~~l~s~~~dg~v~iwd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~p~~~~~~~~~~~~~~~~~~~~~~  502 (812)
                      + .+|++++.|+.|++|++.....                ......+...+..+.|+|+...                  
T Consensus       155 ~-~~l~~~~~d~~v~~~~~~~~~~----------------~~~~~~~~~~i~~~~~~~~~~~------------------  199 (317)
T d1vyhc1         155 G-TLIASCSNDQTVRVWVVATKEC----------------KAELREHRHVVECISWAPESSY------------------  199 (317)
T ss_dssp             S-SEEEEEETTSCEEEEETTTCCE----------------EEEECCCSSCEEEEEECCSCGG------------------
T ss_pred             C-CEEEEEeCCCeEEEEeecccee----------------eEEEecCCCCceEEEEeecccc------------------
Confidence            6 6999999999999999987631                1111222223444444443110                  


Q ss_pred             CCcccEEeecCCCCeeEEEEcCCCCCeEEEeeCCCceEEEEeecccCcccccccccccccccCCCCCCccccCCCccceE
Q psy4510         503 LPSQLLFIHLGQKEIKELHWHPQLPGTIISTANSGFNIFRTISMSNLTSTEEDNERELEDDESEGSGDEDRRKDPVMNSY  582 (812)
Q Consensus       503 ~~~~~~~~~~~~~~i~~~~~~p~~~~~~i~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  582 (812)
                                                ..+                                                   
T Consensus       200 --------------------------~~~---------------------------------------------------  202 (317)
T d1vyhc1         200 --------------------------SSI---------------------------------------------------  202 (317)
T ss_dssp             --------------------------GGG---------------------------------------------------
T ss_pred             --------------------------cee---------------------------------------------------
Confidence                                      000                                                   


Q ss_pred             EecccceEEEEEEeccCCeEEEEeecCcceEEEEeccccccccCCcccccccccccCCCCCCCCCCeeeecCCCCceEEE
Q psy4510         583 FIRHRGCINRVRTCQYGSTTLAGVWGEVGKVGIWDLKTALQTVDDPFQLAEHNKKRGKGPGIPTPPLFSFSGHLTEGFAM  662 (812)
Q Consensus       583 ~~~h~~~v~~l~~s~~g~~l~~~~~~~dg~I~iwd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gh~~~V~~l  662 (812)
                        ..............+..++++  +.||.|++|++.++.                         ++.++.+|...|.++
T Consensus       203 --~~~~~~~~~~~~~~~~~~~~~--~~d~~i~~~~~~~~~-------------------------~~~~~~~~~~~v~~~  253 (317)
T d1vyhc1         203 --SEATGSETKKSGKPGPFLLSG--SRDKTIKMWDVSTGM-------------------------CLMTLVGHDNWVRGV  253 (317)
T ss_dssp             --GGCCSCC-------CCEEEEE--ETTSEEEEEETTTTE-------------------------EEEEEECCSSCEEEE
T ss_pred             --eccccceeeeeccCCceeEec--cCCCEEEEEECCCCc-------------------------EEEEEeCCCCCEEEE
Confidence              000011122334456678887  899999999999876                         788899999999999


Q ss_pred             EeCCCCCCeEEecCCCceEEEEecCCCceeEEEEecCCCCEEEeecCCCeEEEeecCCCCCcccccccccCCCcceeEeE
Q psy4510         663 DWSSTEPGVLATGDCKRNIHIWTPREAGAWSVYLYTNRFGVLATGDCKRNIHIWTPREAGAWQVDQKPLVGHTNSVEDLQ  742 (812)
Q Consensus       663 ~~sp~~~~~las~s~Dg~v~iWd~~~~~~~~~~~~s~dg~~lasgs~dg~i~iwd~~~~~~~~~~~~~~~gH~~~V~~l~  742 (812)
                      +|+| ++++|++++.||+|+|||                                +.+++    ++.++.+|.+.|++|+
T Consensus       254 ~~~~-~~~~l~s~~~dg~i~iwd--------------------------------~~~~~----~~~~~~~h~~~V~~~~  296 (317)
T d1vyhc1         254 LFHS-GGKFILSCADDKTLRVWD--------------------------------YKNKR----CMKTLNAHEHFVTSLD  296 (317)
T ss_dssp             EECS-SSSCEEEEETTTEEEEEC--------------------------------CTTSC----CCEEEECCSSCEEEEE
T ss_pred             EECC-CCCEEEEEECCCeEEEEE--------------------------------CCCCc----EEEEEcCCCCCEEEEE
Confidence            9999 666666666665555555                                44555    4667889999999999


Q ss_pred             EecCCceeEEeeccCCceEEee
Q psy4510         743 WSPGEKRVLASCSVDRSNRIGA  764 (812)
Q Consensus       743 fs~dg~~~L~s~s~Dg~i~iWd  764 (812)
                      |+|+++ +|+|||.||+|+|||
T Consensus       297 ~s~~~~-~l~s~s~Dg~i~iWd  317 (317)
T d1vyhc1         297 FHKTAP-YVVTGSVDQTVKVWE  317 (317)
T ss_dssp             ECSSSS-CEEEEETTSEEEEEC
T ss_pred             EcCCCC-EEEEEeCCCeEEEeC
Confidence            999999 899999999999997



>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure