Psyllid ID: psy4520

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-
MSEYSLDLALQGVTTLWGSFEVQNKRLARIMLQQLVRKPLLDNLDKFDEYSDWFKTLPMYFLTFHGPQPLKLVMELVRKPLLDNLDKFDEYSDWFKTLPMYFLTFHGPQPLKLVMEAVEHAMYVYDTGHVIIDNVQFMLGLSDSALDRFYMQDTIIQEFRAFASRSHCHVTLVIHPRKENEQLTVNSVFGSAKATQESDNVLIIQQKFNQNLELKKFLQALPIERCPQFRDQPPGSTATYNGKCYIFYNRRPMNLRDSLAFCRSRGGSLVDESNPALQGFISWELSGLPDS
ccHHHHHHHHccccEEEEEEEEcHHHHHHHHHHHHHcccccccccccccccHHHccccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHcccccEEEcccccccHHHHHHHHHHHHHHccccEEEEccHHHHHcccccccHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccccccccccccccccccEEEEEEEcccHHHHHHHHHHccccccccccccccccEEEEccEEEEEEEcccccHHHHHHHccccccccccccccccccEEEEEEcccccc
ccHHHHHHHHccccEEEEEEEccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccEEEEEEcccccHHHHHHHHHHHHHHccccEEEEEcHHHHHcccccccHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccccccccccHHHHHcccEEEEEEcccccccccEEEEEEcccHcHHHcccccccccccccEEEEEEccccHcHHHHHHHHHcccccEEcccccccccEEEEEEcccccc
MSEYSLDLALQGVTTLWGSFEVQNKRLARIMLQQLVRKplldnldkfdeysdwfktlpmyfltfhgpqpLKLVMELVRKplldnldkfdeysdwfktlpmyfltfhgpqpLKLVMEAVEHAMYVYDTGHVIIDNVQFMLGLSDSALDRFYMQDTIIQEFRAFASRSHCHVTLvihprkeneqltVNSVFgsakatqesdNVLIIQQKFNQNLELKKFLqalpiercpqfrdqppgstatyngkcyifynrrpmnlrdSLAFCRsrggslvdesnpalqGFISwelsglpds
MSEYSLDLALQGVTTLWGSFEVQNKRLARIMLQQLVRKPLLDNLDKFDEYSDWFKTLPMYFLTFHGPQPLKLVMELVRKPLLDNLDKFDEYSDWFKTLPMYFLTFHGPQPLKLVMEAVEHAMYVYDTGHVIIDNVQFMLGLSDSALDRFYMQDTIIQEFRAFASRSHCHVTLVihprkeneqltVNSVFGSAKATQESDNVLIIQQKFNQNLELKKFLQALPIErcpqfrdqppgstatynGKCYIFYNRRPMNLRDSLAFCRSRGGSlvdesnpalqgfiswelsglpds
MSEYSLDLALQGVTTLWGSFEVQNKRLARIMLQQLVRKPLLDNLDKFDEYSDWFKTLPMYFLTFHGPQPLKLVMELVRKPLLDNLDKFDEYSDWFKTLPMYFLTFHGPQPLKLVMEAVEHAMYVYDTGHVIIDNVQFMLGLSDSALDRFYMQDTIIQEFRAFASRSHCHVTLVIHPRKENEQLTVNSVFGSAKATQESDNVLIIQQKFNQNLELKKFLQALPIERCPQFRDQPPGSTATYNGKCYIFYNRRPMNLRDSLAFCRSRGGSLVDESNPALQGFISWELSGLPDS
*****LDLALQGVTTLWGSFEVQNKRLARIMLQQLVRKPLLDNLDKFDEYSDWFKTLPMYFLTFHGPQPLKLVMELVRKPLLDNLDKFDEYSDWFKTLPMYFLTFHGPQPLKLVMEAVEHAMYVYDTGHVIIDNVQFMLGLSDSALDRFYMQDTIIQEFRAFASRSHCHVTLVIHPRKENEQLTVNSVFGSAK***ESDNVLIIQQKFNQNLELKKFLQALPIERCPQFRD***GSTATYNGKCYIFYNRRPMNLRDSLAFCRSRGGSLV*****ALQGFISWE*******
*SEYSLDLALQGVTTLWGSFEVQNKRLARIMLQQLVRKPLLDNLDKFDEYSDWFKTLPMYFLTF******************DNLDKFDEYSDWFKTLPMYFLTFHGPQPLKLVMEAVEHAMYVYDTGHVIIDNVQFMLGLSDSALDRFYMQDTIIQEFRAFASRSHCHVTLVIH*************FGSAKATQESDNVLIIQQKFNQNLELKKFLQALPIERCP***DQPPGSTATYNGKCYIFYNRRPMNLRDSLAF***************LQGFISWELSGLP**
MSEYSLDLALQGVTTLWGSFEVQNKRLARIMLQQLVRKPLLDNLDKFDEYSDWFKTLPMYFLTFHGPQPLKLVMELVRKPLLDNLDKFDEYSDWFKTLPMYFLTFHGPQPLKLVMEAVEHAMYVYDTGHVIIDNVQFMLGLSDSALDRFYMQDTIIQEFRAFASRSHCHVTLVIHPRKENEQLTVNSVFGSAKATQESDNVLIIQQKFNQNLELKKFLQALPIERCPQFRDQPPGSTATYNGKCYIFYNRRPMNLRDSLAFCRSRGGSLVDESNPALQGFISWELSGLPDS
MSEYSLDLALQGVTTLWGSFEVQNKRLARIMLQQLVRKPLLDNLDKFDEYSDWFKTLPMYFLTFHGPQPLKLVMELVRKPLLDNLDKFDEYSDWFKTLPMYFLTFHGPQPLKLVMEAVEHAMYVYDTGHVIIDNVQFMLGLSDSALDRFYMQDTIIQEFRAFASRSHCHVTLVIHPRKENEQLTVNSVFGSAKATQESDNVLIIQQKFNQNLELKKFLQALPIERCPQFRDQPPGSTATYNGKCYIFYNRRPMNLRDSLAFCRSRGGSLVDESNPALQGFISWELSGL***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEYSLDLALQGVTTLWGSFEVQNKRLARIMLQQLVRKPLLDNLDKFDEYSDWFKTLPMYFLTFHGPQPLKLVMELVRKPLLDNLDKFDEYSDWFKTLPMYFLTFHGPQPLKLVMEAVEHAMYVYDTGHVIIDNVQFMLGLSDSALDRFYMQDTIIQEFRAFASRSHCHVTLVIHPRKENEQLTVNSVFGSAKATQESDNVLIIQQKFNQNLELKKFLQALPIERCPQFRDQPPGSTATYNGKCYIFYNRRPMNLRDSLAFCRSRGGSLVDESNPALQGFISWELSGLPDS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query291 2.2.26 [Sep-21-2011]
Q96RR1684 Twinkle protein, mitochon yes N/A 0.611 0.260 0.447 2e-46
Q8CIW5685 Twinkle protein, mitochon yes N/A 0.611 0.259 0.434 7e-46
Q5ZIW1669 Twinkle protein, mitochon yes N/A 0.611 0.266 0.434 3e-45
>sp|Q96RR1|PEO1_HUMAN Twinkle protein, mitochondrial OS=Homo sapiens GN=PEO1 PE=1 SV=1 Back     alignment and function desciption
 Score =  186 bits (472), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 99/221 (44%), Positives = 132/221 (59%), Gaps = 43/221 (19%)

Query: 1   MSEYSLDLALQGVTTLWGSFEVQNKRLARIMLQQLVRKPLLDNLDKFDEYSDWFKTLPMY 60
           +SEY+LDL  QGV TLWGSFE+ N RLAR+ML Q     L D L                
Sbjct: 425 ISEYALDLCSQGVNTLWGSFEISNVRLARVMLTQFAEGRLEDQL---------------- 468

Query: 61  FLTFHGPQPLKLVMELVRKPLLDNLDKFDEYSDWFKTLPMYFLTFHGPQPLKLVMEAVEH 120
                                    DK+D ++D F+ LP+YF+TFHG Q ++ V++ ++H
Sbjct: 469 -------------------------DKYDHWADRFEDLPLYFMTFHGQQSIRTVIDTMQH 503

Query: 121 AMYVYDTGHVIIDNVQFMLGLSDSALDRFYMQDTIIQEFRAFASRSHCHVTLVIHPRKEN 180
           A+YVYD  HVIIDN+QFM+G    + DR   QD II  FR FA+ ++CHVTLVIHPRKE+
Sbjct: 504 AVYVYDICHVIIDNLQFMMGHEQLSTDRIAAQDYIIGVFRKFATDNNCHVTLVIHPRKED 563

Query: 181 E--QLTVNSVFGSAKATQESDNVLIIQQKFNQNLELKKFLQ 219
           +  +L   S+FGSAKA+QE+DNVLI+Q +       K++LQ
Sbjct: 564 DDKELQTASIFGSAKASQEADNVLILQDRKLVTGPGKRYLQ 604
Involved in mitochondrial DNA (mtDNA) metabolism. Could function as an adenine nucleotide-dependent DNA helicase. Function inferred to be critical for lifetime maintenance of mtDNA integrity. In vitro, forms in combination with POLG, a processive replication machinery, which can use double-stranded DNA (dsDNA) as template to synthesize single-stranded DNA (ssDNA) molecules. May be a key regulator of mtDNA copy number in mammals.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 2
>sp|Q8CIW5|PEO1_MOUSE Twinkle protein, mitochondrial OS=Mus musculus GN=Peo1 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZIW1|PEO1_CHICK Twinkle protein, mitochondrial OS=Gallus gallus GN=PEO1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query291
322795386 542 hypothetical protein SINV_00308 [Solenop 0.615 0.330 0.545 1e-56
193685982 574 PREDICTED: twinkle protein, mitochondria 0.615 0.311 0.515 5e-56
307166665 940 Twinkle protein, mitochondrial [Camponot 0.611 0.189 0.536 6e-56
307213491 479 Twinkle protein, mitochondrial [Harpegna 0.611 0.371 0.524 4e-55
345490046 623 PREDICTED: twinkle protein, mitochondria 0.635 0.296 0.508 8e-55
383862285 555 PREDICTED: twinkle protein, mitochondria 0.615 0.322 0.508 3e-54
189235245 491 PREDICTED: similar to pom1 [Tribolium ca 0.611 0.362 0.515 9e-54
270003724 403 hypothetical protein TcasGA2_TC002994 [T 0.611 0.441 0.515 9e-54
350422873 622 PREDICTED: twinkle protein, mitochondria 0.615 0.287 0.5 2e-53
380019396 447 PREDICTED: twinkle protein, mitochondria 0.615 0.400 0.486 6e-53
>gi|322795386|gb|EFZ18165.1| hypothetical protein SINV_00308 [Solenopsis invicta] Back     alignment and taxonomy information
 Score =  225 bits (574), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 121/222 (54%), Positives = 148/222 (66%), Gaps = 43/222 (19%)

Query: 1   MSEYSLDLALQGVTTLWGSFEVQNKRLARIMLQQLVRKPLLDNLDKFDEYSDWFKTLPMY 60
           MSEYSLDLA+QGV TLWGSFE++N RLAR MLQQ+             E S         
Sbjct: 315 MSEYSLDLAMQGVNTLWGSFEIRNARLARTMLQQMA------------EVS--------- 353

Query: 61  FLTFHGPQPLKLVMELVRKPLLDNLDKFDEYSDWFKTLPMYFLTFHGPQPLKLVMEAVEH 120
                               L +NLDKF+ Y+D F  LP+YF+TFHG Q +K+VM+AVEH
Sbjct: 354 --------------------LEENLDKFNSYADAFNKLPIYFMTFHGQQNIKVVMDAVEH 393

Query: 121 AMYVYDTGHVIIDNVQFMLGLS-DSALDRFYMQDTIIQEFRAFASRSHCHVTLVIHPRKE 179
           A YV+D  HVIIDNVQFM+G+S D   DRF+ QD II EFR FA++ +CHVTLVIHPRKE
Sbjct: 394 ATYVHDIAHVIIDNVQFMMGMSEDITSDRFWKQDKIIAEFRNFATKHNCHVTLVIHPRKE 453

Query: 180 -NEQLTVNSVFGSAKATQESDNVLIIQQKFNQNLELKKFLQA 220
            NE+LT  S+FGSAKA+QE+DNVLIIQ K   +++ KK+LQ 
Sbjct: 454 RNEELTTLSIFGSAKASQEADNVLIIQDKRLTSIKGKKYLQV 495

Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|193685982|ref|XP_001942891.1| PREDICTED: twinkle protein, mitochondrial-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307166665|gb|EFN60662.1| Twinkle protein, mitochondrial [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307213491|gb|EFN88900.1| Twinkle protein, mitochondrial [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|345490046|ref|XP_001604051.2| PREDICTED: twinkle protein, mitochondrial-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383862285|ref|XP_003706614.1| PREDICTED: twinkle protein, mitochondrial-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|189235245|ref|XP_970366.2| PREDICTED: similar to pom1 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270003724|gb|EFA00172.1| hypothetical protein TcasGA2_TC002994 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|350422873|ref|XP_003493311.1| PREDICTED: twinkle protein, mitochondrial-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|380019396|ref|XP_003693593.1| PREDICTED: twinkle protein, mitochondrial-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query291
UNIPROTKB|B0XE78660 CpipJ_CPIJ017385 "Pom1" [Culex 0.508 0.224 0.565 1.3e-42
UNIPROTKB|B4Q887613 GD22331 "GD22331" [Drosophila 0.508 0.241 0.56 4e-42
UNIPROTKB|Q16JS5671 AAEL013237 "AAEL013237-PA" [Ae 0.508 0.220 0.565 2.3e-41
UNIPROTKB|B4JE32616 GH10441 "GH10441" [Drosophila 0.508 0.240 0.573 7.5e-41
UNIPROTKB|B4KJD8620 GI24377 "GI24377" [Drosophila 0.508 0.238 0.566 1.3e-40
UNIPROTKB|B4HWB5613 GM12211 "GM12211" [Drosophila 0.508 0.241 0.56 5.6e-40
UNIPROTKB|B3MP19614 GF15234 "GF15234" [Drosophila 0.532 0.252 0.541 7.5e-40
UNIPROTKB|B4MTK6618 GK23862 "GK23862" [Drosophila 0.508 0.239 0.553 8.3e-40
UNIPROTKB|B4NYN0613 GE10270 "GE10270" [Drosophila 0.508 0.241 0.56 9.9e-40
FB|FBgn0032154613 mtDNA-helicase "mitochondrial 0.508 0.241 0.56 9.9e-40
UNIPROTKB|B0XE78 CpipJ_CPIJ017385 "Pom1" [Culex quinquefasciatus (taxid:7176)] Back     alignment and assigned GO terms
 Score = 452 (164.2 bits), Expect = 1.3e-42, P = 1.3e-42
 Identities = 86/152 (56%), Positives = 118/152 (77%)

Query:    72 LVMELVRKPLLDNLDKFDEYSDWFKTLPMYFLTFHGPQPLKLVMEAVEHAMYVYDTGHVI 131
             L+ ++  +PL  NL +FD ++D F+ LP+YF+TFHG QP+K+VM+A+EHA YV+D  HVI
Sbjct:   463 LLRQMAGRPLDVNLSEFDHWADEFEQLPVYFMTFHGQQPIKVVMDAIEHAQYVHDIQHVI 522

Query:   132 IDNVQFMLGLSDSA--LDRFYMQDTIIQEFRAFASRSHCHVTLVIHPRKENE--QLTVNS 187
             IDN+QFM+G+S+ +  LDR++ QD II  FR FA+R +CHVTLVIHPRKE +   LT +S
Sbjct:   523 IDNLQFMMGVSEESKHLDRYWKQDAIIASFRTFATRKNCHVTLVIHPRKERDTDDLTTSS 582

Query:   188 VFGSAKATQESDNVLIIQQKFNQNLELKKFLQ 219
             +FG AKA+QE+DNVLIIQ K   ++  KK+LQ
Sbjct:   583 IFGGAKASQEADNVLIIQDKRLTSVRGKKYLQ 614
GO:0003697 "single-stranded DNA binding" evidence=ISS
GO:0006264 "mitochondrial DNA replication" evidence=ISS
GO:0042645 "mitochondrial nucleoid" evidence=ISS
GO:0043139 "5'-3' DNA helicase activity" evidence=ISS
UNIPROTKB|B4Q887 GD22331 "GD22331" [Drosophila simulans (taxid:7240)] Back     alignment and assigned GO terms
UNIPROTKB|Q16JS5 AAEL013237 "AAEL013237-PA" [Aedes aegypti (taxid:7159)] Back     alignment and assigned GO terms
UNIPROTKB|B4JE32 GH10441 "GH10441" [Drosophila grimshawi (taxid:7222)] Back     alignment and assigned GO terms
UNIPROTKB|B4KJD8 GI24377 "GI24377" [Drosophila mojavensis (taxid:7230)] Back     alignment and assigned GO terms
UNIPROTKB|B4HWB5 GM12211 "GM12211" [Drosophila sechellia (taxid:7238)] Back     alignment and assigned GO terms
UNIPROTKB|B3MP19 GF15234 "GF15234" [Drosophila ananassae (taxid:7217)] Back     alignment and assigned GO terms
UNIPROTKB|B4MTK6 GK23862 "GK23862" [Drosophila willistoni (taxid:7260)] Back     alignment and assigned GO terms
UNIPROTKB|B4NYN0 GE10270 "GE10270" [Drosophila yakuba (taxid:7245)] Back     alignment and assigned GO terms
FB|FBgn0032154 mtDNA-helicase "mitochondrial DNA helicase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query291
cd01122271 cd01122, GP4d_helicase, GP4d_helicase is a homohex 6e-46
pfam13481154 pfam13481, AAA_25, AAA domain 1e-06
smart00034124 smart00034, CLECT, C-type lectin (CTL) or carbohyd 3e-05
cd00037116 cd00037, CLECT, C-type lectin (CTL)/C-type lectin- 0.001
cd03591114 cd03591, CLECT_collectin_like, C-type lectin-like 0.004
>gnl|CDD|238542 cd01122, GP4d_helicase, GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information 
 Score =  155 bits (394), Expect = 6e-46
 Identities = 53/217 (24%), Positives = 85/217 (39%), Gaps = 44/217 (20%)

Query: 1   MSEYSLDLALQ-GVTTLWGSFEVQNKRLARIMLQQLVRKPLLDNLDKFDEYSDWFKTLPM 59
           + EY+LDL  Q GV     S E    R AR +L Q   K L      F            
Sbjct: 47  LREYALDLITQHGVRVGTISLEEPVVRTARRLLGQYAGKRLHLPDTVFIYT--------- 97

Query: 60  YFLTFHGPQPLKLVMELVRKPLLDNLDKFDEYSDWFKTLPMYFLTFHGPQ-PLKLVMEAV 118
                                    L++FD   D F+     F+     +  +  V+E V
Sbjct: 98  -------------------------LEEFDAAFDEFEGTGRLFMYDSFGEYSMDSVLEKV 132

Query: 119 EHAMYVYDTGHVIIDNVQFMLGLSDSALDRFYMQDTIIQEFRAFASRSHCHVTLVIHPRK 178
            +    +   H+IIDN+  M+    ++ D     D I+ + R FA+    H+TLV H R+
Sbjct: 133 RYMAVSHGIQHIIIDNLSIMVSDERASGDERKALDEIMTKLRGFATEHGIHITLVSHLRR 192

Query: 179 --------ENEQLTVNSVFGSAKATQESDNVLIIQQK 207
                   E  +++++   GSA   Q +DNV+ +++ 
Sbjct: 193 PDGDKTHEEGGEVSLSDFRGSAAIGQLADNVIALERN 229

Helicases couple NTP hydrolysis to the unwinding of nucleic acid duplexes into their component strands. Length = 271
>gnl|CDD|222165 pfam13481, AAA_25, AAA domain Back     alignment and domain information
>gnl|CDD|214480 smart00034, CLECT, C-type lectin (CTL) or carbohydrate-recognition domain (CRD) Back     alignment and domain information
>gnl|CDD|153057 cd00037, CLECT, C-type lectin (CTL)/C-type lectin-like (CTLD) domain Back     alignment and domain information
>gnl|CDD|153061 cd03591, CLECT_collectin_like, C-type lectin-like domain (CTLD) of the type found in human collectins including lung surfactant proteins A and D, mannose- or mannan binding lectin (MBL), and CL-L1 (collectin liver 1) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 291
COG0305435 DnaB Replicative DNA helicase [DNA replication, re 100.0
PRK08006471 replicative DNA helicase; Provisional 100.0
PRK08840464 replicative DNA helicase; Provisional 100.0
PRK07004460 replicative DNA helicase; Provisional 100.0
PRK06749428 replicative DNA helicase; Provisional 100.0
PRK05636505 replicative DNA helicase; Provisional 100.0
PRK06321472 replicative DNA helicase; Provisional 100.0
PRK06904472 replicative DNA helicase; Validated 100.0
PRK08760476 replicative DNA helicase; Provisional 100.0
PRK08506472 replicative DNA helicase; Provisional 100.0
PRK05595444 replicative DNA helicase; Provisional 100.0
PRK09165497 replicative DNA helicase; Provisional 100.0
PHA02542473 41 41 helicase; Provisional 100.0
PRK05748448 replicative DNA helicase; Provisional 100.0
KOG2373|consensus514 100.0
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 100.0
TIGR00665434 DnaB replicative DNA helicase. This model describe 100.0
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 100.0
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 100.0
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 99.97
PRK07773 886 replicative DNA helicase; Validated 99.96
PRK05973237 replicative DNA helicase; Provisional 99.72
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 99.38
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 99.33
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 99.29
cd01124187 KaiC KaiC is a circadian clock protein primarily f 99.21
PRK11823 446 DNA repair protein RadA; Provisional 99.2
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 99.17
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 99.15
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 99.14
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 99.13
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 99.13
PRK09361225 radB DNA repair and recombination protein RadB; Pr 99.06
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 99.02
cd01393226 recA_like RecA is a bacterial enzyme which has rol 99.0
cd01394218 radB RadB. The archaeal protein radB shares simila 98.86
PRK04328249 hypothetical protein; Provisional 98.84
PRK09302 509 circadian clock protein KaiC; Reviewed 98.77
TIGR02237209 recomb_radB DNA repair and recombination protein R 98.76
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 98.75
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 98.68
COG1066 456 Sms Predicted ATP-dependent serine protease [Postt 98.58
PRK09302509 circadian clock protein KaiC; Reviewed 98.56
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 98.4
PRK07773886 replicative DNA helicase; Validated 98.35
PRK04301317 radA DNA repair and recombination protein RadA; Va 98.24
PRK06067234 flagellar accessory protein FlaH; Validated 98.08
TIGR02236310 recomb_radA DNA repair and recombination protein R 98.05
TIGR02239316 recomb_RAD51 DNA repair protein RAD51. This eukary 97.97
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 97.94
PLN03186342 DNA repair protein RAD51 homolog; Provisional 97.93
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 97.89
cd00983325 recA RecA is a bacterial enzyme which has roles in 97.83
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 97.81
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.79
TIGR02012321 tigrfam_recA protein RecA. This model describes or 97.78
PRK09354349 recA recombinase A; Provisional 97.57
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 97.48
PTZ00035337 Rad51 protein; Provisional 97.37
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 97.29
COG3598402 RepA RecA-family ATPase [DNA replication, recombin 97.09
PF00154322 RecA: recA bacterial DNA recombination protein; In 96.61
PRK09519 790 recA DNA recombination protein RecA; Reviewed 96.34
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 96.07
COG2874235 FlaH Predicted ATPases involved in biogenesis of a 94.8
PF13479213 AAA_24: AAA domain 94.74
PF07088 484 GvpD: GvpD gas vesicle protein; InterPro: IPR00978 93.94
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 93.3
PRK04296190 thymidine kinase; Provisional 89.09
PRK04208468 rbcL ribulose bisophosphate carboxylase; Reviewed 86.45
COG0468279 RecA RecA/RadA recombinase [DNA replication, recom 85.98
KOG1434|consensus335 85.83
cd08213412 RuBisCO_large_III Ribulose bisphosphate carboxylas 85.7
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 85.18
TIGR03326412 rubisco_III ribulose bisphosphate carboxylase, typ 84.83
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 84.76
cd08206414 RuBisCO_large_I_II_III Ribulose bisphosphate carbo 83.23
PF09807249 DUF2348: Uncharacterized conserved protein (DUF234 82.86
CHL00040475 rbcL ribulose-1,5-bisphosphate carboxylase/oxygena 82.35
cd08212450 RuBisCO_large_I Ribulose bisphosphate carboxylase 82.18
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 81.99
PF00016309 RuBisCO_large: Ribulose bisphosphate carboxylase l 81.77
PF07302221 AroM: AroM protein; InterPro: IPR010843 This famil 81.3
>COG0305 DnaB Replicative DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information 
Probab=100.00  E-value=1.1e-46  Score=368.62  Aligned_cols=205  Identities=14%  Similarity=0.139  Sum_probs=184.2

Q ss_pred             HHHHHHHH-cCCeEEEEeccCCHHHHHHHHHHHHhcCCCcccc---ccccchhhhhccccccccccCCCCchhHHHHHhh
Q psy4520           3 EYSLDLAL-QGVTTLWGSFEVQNKRLARIMLQQLVRKPLLDNL---DKFDEYSDWFKTLPMYFLTFHGPQPLKLVMELVR   78 (291)
Q Consensus         3 q~al~la~-qG~~v~~fSlEM~~~ql~~Rml~~~a~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~   78 (291)
                      .+|.|+|. ++.+|++||+||+.+|+++|||+..++++.....   ...++|                            
T Consensus       215 nia~n~a~~~~~~v~iFSLEM~~eql~~R~Ls~~s~v~~~kirtg~l~~~d~----------------------------  266 (435)
T COG0305         215 NIALNAAADGRKPVAIFSLEMSEEQLVMRLLSSESGIESSKLRTGRLSDDEW----------------------------  266 (435)
T ss_pred             HHHHHHHHhcCCCeEEEEccCCHHHHHHHhhccccccchhccccccccHHHH----------------------------
Confidence            45666663 7889999999999999999999999999987653   345566                            


Q ss_pred             ccchhhhhhHHHHHHhhcCCCeEEEcCCCCCCHHHHHHHHHHHHHhCCCcEEEEeccccccCCCCCCccHHHHHHHHHHH
Q psy4520          79 KPLLDNLDKFDEYSDWFKTLPMYFLTFHGPQPLKLVMEAVEHAMYVYDTGHVIIDNVQFMLGLSDSALDRFYMQDTIIQE  158 (291)
Q Consensus        79 ~~~~~~~~~~~~a~~~~~~~pl~i~d~~g~~~i~~i~~~~r~~~~~~gv~lviIDyLqlm~~~~~~~~~r~~~~~~i~r~  158 (291)
                             +++..|++.+.+.||||+|+++ .++.+|++++|++++++|+++++|||||+|.+.+ ..++|.+++++|+++
T Consensus       267 -------~~l~~a~~~l~~~~i~IdD~~~-~si~eir~~aRrlk~~~~l~~i~iDYLqLm~~~~-~~~~r~qevs~iSr~  337 (435)
T COG0305         267 -------ERLIKAASELSEAPIFIDDTPG-LTITEIRSKARRLKLKHNLGLIVIDYLQLMTGGK-KSENRKQEVSEISRS  337 (435)
T ss_pred             -------HHHHHHHHHHhhCCeeecCCCc-CCHHHHHHHHHHHHHhcCccEEEEEEEEeecccc-cchhHHHHHHHHHHH
Confidence                   7888899999999999999999 5999999999999999999999999999998765 347999999999999


Q ss_pred             HHHHHHhcCceEEEEec-cCCcC----CCCccccccccccccccCccEEEEEccCcc----ccccceEEEEecccCCCCc
Q psy4520         159 FRAFASRSHCHVTLVIH-PRKEN----EQLTVNSVFGSAKATQESDNVLIIQQKFNQ----NLELKKFLQALPIERCPQF  229 (291)
Q Consensus       159 LK~~Ake~~VpVilvsh-pRk~e----k~p~lsDLrgSg~IeQdAD~Vi~L~R~~~~----~~~~~~~l~I~KnR~~~~~  229 (291)
                      ||.||||++|||++++| +|.+|    |||+|||||+||+||||||+|+||||+++.    +..+.+++||+|||     
T Consensus       338 LK~lAkEl~vpvialSQLsR~~E~R~dkrP~lSDLRESGsIEQDAD~VmflyRde~y~~~~~~~g~aeiIi~K~R-----  412 (435)
T COG0305         338 LKGLAKELGVPVIALSQLNRSVEQRTDKRPMLSDLRESGALEQDADIVIFLHRDEAYLKDTPDRGEAEVIVAKNR-----  412 (435)
T ss_pred             HHHHHHhcCCcEEehhhhcccchhccccCCccccCccCCchhhhCCEEEEEechhhccCCCCCCceEEEEEEecc-----
Confidence            99999999999999999 99998    899999999999999999999999999863    23366789999985     


Q ss_pred             cCCCCCC-ceeeeceEeEEeeC
Q psy4520         230 RDQPPGS-TATYNGKCYIFYNR  250 (291)
Q Consensus       230 R~g~~G~-~l~f~g~~~~f~~~  250 (291)
                       |||+|+ .+.|++.+++|-|.
T Consensus       413 -nGp~GtV~l~f~~~~~~F~~~  433 (435)
T COG0305         413 -NGPTGTVKLAFDPQFTKFKNL  433 (435)
T ss_pred             -CCCCceEEEEEeccccccccc
Confidence             999999 99999999999775

>PRK08006 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08840 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK06749 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05636 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK06321 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK09165 replicative DNA helicase; Provisional Back     alignment and domain information
>PHA02542 41 41 helicase; Provisional Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>KOG2373|consensus Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK07773 replicative DNA helicase; Validated Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PRK07773 replicative DNA helicase; Validated Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>PF07088 GvpD: GvpD gas vesicle protein; InterPro: IPR009788 This family consists of several archaeal GvpD gas vesicle proteins Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK04208 rbcL ribulose bisophosphate carboxylase; Reviewed Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1434|consensus Back     alignment and domain information
>cd08213 RuBisCO_large_III Ribulose bisphosphate carboxylase large chain, Form III Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03326 rubisco_III ribulose bisphosphate carboxylase, type III Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd08206 RuBisCO_large_I_II_III Ribulose bisphosphate carboxylase large chain, Form I,II,III Back     alignment and domain information
>PF09807 DUF2348: Uncharacterized conserved protein (DUF2348); InterPro: IPR018627 Members of this family of putative uncharacterised proteins have no known function Back     alignment and domain information
>CHL00040 rbcL ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit Back     alignment and domain information
>cd08212 RuBisCO_large_I Ribulose bisphosphate carboxylase large chain, Form I Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PF00016 RuBisCO_large: Ribulose bisphosphate carboxylase large chain, catalytic domain; InterPro: IPR000685 Ribulose bisphosphate carboxylase (RuBisCO) [, ] catalyses the initial step in Calvin's reductive pentose phosphate cycle in plants as well as purple and green bacteria Back     alignment and domain information
>PF07302 AroM: AroM protein; InterPro: IPR010843 This family consists of several bacterial and archaeal AroM proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query291
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 4e-23
1sl6_A184 C-type lectin DC-signr; sugar binding protein; HET 1e-05
1wk1_A150 Hypothetical protein YK1067A12; lectin C-type doma 1e-05
1pwb_A177 SP-D, PSP-D, pulmonary surfactant-associated prote 3e-05
2ox9_A140 Collectin placenta 1; C-type lectin, sugar binding 5e-05
1buu_A168 Protein (mannose-binding protein A); lectin, HOST 6e-05
1tn3_A137 Tetranectin; plasminogen binding, kringle 4, C-typ 8e-05
3pbf_A148 Pulmonary surfactant-associated protein A; collect 1e-04
1jwi_A131 Bitiscetin; domain swapping, C-type lectin, toxin; 1e-04
3kqg_A182 Langerin, C-type lectin domain family 4 member K; 1e-04
2afp_A129 Protein (SEA raven type II antifreeze protein); re 1e-04
2ls8_A156 C-type lectin domain family 4 member D; structural 1e-04
2vuv_A129 Codakine; sugar-binding protein, C-type, lectin, m 1e-04
1hq8_A123 NKG2-D; homodimer, CIS-proline, apoptosis; 1.95A { 1e-04
1tdq_B130 Aggrecan core protein; extracellular matrix, lecti 1e-04
2b6b_D175 CD209 antigen; cryo EM dengue CRD DC-SIGN, icosahe 1e-04
3bdw_A123 Natural killer cells antigen CD94; NK cells, recep 2e-04
2xr6_A170 CD209 antigen; sugar binding protein, carbohydrate 2e-04
1htn_A182 Tetranectin; plasminogen binding, kringle 4, alpha 2e-04
3c22_A156 C-type lectin domain family 4 member K; coiled coi 2e-04
2zib_A133 Type II antifreeze protein; thermal hysteresis, le 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
1dv8_A128 Asialoglycoprotein receptor 1; C-type lectin CRD, 2e-04
1rtm_1149 Mannose-binding protein-A; lectin; 1.80A {Rattus n 3e-04
2py2_A136 Antifreeze protein type II; type II antifreeze pro 3e-04
1mpu_A138 NKG2-D type II integral membrane protein; C-type l 3e-04
1hup_A141 Mannose-binding protein; alpha-helical coiled-coil 4e-04
2h2t_B 175 Low affinity immunoglobulin epsilon FC receptor ( 4e-04
3vpp_A132 C-type lectin domain family 9 member A; dendritic 4e-04
2c6u_A122 CLEC1B protein; lectin, rhodocytin, aggretin, C-ty 4e-04
2bpd_A142 Dectin-1; receptor, beta-glucan, fungal recognitio 5e-04
1c3a_A135 Flavocetin-A: alpha subunit; C-type lectin-like do 5e-04
3bdw_B120 NKG2-A/NKG2-B type II integral membrane protein; N 6e-04
3ff7_C112 Killer cell lectin-like receptor subfamily G membe 7e-04
1qdd_A144 Lithostathine; pancreatic stone inhibitor, metal b 7e-04
3g8l_A190 Lectin-related NK cell receptor LY49L1; natural ki 8e-04
3g8k_A130 Lectin-related NK cell receptor LY49L1; natural ki 8e-04
1uv0_A149 Pancreatitis-associated protein 1; lectin, C-type, 9e-04
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Length = 503 Back     alignment and structure
 Score = 97.9 bits (243), Expect = 4e-23
 Identities = 23/214 (10%), Positives = 64/214 (29%), Gaps = 41/214 (19%)

Query: 1   MSEYSLDLALQ-GVTTLWGSFEVQNKRLARIMLQQLVRKPLLDNLDKFDEYSDWFKTLPM 59
           + + +L      G        E   +  A  ++    R  L  +     E  +  K    
Sbjct: 259 VRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKF--- 315

Query: 60  YFLTFHGPQPLKLVMELVRKPLLDNLDKFDEYSDWFKTLPMYFLTFHGPQPLKLVMEAVE 119
                                          + + F     +            ++  + 
Sbjct: 316 ----------------------------DQWFDELFGNDTFHLYDSFAEAETDRLLAKLA 347

Query: 120 HAMYVYDTGHVIIDNVQFMLGLSDSALDRFYMQDTIIQEFRAFASRSHCHVTLVIHPRKE 179
           +         +I+D++  ++  S  + D   M D ++ + + FA  +   + ++ H +  
Sbjct: 348 YMRSGLGCDVIILDHISIVVSASGES-DERKMIDNLMTKLKGFAKSTGVVLVVICHLKNP 406

Query: 180 NEQ--------LTVNSVFGSAKATQESDNVLIIQ 205
           ++         +++  + GS    Q SD ++ ++
Sbjct: 407 DKGKAHEEGRPVSITDLRGSGALRQLSDTIIALE 440
>1sl6_A C-type lectin DC-signr; sugar binding protein; HET: GAL NDG FUC; 2.25A {Homo sapiens} SCOP: d.169.1.1 PDB: 1xar_A Length = 184 Back     alignment and structure
>1wk1_A Hypothetical protein YK1067A12; lectin C-type domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Caenorhabditis elegans} SCOP: d.169.1.1 Length = 150 Back     alignment and structure
>1pwb_A SP-D, PSP-D, pulmonary surfactant-associated protein D; collectin, C-type lectin, alpha-helical coiled coil, carbohydrate recognition domain; HET: GLC; 1.40A {Homo sapiens} SCOP: d.169.1.1 h.1.1.1 PDB: 1pw9_A* 3ikn_A* 3ikp_A* 3ikq_A* 3ikr_A* 2rie_A* 2ggx_A* 2ggu_A* 2ork_A* 2orj_A* 2ria_A* 2rib_A* 2ric_A* 2rid_A* 2os9_A* 3dbz_A 3g81_A* 3g83_A* 1b08_A 3g84_A* ... Length = 177 Back     alignment and structure
>2ox9_A Collectin placenta 1; C-type lectin, sugar binding protein; HET: GAL NAG FUC; 1.95A {Mus musculus} PDB: 2ox8_A Length = 140 Back     alignment and structure
>1buu_A Protein (mannose-binding protein A); lectin, HOST defense, metalloprotein, sugar binding protein; 1.90A {Rattus norvegicus} SCOP: d.169.1.1 h.1.1.1 Length = 168 Back     alignment and structure
>1tn3_A Tetranectin; plasminogen binding, kringle 4, C-type lectin, carbohydrate recognition domain; 2.00A {Homo sapiens} SCOP: d.169.1.1 PDB: 1rjh_A 3l9j_C Length = 137 Back     alignment and structure
>3pbf_A Pulmonary surfactant-associated protein A; collectin, carbohydrate binding, lectin, mannose, sugar BIND protein; 1.80A {Rattus norvegicus} PDB: 1r14_A* 1r13_A* 3paq_A* 3par_A 3pak_A Length = 148 Back     alignment and structure
>1jwi_A Bitiscetin; domain swapping, C-type lectin, toxin; 2.00A {Bitis arietans} SCOP: d.169.1.1 PDB: 1uex_A Length = 131 Back     alignment and structure
>3kqg_A Langerin, C-type lectin domain family 4 member K; trimer, NECK and CRD, coiled coil, immune system; 2.30A {Homo sapiens} Length = 182 Back     alignment and structure
>2afp_A Protein (SEA raven type II antifreeze protein); recombinant SEA raven protein, solution backbone fold, C- type lectin; NMR {Hemitripterus americanus} SCOP: d.169.1.1 Length = 129 Back     alignment and structure
>2ls8_A C-type lectin domain family 4 member D; structural genomics, NEW YORK structural genomics research consortium, nysgrc, PSI-biology, immune system; NMR {Homo sapiens} Length = 156 Back     alignment and structure
>2vuv_A Codakine; sugar-binding protein, C-type, lectin, mannose, invertebrate; HET: CIT; 1.3A {Codakia orbicularis} PDB: 2vuz_A* Length = 129 Back     alignment and structure
>1hq8_A NKG2-D; homodimer, CIS-proline, apoptosis; 1.95A {Mus musculus} SCOP: d.169.1.1 PDB: 1jsk_A 1kcg_A* Length = 123 Back     alignment and structure
>1tdq_B Aggrecan core protein; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: d.169.1.1 Length = 130 Back     alignment and structure
>2b6b_D CD209 antigen; cryo EM dengue CRD DC-SIGN, icosahedral virus, virus-recepto; 25.00A {Homo sapiens} SCOP: d.169.1.1 Length = 175 Back     alignment and structure
>3bdw_A Natural killer cells antigen CD94; NK cells, receptor, glycoprotein, lectin, signal-A transmembrane, immune system receptor; 2.50A {Homo sapiens} SCOP: d.169.1.1 PDB: 3cdg_J 1b6e_A 3cii_G Length = 123 Back     alignment and structure
>2xr6_A CD209 antigen; sugar binding protein, carbohydrate binding, mannose; HET: MAN 07B; 1.35A {Homo sapiens} PDB: 1sl4_A* 2it6_A* 1k9i_A* 2xr5_A* 1sl5_A* 2it5_A* 1xph_A 1k9j_A* Length = 170 Back     alignment and structure
>1htn_A Tetranectin; plasminogen binding, kringle 4, alpha-helical coiled coil, C-type lectin, carbohydrate recognition domain; 2.80A {Homo sapiens} SCOP: d.169.1.1 h.1.1.1 Length = 182 Back     alignment and structure
>3c22_A C-type lectin domain family 4 member K; coiled coil, glycoprotein, membrane, signal-anchor, transmembrane, immune system, sugar binding protein; 1.50A {Homo sapiens} PDB: 3p5g_A* 3p5d_A* 3p5f_A* 3p5e_A* 3p5h_A* 3p5i_A* 3p7g_A* 3p7f_A* 3p7h_A* 3bc7_A* 3bbs_A* 3bc6_A* Length = 156 Back     alignment and structure
>2zib_A Type II antifreeze protein; thermal hysteresis, lectin; 1.34A {Brachyopsis rostratus} Length = 133 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1dv8_A Asialoglycoprotein receptor 1; C-type lectin CRD, signaling protein; 2.30A {Homo sapiens} SCOP: d.169.1.1 Length = 128 Back     alignment and structure
>1rtm_1 Mannose-binding protein-A; lectin; 1.80A {Rattus norvegicus} SCOP: d.169.1.1 h.1.1.1 PDB: 1kwu_A* 1kwv_A* 1kwt_A* 1kwx_A* 1kwy_A* 1kx1_A* 1kww_A 1kwz_A* 1kx0_A* 3kmb_1* 1kmb_1* 2kmb_1* 4kmb_1* 1afb_1* 1afa_1* 1afd_1 1bch_1* 1bcj_1* 1fif_A 1fih_A* Length = 149 Back     alignment and structure
>2py2_A Antifreeze protein type II; type II antifreeze protein; 1.70A {Clupea harengus} Length = 136 Back     alignment and structure
>1mpu_A NKG2-D type II integral membrane protein; C-type lectin-like domain, immune system; 2.50A {Homo sapiens} SCOP: d.169.1.1 PDB: 1hyr_B Length = 138 Back     alignment and structure
>1hup_A Mannose-binding protein; alpha-helical coiled-coil, C-type lectin; 2.50A {Homo sapiens} SCOP: d.169.1.1 h.1.1.1 Length = 141 Back     alignment and structure
>2h2t_B Low affinity immunoglobulin epsilon FC receptor ( IGE receptor) (FC-epsilon-RII)...; C-type lectin, calcium-bound, lectin domain; 1.30A {Homo sapiens} PDB: 2h2r_A 1t8c_A 1t8d_A Length = 175 Back     alignment and structure
>3vpp_A C-type lectin domain family 9 member A; dendritic cell, C-type lectin-like domain, membrane, immune; 1.64A {Homo sapiens} Length = 132 Back     alignment and structure
>2c6u_A CLEC1B protein; lectin, rhodocytin, aggretin, C-type lectin-like, platelets, thrombosis; 1.6A {Homo sapiens} Length = 122 Back     alignment and structure
>2bpd_A Dectin-1; receptor, beta-glucan, fungal recognition, C-type lectin-like domain, CTLD, carbohydrate; 1.5A {Mus musculus} PDB: 2bph_A 2bpe_A 2cl8_A* Length = 142 Back     alignment and structure
>1c3a_A Flavocetin-A: alpha subunit; C-type lectin-like domains, membrane protein; 2.50A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1v4l_A Length = 135 Back     alignment and structure
>3bdw_B NKG2-A/NKG2-B type II integral membrane protein; NK cells, receptor, glycoprotein, lectin, signal-A transmembrane, immune system receptor; 2.50A {Homo sapiens} PDB: 3cdg_K 3cii_H Length = 120 Back     alignment and structure
>3ff7_C Killer cell lectin-like receptor subfamily G member 1; KLRG1-cadherin complex, calcium, cell adhesion, cell junction, cell membrane; 1.80A {Homo sapiens} Length = 112 Back     alignment and structure
>1qdd_A Lithostathine; pancreatic stone inhibitor, metal binding protein; HET: SIA NDG GAL; 1.30A {Homo sapiens} SCOP: d.169.1.1 PDB: 1lit_A Length = 144 Back     alignment and structure
>3g8l_A Lectin-related NK cell receptor LY49L1; natural killer cell receptor, immune system; 2.50A {Mus musculus} Length = 190 Back     alignment and structure
>1uv0_A Pancreatitis-associated protein 1; lectin, C-type, secreted, inflammatory response, acute phase; 1.78A {Homo sapiens} SCOP: d.169.1.1 PDB: 2go0_A Length = 149 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query291
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 100.0
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 100.0
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 100.0
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 100.0
2r6a_A454 DNAB helicase, replicative helicase; replication, 100.0
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 100.0
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 99.92
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 99.82
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 99.67
1xp8_A366 RECA protein, recombinase A; recombination, radior 99.59
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 99.58
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 99.58
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 99.56
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 99.55
2cvh_A220 DNA repair and recombination protein RADB; filamen 99.5
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 99.5
2z43_A324 DNA repair and recombination protein RADA; archaea 99.48
1u94_A356 RECA protein, recombinase A; homologous recombinat 99.47
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 99.29
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 99.25
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 99.24
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 99.22
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 99.13
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 99.03
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 98.85
4a74_A231 DNA repair and recombination protein RADA; hydrola 98.5
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 97.99
3io5_A333 Recombination and repair protein; storage dimer, i 97.88
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 97.85
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 97.7
3bs4_A260 Uncharacterized protein PH0321; structural genomic 97.09
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 94.61
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 91.53
1bwv_A493 Rubisco, protein (ribulose bisphosphate carboxylas 89.12
2qv5_A261 AGR_C_5032P, uncharacterized protein ATU2773; stru 87.89
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 87.44
3kdn_A444 Rubisco, ribulose bisphosphate carboxylase; ribulo 86.75
2nly_A245 BH1492 protein, divergent polysaccharide deacetyla 86.15
1wdd_A477 Ribulose bisphosphate carboxylase large chain; rub 85.19
2d69_A430 Ribulose bisphosphate carboxylase; alpha/beta barr 83.35
4f0h_A493 Ribulose bisphosphate carboxylase large chain; alp 82.36
3qfw_A378 Ribulose-1,5-bisphosphate carboxylase/oxygenase L 82.32
3nwr_A432 A rubisco-like protein; lyase; HET: KCX; 1.50A {Bu 80.86
3bdw_A123 Natural killer cells antigen CD94; NK cells, recep 80.82
2yhf_A118 C-type lectin domain family 5 member A; immune sys 80.78
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
Probab=100.00  E-value=1.2e-45  Score=351.36  Aligned_cols=206  Identities=14%  Similarity=0.144  Sum_probs=179.5

Q ss_pred             cHHHHHHHHcCCeEEEEeccCCHHHHHHHHHHHHhcCCCcccc---ccccchhhhhccccccccccCCCCchhHHHHHhh
Q psy4520           2 SEYSLDLALQGVTTLWGSFEVQNKRLARIMLQQLVRKPLLDNL---DKFDEYSDWFKTLPMYFLTFHGPQPLKLVMELVR   78 (291)
Q Consensus         2 ~q~al~la~qG~~v~~fSlEM~~~ql~~Rml~~~a~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~   78 (291)
                      .+++.+++.+|.+|++||+||+.++++.||++..+++++....   .+..+|                            
T Consensus        64 l~ia~~~a~~g~~Vl~fSlEms~~ql~~Rlls~~~~v~~~~l~~g~Ls~~e~----------------------------  115 (338)
T 4a1f_A           64 MNMVLSALNDDRGVAVFSLEMSAEQLALRALSDLTSINMHDLESGRLDDDQW----------------------------  115 (338)
T ss_dssp             HHHHHHHHHTTCEEEEEESSSCHHHHHHHHHHHHHCCCHHHHHHTCCCHHHH----------------------------
T ss_pred             HHHHHHHHHcCCeEEEEeCCCCHHHHHHHHHHHhhCCCHHHHhcCCCCHHHH----------------------------
Confidence            3677777889999999999999999999999999999987542   233445                            


Q ss_pred             ccchhhhhhHHHHHHhhcCCCeEEEcCCCCCCHHHHHHHHHHHHHhC-CCcEEEEeccccccCCCCCCccHHHHHHHHHH
Q psy4520          79 KPLLDNLDKFDEYSDWFKTLPMYFLTFHGPQPLKLVMEAVEHAMYVY-DTGHVIIDNVQFMLGLSDSALDRFYMQDTIIQ  157 (291)
Q Consensus        79 ~~~~~~~~~~~~a~~~~~~~pl~i~d~~g~~~i~~i~~~~r~~~~~~-gv~lviIDyLqlm~~~~~~~~~r~~~~~~i~r  157 (291)
                             +++..|...+.+.|+||+|+++ .++++|++++|++++++ |+++|||||||+|.... ...++++++++|++
T Consensus       116 -------~~l~~a~~~l~~~~l~I~d~~~-~si~~i~~~ir~l~~~~gg~~lIVIDyLqlm~~~~-~~~~r~~ei~~isr  186 (338)
T 4a1f_A          116 -------ENLAKCFDHLSQKKLFFYDKSY-VRIEQIRLQLRKLKSQHKELGIAFIDYLQLMSGSK-ATKERHEQIAEISR  186 (338)
T ss_dssp             -------HHHHHHHHHHHHSCEEEECCTT-CCHHHHHHHHHHHHHHCTTEEEEEEEEEECCCTHH-HHHHCCCCHHHHHH
T ss_pred             -------HHHHHHHHHHhcCCeEEeCCCC-CcHHHHHHHHHHHHHhcCCCCEEEEechHHhcCCC-CCCChHHHHHHHHH
Confidence                   6777888999999999999887 58999999999999999 89999999999987532 12467788999999


Q ss_pred             HHHHHHHhcCceEEEEec-cCCcC----CCCccccccccccccccCccEEEEEccCcc--------------cc------
Q psy4520         158 EFRAFASRSHCHVTLVIH-PRKEN----EQLTVNSVFGSAKATQESDNVLIIQQKFNQ--------------NL------  212 (291)
Q Consensus       158 ~LK~~Ake~~VpVilvsh-pRk~e----k~p~lsDLrgSg~IeQdAD~Vi~L~R~~~~--------------~~------  212 (291)
                      .||.||||+||||++|+| +|.+|    ++|+|+||||||+|||+||+|+||||+++.              +.      
T Consensus       187 ~LK~lAkel~vpVi~lsQl~R~~e~r~dkrP~lsDLreSg~IeqdAD~Vl~l~R~~~y~~~~~~~~~~~~~~~~~~~~~~  266 (338)
T 4a1f_A          187 ELKTLARELEIPIIALVQLNRSLENRDDKRPILSDIKDSGGIEQDADIVLFLYRGYIYQMRAEDNKIDKLKKEGKIEEAQ  266 (338)
T ss_dssp             HHHHHHHHHTSCEEEEEECCGGGGGSSSCSCCGGGSEETTEECCCCSEEEEEECHHHHHHHHHHHHHHHHHGGGCHHHHH
T ss_pred             HHHHHHHHcCCeEEEEEecCccccccccCCCChHhcccchhhhhhCcEEEEEecchhccccccccccccccccccccccc
Confidence            999999999999999999 78776    799999999999999999999999999742              11      


Q ss_pred             ------------------ccceEEEEecccCCCCccCCCCCC-ceeeeceEeEEeeC
Q psy4520         213 ------------------ELKKFLQALPIERCPQFRDQPPGS-TATYNGKCYIFYNR  250 (291)
Q Consensus       213 ------------------~~~~~l~I~KnR~~~~~R~g~~G~-~l~f~g~~~~f~~~  250 (291)
                                        .+.++|+|+|||      |||+|+ .+.|++++++|.|.
T Consensus       267 ~~~~~~~~~~~~~~~~~~~~~~eiiiaK~R------~G~~g~v~l~f~~~~~~F~~~  317 (338)
T 4a1f_A          267 ELYLKVNEERRIHKQNGSIEEAEIIVAKNR------NGATGTVYTRFNAPFTRYEDM  317 (338)
T ss_dssp             HHHHHHHHHHHHHHHTTSEEEEEEEEEEET------TSCCEEEEEEEEGGGTEECCC
T ss_pred             chhhhhhhhhcccccccCCCceEEEEEecc------CCCCceEEEEEccccceeccc
Confidence                              345789999985      999999 99999999999987
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1bwv_A Rubisco, protein (ribulose bisphosphate carboxylase); carbon dioxide fixation, complex (rubisco-reaction intermedi high specificity factor; HET: KCX CAP; 2.40A {Galdieria partita} SCOP: c.1.14.1 d.58.9.1 PDB: 1iwa_A 1bxn_A Back     alignment and structure
>2qv5_A AGR_C_5032P, uncharacterized protein ATU2773; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3kdn_A Rubisco, ribulose bisphosphate carboxylase; ribulose-1,5-bisphosphate carboxylase/oxygenase, Ca dioxide fixation, lyase, magnesium; HET: KCX CAP; 2.09A {Thermococcus kodakaraensis} PDB: 3a13_A* 3kdo_A* 3a12_A* 1geh_A* Back     alignment and structure
>2nly_A BH1492 protein, divergent polysaccharide deacetylase hypothetical; PFAM04748, structural PSI, protein structure initiative; 2.50A {Bacillus halodurans} SCOP: c.6.2.7 Back     alignment and structure
>1wdd_A Ribulose bisphosphate carboxylase large chain; rubisco, photosynthesis, alpha/beta barrel, N-methylmethioni translational modification, lyase; HET: KCX CAP; 1.35A {Oryza sativa} SCOP: c.1.14.1 d.58.9.1 PDB: 3axk_A* 3axm_A* 1rlc_L* 4rub_A* 3rub_L 1ej7_L 1aa1_L* 1aus_L 1rbo_L* 1rco_L* 1rcx_L* 1rxo_L* 1gk8_A* 1ir2_A* 1uzd_A* 1uzh_A* 2v69_A* 1uwa_A* 2v63_A* 2v67_A* ... Back     alignment and structure
>2d69_A Ribulose bisphosphate carboxylase; alpha/beta barrel, structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.90A {Pyrococcus horikoshii} SCOP: c.1.14.1 d.58.9.1 PDB: 2cxe_A 2cwx_A Back     alignment and structure
>4f0h_A Ribulose bisphosphate carboxylase large chain; alpha beta domain, catalytic domain TIM barrel, carboxylase/oxygenase, nitrosylation; 1.96A {Galdieria sulphuraria} PDB: 4f0k_A 4f0m_A 1bwv_A* 1iwa_A 1bxn_A Back     alignment and structure
>3qfw_A Ribulose-1,5-bisphosphate carboxylase/oxygenase L subunit; structural genomics, PSI-2, protein structure initiative; 1.79A {Rhodopseudomonas palustris} Back     alignment and structure
>3nwr_A A rubisco-like protein; lyase; HET: KCX; 1.50A {Burkholderia fungorum} Back     alignment and structure
>3bdw_A Natural killer cells antigen CD94; NK cells, receptor, glycoprotein, lectin, signal-A transmembrane, immune system receptor; 2.50A {Homo sapiens} SCOP: d.169.1.1 PDB: 3cdg_J 1b6e_A 3cii_G Back     alignment and structure
>2yhf_A C-type lectin domain family 5 member A; immune system; 1.90A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 291
d1wk1a_150 d.169.1.1 (A:) Hypothetical protein F28B4.3 {Caeno 3e-04
d1xpha1130 d.169.1.1 (A:265-394) DC-SIGNR (DC-SIGN related re 3e-04
d1egga_136 d.169.1.1 (A:) Macrophage mannose receptor, CRD4 { 3e-04
d1e87a_117 d.169.1.1 (A:) CD69 {Human (Homo sapiens) [TaxId: 5e-04
d1tdqb_126 d.169.1.1 (B:) Aggrecan core protein {Rat (Rattus 8e-04
d1kg0c_136 d.169.1.1 (C:) EBV gp42 {Epstein-Barr virus [TaxId 8e-04
d1hupa1117 d.169.1.1 (A:112-228) Mannose-binding protein A, C 0.002
d1ypqa1131 d.169.1.1 (A:140-270) Oxidised low density lipopro 0.002
d1rdl1_111 d.169.1.1 (1:) Mannose-binding protein A, C-lectin 0.002
d1qo3c_133 d.169.1.1 (C:) NK cell receptor {Mouse (Mus muscul 0.002
>d1wk1a_ d.169.1.1 (A:) Hypothetical protein F28B4.3 {Caenorhabditis elegans [TaxId: 6239]} Length = 150 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: C-type lectin-like
superfamily: C-type lectin-like
family: C-type lectin domain
domain: Hypothetical protein F28B4.3
species: Caenorhabditis elegans [TaxId: 6239]

 Score = 38.5 bits (88), Expect = 3e-04
 Identities = 13/49 (26%), Positives = 20/49 (40%), Gaps = 1/49 (2%)

Query: 235 GSTATYNGKCYIFYNRRPMNLRDSLAFCRSRGGSLVDESNPALQGFISW 283
           GS+ +   K     N   +++  +  FC S GG L D+       F S 
Sbjct: 1   GSSGSSGVKFLTV-NDDILSMPQARNFCASAGGYLADDLGDDKNNFYSS 48
>d1xpha1 d.169.1.1 (A:265-394) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1egga_ d.169.1.1 (A:) Macrophage mannose receptor, CRD4 {Human (Homo sapiens) [TaxId: 9606]} Length = 136 Back     information, alignment and structure
>d1e87a_ d.169.1.1 (A:) CD69 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1tdqb_ d.169.1.1 (B:) Aggrecan core protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 126 Back     information, alignment and structure
>d1kg0c_ d.169.1.1 (C:) EBV gp42 {Epstein-Barr virus [TaxId: 10376]} Length = 136 Back     information, alignment and structure
>d1hupa1 d.169.1.1 (A:112-228) Mannose-binding protein A, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ypqa1 d.169.1.1 (A:140-270) Oxidised low density lipoprotein {Human (Homo sapiens) [TaxId: 9606]} Length = 131 Back     information, alignment and structure
>d1rdl1_ d.169.1.1 (1:) Mannose-binding protein A, C-lectin domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 111 Back     information, alignment and structure
>d1qo3c_ d.169.1.1 (C:) NK cell receptor {Mouse (Mus musculus), ly49-a [TaxId: 10090]} Length = 133 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query291
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 100.0
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 99.7
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 99.39
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 99.23
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 98.53
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 98.5
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 98.24
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 98.18
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 98.08
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 97.95
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 97.53
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 97.35
d1geha1307 Ribulose 1,5-bisphosphate carboxylase-oxygenase {A 90.13
d1tdqb_126 Aggrecan core protein {Rat (Rattus norvegicus) [Ta 89.0
d2d69a1291 Ribulose 1,5-bisphosphate carboxylase-oxygenase {A 87.95
d3bdwa1121 CD94 {Human (Homo sapiens) [TaxId: 9606]} 85.69
d1wdda1325 Ribulose 1,5-bisphosphate carboxylase-oxygenase {R 85.45
d1t8da1143 Low affinity immunoglobulin epsilon Fc receptor {H 85.29
d1jwia_124 Snake coagglutinin alpha chain {Puff adder (Bitis 83.63
d1dv8a_128 H1 subunit of the asialoglycoprotein receptor {Hum 83.29
d1xpha1130 DC-SIGNR (DC-SIGN related receptor) {Human (Homo s 82.14
d1e87a_117 CD69 {Human (Homo sapiens) [TaxId: 9606]} 80.75
d2afpa_129 Type II antifreeze protein {Sea raven (Hemitripter 80.22
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Gene 4 protein (g4p, DNA primase), helicase domain
species: Bacteriophage T7 [TaxId: 10760]

Probab=100.00  E-value=7.1e-33  Score=247.78  Aligned_cols=212  Identities=15%  Similarity=0.192  Sum_probs=146.8

Q ss_pred             cHHHHHHH-HcCCeEEEEeccCCHHHHHHHHHHHHhcCCCccccccccchhhhhccccccccccCCCCchhHHHHHhhcc
Q psy4520           2 SEYSLDLA-LQGVTTLWGSFEVQNKRLARIMLQQLVRKPLLDNLDKFDEYSDWFKTLPMYFLTFHGPQPLKLVMELVRKP   80 (291)
Q Consensus         2 ~q~al~la-~qG~~v~~fSlEM~~~ql~~Rml~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~   80 (291)
                      .|+++++| .+|++|++||+||++++++.|+++..+++++........+.                       .      
T Consensus        53 ~~la~~~a~~~g~~v~~~s~E~~~~~~~~r~~~~~~~~~~~~~~~~~~~~-----------------------~------  103 (277)
T d1cr2a_          53 RQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREI-----------------------I------  103 (277)
T ss_dssp             HHHHHHHHHTSCCCEEEEESSSCHHHHHHHHHHHHTTCCGGGCHHHHHHH-----------------------H------
T ss_pred             HHHHHhhhhhcccceeEeeeccchhhHHhHHHHHhhcCCchhhcccccch-----------------------h------
Confidence            57888877 57999999999999999999999999999886532100000                       0      


Q ss_pred             chhhhhhHHHHHHhh-cCCCeEEEcCCCCCCHHHHHHHHHHHHHhCCCcEEEEeccccccCCCCCCccHHHHHHHHHHHH
Q psy4520          81 LLDNLDKFDEYSDWF-KTLPMYFLTFHGPQPLKLVMEAVEHAMYVYDTGHVIIDNVQFMLGLSDSALDRFYMQDTIIQEF  159 (291)
Q Consensus        81 ~~~~~~~~~~a~~~~-~~~pl~i~d~~g~~~i~~i~~~~r~~~~~~gv~lviIDyLqlm~~~~~~~~~r~~~~~~i~r~L  159 (291)
                         +.+++.++.+.+ ...++++++.....+.+++...+++++..+++++|||||||+|..... ..+.+.++.++++.|
T Consensus       104 ---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vvID~l~~l~~~~~-~~~~~~~~~~~~~~l  179 (277)
T d1cr2a_         104 ---ENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSASG-ESDERKMIDNLMTKL  179 (277)
T ss_dssp             ---HTSHHHHHHHHHHSSSCEEEECCC-CCCHHHHHHHHHHHHHTTCCSEEEEEEEEC-----------CHHHHHHHHHH
T ss_pred             ---hhHHHHHHHHHhhccceeeeeccccchhHHHHHHHhhhhhhccCcceEEEccccccccccc-ccchhHHHHHHHHHH
Confidence               002333333333 345788888877789999999999999999999999999998865432 234557889999999


Q ss_pred             HHHHHhcCceEEEEeccCCcC--------CCCccccccccccccccCccEEEEEccCccccccceEEEEecccCCCCccC
Q psy4520         160 RAFASRSHCHVTLVIHPRKEN--------EQLTVNSVFGSAKATQESDNVLIIQQKFNQNLELKKFLQALPIERCPQFRD  231 (291)
Q Consensus       160 K~~Ake~~VpVilvshpRk~e--------k~p~lsDLrgSg~IeQdAD~Vi~L~R~~~~~~~~~~~l~I~KnR~~~~~R~  231 (291)
                      |.||+++||||++++|+++..        ++|+++|++||++|+|.||+|+.|+|+...+..+...|+|+|||     ++
T Consensus       180 ~~lA~~~~i~vi~~~q~~r~~~~~~~~~~~~~~~~~~~gS~~i~~~ad~vl~l~r~~~~~~~~~~~l~v~KnR-----~~  254 (277)
T d1cr2a_         180 KGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALERNQQGDMPNLVLVRILKCR-----FT  254 (277)
T ss_dssp             HHHHHHHCCEEEEEEECC---------------------CHHHHHHCSEEEEEECC------CEEEEEEEEET-----TT
T ss_pred             HHHhhhccccceeecccccccccccccccccchhhhcccccchhhhCcEEEEEEecCccCCCCeEEEEEEccC-----CC
Confidence            999999999999999955442        46899999999999999999999999887666677889999998     36


Q ss_pred             CCCCCceeeeceEeEEeeCCCCchhh
Q psy4520         232 QPPGSTATYNGKCYIFYNRRPMNLRD  257 (291)
Q Consensus       232 g~~G~~l~f~g~~~~f~~~~~~~~~~  257 (291)
                      |++|.      .+.+.||+.|++|..
T Consensus       255 G~~G~------~~~l~~d~~tgr~~~  274 (277)
T d1cr2a_         255 GDTGI------AGYMEYNKETGWLEP  274 (277)
T ss_dssp             CCCEE------EEEEEECTTTCCEEE
T ss_pred             CCCCC------EEEEEEeCCCCeEcC
Confidence            77763      245678888888763
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1geha1 c.1.14.1 (A:137-443) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Thermococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d1tdqb_ d.169.1.1 (B:) Aggrecan core protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2d69a1 c.1.14.1 (A:134-424) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3bdwa1 d.169.1.1 (A:59-179) CD94 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdda1 c.1.14.1 (A:151-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1t8da1 d.169.1.1 (A:1-143) Low affinity immunoglobulin epsilon Fc receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jwia_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Puff adder (Bitis arietans), bitiscetin [TaxId: 8692]} Back     information, alignment and structure
>d1dv8a_ d.169.1.1 (A:) H1 subunit of the asialoglycoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpha1 d.169.1.1 (A:265-394) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e87a_ d.169.1.1 (A:) CD69 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2afpa_ d.169.1.1 (A:) Type II antifreeze protein {Sea raven (Hemitripterus americanus) [TaxId: 8094]} Back     information, alignment and structure