Psyllid ID: psy4525

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------39
MMKRVYSTISQLKPNVCIVGSGPAGFYCAQQILKLLPQSTVDIYEKLPVPFGLVRYGVAPDHPEVKNVINTFTKTGDNPRVNFYGNICLGQDISLGDLTNAYHAVVLTYGADNDKKLNIPGEDGKNIISARSFVGWYNGLPEDASLDLSLDCEEATILGQGNVAMDVARILLSPVDQLKSTDITEHSLEKLSTSRIKSVNLVGRRGALQVAFTIKEFREMTKLPHVQTVFRNEQLCGVHEASATLARPRKRLTELILKTSNPDESKSNCSKYFRPIFLRSPTEFKLNDNGAITGINFANQQALVTEDTELIPSGIAFRSIGYQSRCVDSDIPFNEKSCTVIPKEGVPVVTWEGWKAIDKEETERGKLKGKPREKIISIEEMISVSGNS
ccccccccccccccEEEEEcccHHHHHHHHHHHHHccccEEEEEcccccccEEEEcccccccHHHHHHHHHHHHHcccccEEEEccEEEcccccHHHHHHcccEEEEccccccccccccccccccccEEHHHHHHHHHccccccccccccccccEEEEcccHHHHHHHHHHcccccccccccccHHHHHHHHcccccEEEEEEcccHHHccccHHHHHHHHcccccEEEEccccccccHHHHHHcccHHHHHHHHHHHHcccccccccccEEEEEEEEccccEEEccccccEEEEEEEEcEEEccccEEEEcccEEEEcccccccccccccccccccccccccccccEEEccccccccccEEEccccccccccccccHHHHHHHHccc
ccccccccccccccEEEEEcccHHHHHHHHHHHHHccccEEEEEccccccccHHHHccccccccHHHHHHHHHHHHccccEEEEEcccEcccEcHHHHHHHccEEEEcccccEEccccccccccccEEEHHHHHHHHHccHHHccccccccccEEEEEcccHHHHHHHHHHHccHHHHccccccHHHHHHHHHccccEEEEEccccHHHccccHHHHHHHHccccEEEEccHHHHccHHHHcccccHHHHHHHHHHHHHHHHcccccccccEEEEEEEcccEEEEcccccEEEEEEEEEEEEEccccEEEcccEEEEEEEcccccccccccccccccccEcccccccEEEEEEEEEcccHHHHcccccccccccHHHHHHHHHHcccc
MMKRVYSTIsqlkpnvcivgsgpagfYCAQQILKLlpqstvdiyeklpvpfglvrygvapdhpevkNVINTftktgdnprvnfygniclgqdislgdltnAYHAVVLTYgadndkklnipgedgkniiSARSFvgwynglpedasldlsldceeatilgqgNVAMDVARILlspvdqlkstditehSLEKLSTSRIKSVNLVGRRGALQVAFTIKEFREmtklphvqtvfrneqlcgvheasatlaRPRKRLTELILktsnpdesksncskyfrpiflrsptefklndngaitginfanqqalvtedtelipsgiafrsigyqsrcvdsdipfneksctvipkegvpvvtwegwkaidkeetergklkgkprekIISIEEMISVSGNS
MMKRVYSTISQLKPNVCIVGSGPAGFYCAQQILKLLPQSTVDIYEKLPVPFGLVRYGVAPDHPEVKNVINtftktgdnprVNFYGNICLGQDISLGDLTNAYHAVVLTYgadndkklnipgedgKNIISARSFVGWYNGLPEDASLDLSLDCEEATILGQGNVAMDVARILLSpvdqlkstditehsleklstsriksvnlvgrrGALQVAFTIKEFREMTKLPHVQTVFRNEQLCGVHEasatlarprkRLTELIlktsnpdesksncsKYFRPIFLRSPTEFKLNDNGAITGINFANQQALVTEDTELIPSGIAFRSIGYQSRCVDSDIpfneksctvipkegvpvvtwegwkaidkeetergklkgkprekiisieemisvsgns
MMKRVYSTISQLKPNVCIVGSGPAGFYCAQQILKLLPQSTVDIYEKLPVPFGLVRYGVAPDHPEVKNVINTFTKTGDNPRVNFYGNICLGQDISLGDLTNAYHAVVLTYGADNDKKLNIPGEDGKNIISARSFVGWYNGLPEDASLDLSLDCEEATILGQGNVAMDVARILLSPVDQLKSTDITEHSLEKLSTSRIKSVNLVGRRGALQVAFTIKEFREMTKLPHVQTVFRNEQLCGVHEASATLARPRKRLTELILKTSNPDESKSNCSKYFRPIFLRSPTEFKLNDNGAITGINFANQQALVTEDTELIPSGIAFRSIGYQSRCVDSDIPFNEKSCTVIPKEGVPVVTWEGWKAIDKEETERGKLKGKPREKIISIEEMISVSGNS
*****YSTISQLKPNVCIVGSGPAGFYCAQQILKLLPQSTVDIYEKLPVPFGLVRYGVAPDHPEVKNVINTFTKTGDNPRVNFYGNICLGQDISLGDLTNAYHAVVLTYGADNDKKLNIPGEDGKNIISARSFVGWYNGLPEDASLDLSLDCEEATILGQGNVAMDVARILLSPVDQLKSTDITE**L*KLSTSRIKSVNLVGRRGALQVAFTIKEFREMTKLPHVQTVFRNEQLCGVHEASATLA*****LTELI************CSKYFRPIFLRSPTEFKLNDNGAITGINFANQQALVTEDTELIPSGIAFRSIGYQSRCVDSDIPFNEKSCTVIPKEGVPVVTWEGWKAI*******************************
***************VCIVGSGPAGFYCAQQILKLLPQSTVDIYEKLPVPFGLVRYGVAPDHPEVKNVINTFTKTGDNPRVNFYGNICLGQDISLGDLTNAYHAVVLTYGADNDKKLNIPGEDGKNIISARSFVGWYNGLPEDASLDLSLDCEEATILGQGNVAMDVARILLSPVDQLKSTDITEHSLEKLSTSRIKSVNLVGRRGALQVAFTIKEFREMTKLPHVQTVFRNEQLCGVHEASATLARPRKRLTEL*****************FRPIFLRSPTEFKLNDNGAITGINFANQQALVTEDTELIPSGIAFRSIGYQSRCVDSDIPFNEKSCTVIPKEGVPVVTWEGWKAIDKEETERGKLKGKPREKIISIEEMISVSG**
MMKRVYSTISQLKPNVCIVGSGPAGFYCAQQILKLLPQSTVDIYEKLPVPFGLVRYGVAPDHPEVKNVINTFTKTGDNPRVNFYGNICLGQDISLGDLTNAYHAVVLTYGADNDKKLNIPGEDGKNIISARSFVGWYNGLPEDASLDLSLDCEEATILGQGNVAMDVARILLSPVDQLKSTDITEHSLEKLSTSRIKSVNLVGRRGALQVAFTIKEFREMTKLPHVQTVFRNEQLCGVHEASATLARPRKRLTELILKT********NCSKYFRPIFLRSPTEFKLNDNGAITGINFANQQALVTEDTELIPSGIAFRSIGYQSRCVDSDIPFNEKSCTVIPKEGVPVVTWEGWKAIDKEE*********PREKIISIEEMISVSGNS
***********LKPNVCIVGSGPAGFYCAQQILKLLPQSTVDIYEKLPVPFGLVRYGVAPDHPEVKNVINTFTKTGDNPRVNFYGNICLGQDISLGDLTNAYHAVVLTYGADNDKKLNIPGEDGKNIISARSFVGWYNGLPEDASLDLSLDCEEATILGQGNVAMDVARILLSPVDQLKSTDITEHSLEKLSTSRIKSVNLVGRRGALQVAFTIKEFREMTKLPHVQTVFRNEQLCGVHEASATLARPRKRLTELILKTSNPDESKSNCSKYFRPIFLRSPTEFKLNDNGAITGINFANQQALVTEDTELIPSGIAFRSIGYQSRCVDSDIPFNEKSCTVIPKEGVPVVTWEGWKAIDKEETERGKLKGKPREKIISIEEMISV****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMKRVYSTISQLKPNVCIVGSGPAGFYCAQQILKLLPQSTVDIYEKLPVPFGLVRYGVAPDHPEVKNVINTFTKTGDNPRVNFYGNICLGQDISLGDLTNAYHAVVLTYGADNDKKLNIPGEDGKNIISARSFVGWYNGLPEDASLDLSLDCEEATILGQGNVAMDVARILLSPVDQLKSTDITEHSLEKLSTSRIKSVNLVGRRGALQVAFTIKEFREMTKLPHVQTVFRNEQLCGVHEASATLARPRKRLTELILKTSNPDESKSNCSKYFRPIFLRSPTEFKLNDNGAITGINFANQQALVTEDTELIPSGIAFRSIGYQSRCVDSDIPFNEKSCTVIPKEGVPVVTWEGWKAIDKEETERGKLKGKPREKIISIEEMISVSGNS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query388 2.2.26 [Sep-21-2011]
Q9V3T9466 NADPH:adrenodoxin oxidore yes N/A 0.953 0.793 0.475 1e-100
P22570491 NADPH:adrenodoxin oxidore yes N/A 0.876 0.692 0.498 6e-92
P08165492 NADPH:adrenodoxin oxidore yes N/A 0.896 0.707 0.490 3e-91
P56522494 NADPH:adrenodoxin oxidore yes N/A 0.878 0.690 0.481 3e-90
P82861498 NADPH:adrenodoxin oxidore N/A N/A 0.840 0.654 0.501 3e-90
Q61578494 NADPH:adrenodoxin oxidore yes N/A 0.961 0.755 0.434 2e-85
O59710469 Probable NADPH:adrenodoxi yes N/A 0.902 0.746 0.402 3e-64
Q54KG7515 Probable NADPH:adrenodoxi yes N/A 0.853 0.642 0.386 6e-58
O32886456 NADPH-ferredoxin reductas yes N/A 0.814 0.692 0.389 7e-58
O05783456 NADPH-ferredoxin reductas yes N/A 0.827 0.703 0.379 2e-57
>sp|Q9V3T9|ADRO_DROME NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Drosophila melanogaster GN=dare PE=2 SV=1 Back     alignment and function desciption
 Score =  366 bits (939), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 207/435 (47%), Positives = 267/435 (61%), Gaps = 65/435 (14%)

Query: 16  VCIVGSGPAGFYCAQQILKLLPQSTVDIYEKLPVPFGLVRYGVAPDHPEVKNVINTFTKT 75
           +CIVG+GPAGFY AQ ILK L    VD+ EKLPVPFGLVR+GVAPDHPEVKNVINTFTKT
Sbjct: 32  ICIVGAGPAGFYAAQLILKQLDNCVVDVVEKLPVPFGLVRFGVAPDHPEVKNVINTFTKT 91

Query: 76  GDNPRVNFYGNICLGQDISLGDLTNAYHAVVLTYGADNDKKLNIPGEDGKNIISARSFVG 135
            ++PR+ ++GNI LG D+SL +L + YHAV+LTYGAD D++L +  E   N+ISAR FV 
Sbjct: 92  AEHPRLRYFGNISLGTDVSLRELRDRYHAVLLTYGADQDRQLELENEQLDNVISARKFVA 151

Query: 136 WYNGLPEDASLDLSLDCEEATILGQGNVAMDVARILLSPVDQLKSTDITEHSLEKLSTSR 195
           WYNGLP   +L   L   + TI+GQGNVA+DVAR+LLSP+D LK+TD TE++LE LS S+
Sbjct: 152 WYNGLPGAENLAPDLSGRDVTIVGQGNVAVDVARMLLSPLDALKTTDTTEYALEALSCSQ 211

Query: 196 IKSVNLVGRRGALQVAFTIKEFREMTKLPHVQTVFRNEQLCGVHEASATLARPRKRLTEL 255
           ++ V+LVGRRG LQ AFTIKE REM KLP+V T +R E   G+      L RPRKRLTEL
Sbjct: 212 VERVHLVGRRGPLQAAFTIKELREMLKLPNVDTRWRTEDFSGIDMQLDKLQRPRKRLTEL 271

Query: 256 ILKTSNPDESKSNCSKYFRPIFLRSP-------TEF---KLNDNGAI------------- 292
           +LK S  ++ + + SK F PIFLR+P        EF   +L    A+             
Sbjct: 272 MLK-SLKEQGRISGSKQFLPIFLRAPKAIAPGEMEFSVTELQQEAAVPTSSTERLPSHLI 330

Query: 293 ------------TGINFANQQALVTEDTELI----------------------PSGIAFR 318
                       TGINF  ++  V      I                      P+G+   
Sbjct: 331 LRSIGYKSSCVDTGINFDTRRGRVHNINGRILKDDATGEVDPGLYVAGWLGTGPTGVIVT 390

Query: 319 SIGYQ---SRCVDSDIPFNE-KSCTVIP---KEGVPVVTWEGWKAIDKEETERGKLKGKP 371
           ++      ++ +  DI  N   + +V P    +G  VVTW+GW+ I+  E+  GK KGKP
Sbjct: 391 TMNGAFAVAKTICDDINTNALDTSSVKPGYDADGKRVVTWDGWQRINDFESAAGKAKGKP 450

Query: 372 REKIISIEEMISVSG 386
           REKI+SIEEM+ V+G
Sbjct: 451 REKIVSIEEMLRVAG 465
Required for synthesis of steroid hormones, for olfactory sensory behavior and completion of the second larval molt (a steroid mediated developmental transition) and pupariation.
Drosophila melanogaster (taxid: 7227)
EC: 1EC: .EC: 1EC: 8EC: .EC: 1EC: .EC: 2
>sp|P22570|ADRO_HUMAN NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Homo sapiens GN=FDXR PE=1 SV=3 Back     alignment and function description
>sp|P08165|ADRO_BOVIN NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Bos taurus GN=FDXR PE=1 SV=3 Back     alignment and function description
>sp|P56522|ADRO_RAT NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Rattus norvegicus GN=Fdxr PE=1 SV=1 Back     alignment and function description
>sp|P82861|ADRO_SALFO NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Salvelinus fontinalis GN=fdxr PE=2 SV=1 Back     alignment and function description
>sp|Q61578|ADRO_MOUSE NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Mus musculus GN=Fdxr PE=2 SV=1 Back     alignment and function description
>sp|O59710|ADRO_SCHPO Probable NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arh1 PE=3 SV=1 Back     alignment and function description
>sp|Q54KG7|ADRO_DICDI Probable NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Dictyostelium discoideum GN=fdxr PE=3 SV=1 Back     alignment and function description
>sp|O32886|FPRA_MYCLE NADPH-ferredoxin reductase FprA OS=Mycobacterium leprae (strain TN) GN=fprA PE=3 SV=1 Back     alignment and function description
>sp|O05783|FPRA_MYCTU NADPH-ferredoxin reductase FprA OS=Mycobacterium tuberculosis GN=fprA PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query388
345486032461 PREDICTED: LOW QUALITY PROTEIN: NADPH:ad 0.958 0.806 0.492 1e-108
383860656461 PREDICTED: NADPH:adrenodoxin oxidoreduct 0.873 0.735 0.571 1e-106
380013956458 PREDICTED: NADPH:adrenodoxin oxidoreduct 0.971 0.823 0.458 1e-102
307212766464 NADPH:adrenodoxin oxidoreductase, mitoch 0.865 0.724 0.543 1e-102
195119752479 GI19640 [Drosophila mojavensis] gi|19390 0.961 0.778 0.466 1e-101
195476052466 GE13030 [Drosophila yakuba] gi|194176397 0.951 0.791 0.481 1e-101
193577815451 PREDICTED: NADPH:adrenodoxin oxidoreduct 0.945 0.813 0.473 1e-101
307187912 1106 NADPH:adrenodoxin oxidoreductase, mitoch 0.835 0.292 0.563 1e-101
195402535481 GJ15006 [Drosophila virilis] gi|19414072 0.953 0.769 0.461 1e-100
242018843474 NADPH:adrenodoxin oxidoreductase, putati 0.904 0.740 0.539 1e-100
>gi|345486032|ref|XP_003425390.1| PREDICTED: LOW QUALITY PROTEIN: NADPH:adrenodoxin oxidoreductase, mitochondrial-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  399 bits (1026), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 216/439 (49%), Positives = 284/439 (64%), Gaps = 67/439 (15%)

Query: 14  PNVCIVGSGPAGFYCAQQILKLLPQSTVDIYEKLPVPFGLVRYGVAPDHPEVKNVINTFT 73
           PN+CIVG+GPAGFY AQQILK L    VDI E+LPVP+GLVR+GVAPDHPEVKNVINTF 
Sbjct: 21  PNICIVGAGPAGFYAAQQILKGLNNVKVDILERLPVPYGLVRFGVAPDHPEVKNVINTFD 80

Query: 74  KTGDNPRVNFYGNICLGQDISLGDLTNAYHAVVLTYGADNDKKLNIPGEDGKNIISARSF 133
           K   + RV F GN+ +GQDIS+ +L   YHAV+LTYGAD+DK LNIPGE+ KN++SARSF
Sbjct: 81  KIAKDARVQFLGNVNVGQDISVAELKEHYHAVLLTYGADDDKVLNIPGENLKNVVSARSF 140

Query: 134 VGWYNGLPEDASLDLSLDCEEATILGQGNVAMDVARILLSPVDQLKSTDITEHSLEKLST 193
           VGWYNGLP + +L+++L+ E+  ILGQGNVA+D+ARILLSP+D+LK+TDIT HSLE+LS 
Sbjct: 141 VGWYNGLPNNKNLNINLNTEDVVILGQGNVAIDIARILLSPIDKLKNTDITSHSLEQLSQ 200

Query: 194 SRIKSVNLVGRRGALQVAFTIKEFREMTKLPHVQTVFRNEQLCGVHEASATLARPRKRLT 253
           S+++ V LVGRRG LQ AFTI E RE+ KL + +T +R +   G+ E    L RPRKRLT
Sbjct: 201 SKVQRVWLVGRRGPLQAAFTIAELRELLKLDNCKTYWRPKDFEGIKEIVPQLVRPRKRLT 260

Query: 254 ELILKTSNPDESKSN-CSKYFRPIFLRSPTEFKLNDN--------GAITGINFANQQALV 304
           EL+LK+ +  ++++   +K F PIFLR+P +F  +D+          + G +F  Q A  
Sbjct: 261 ELMLKSIDDAQTETKKHNKEFHPIFLRAPVQFVGSDSIEKVKLSVTQLHGEDFLKQTAKS 320

Query: 305 TEDTELIPSGIAFRSIGYQSRCVDSDIPFNEKSCTVI----------------------- 341
           T++ E IP G+ FRSIGY+SR +D  +PF+  S  V+                       
Sbjct: 321 TDEFEEIPCGLTFRSIGYKSRPIDPSVPFDTNSGRVLNSDGKIGNGLYAAGWVATGPVGV 380

Query: 342 -----------------------PKEG------------VPVVTWEGWKAIDKEETERGK 366
                                  PK G            V V++++GW+ IDKEE +RG 
Sbjct: 381 ILSTMNNAYRVGSIINKEIDFTAPKAGCEEVKRILEHRNVSVISYQGWEKIDKEERQRGD 440

Query: 367 LKGKPREKIISIEEMISVS 385
             GKPREKI+ I EMI ++
Sbjct: 441 KLGKPREKIVDISEMIDIA 459

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383860656|ref|XP_003705805.1| PREDICTED: NADPH:adrenodoxin oxidoreductase, mitochondrial-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380013956|ref|XP_003691010.1| PREDICTED: NADPH:adrenodoxin oxidoreductase, mitochondrial-like [Apis florea] Back     alignment and taxonomy information
>gi|307212766|gb|EFN88437.1| NADPH:adrenodoxin oxidoreductase, mitochondrial [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|195119752|ref|XP_002004393.1| GI19640 [Drosophila mojavensis] gi|193909461|gb|EDW08328.1| GI19640 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195476052|ref|XP_002090296.1| GE13030 [Drosophila yakuba] gi|194176397|gb|EDW90008.1| GE13030 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|193577815|ref|XP_001948763.1| PREDICTED: NADPH:adrenodoxin oxidoreductase, mitochondrial-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307187912|gb|EFN72825.1| NADPH:adrenodoxin oxidoreductase, mitochondrial [Camponotus floridanus] Back     alignment and taxonomy information
>gi|195402535|ref|XP_002059860.1| GJ15006 [Drosophila virilis] gi|194140726|gb|EDW57197.1| GJ15006 [Drosophila virilis] Back     alignment and taxonomy information
>gi|242018843|ref|XP_002429880.1| NADPH:adrenodoxin oxidoreductase, putative [Pediculus humanus corporis] gi|212514914|gb|EEB17142.1| NADPH:adrenodoxin oxidoreductase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query388
FB|FBgn0015582466 dare "defective in the avoidan 0.819 0.682 0.562 7.4e-103
UNIPROTKB|E7EQC1522 FDXR "NADPH:adrenodoxin oxidor 0.863 0.641 0.508 1e-92
UNIPROTKB|P22570491 FDXR "NADPH:adrenodoxin oxidor 0.868 0.686 0.507 1.3e-92
UNIPROTKB|E2RDC3492 FDXR "NADPH:adrenodoxin oxidor 0.878 0.693 0.494 7e-92
UNIPROTKB|P08165492 FDXR "NADPH:adrenodoxin oxidor 0.873 0.689 0.5 1.9e-91
UNIPROTKB|F1NRB1466 FDXR "NADPH:adrenodoxin oxidor 0.845 0.703 0.510 1.9e-91
RGD|621648494 Fdxr "ferredoxin reductase" [R 0.871 0.684 0.498 4.9e-91
UNIPROTKB|P56522494 Fdxr "NADPH:adrenodoxin oxidor 0.871 0.684 0.498 4.9e-91
MGI|MGI:104724494 Fdxr "ferredoxin reductase" [M 0.871 0.684 0.495 1.7e-90
UNIPROTKB|F1RV70492 FDXR "NADPH:adrenodoxin oxidor 0.899 0.709 0.485 5.6e-90
FB|FBgn0015582 dare "defective in the avoidance of repellents" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 897 (320.8 bits), Expect = 7.4e-103, Sum P(2) = 7.4e-103
 Identities = 181/322 (56%), Positives = 232/322 (72%)

Query:    16 VCIVGSGPAGFYCAQQILKLLPQSTVDIYEKLPVPFGLVRYGVAPDHPEVKNVINTFTKT 75
             +CIVG+GPAGFY AQ ILK L    VD+ EKLPVPFGLVR+GVAPDHPEVKNVINTFTKT
Sbjct:    32 ICIVGAGPAGFYAAQLILKQLDNCVVDVVEKLPVPFGLVRFGVAPDHPEVKNVINTFTKT 91

Query:    76 GDNPRVNFYGNICLGQDISLGDLTNAYHAVVLTYGADNDKKLNIPGEDGKNIISARSFVG 135
              ++PR+ ++GNI LG D+SL +L + YHAV+LTYGAD D++L +  E   N+ISAR FV 
Sbjct:    92 AEHPRLRYFGNISLGTDVSLRELRDRYHAVLLTYGADQDRQLELENEQLDNVISARKFVA 151

Query:   136 WYNGLPEDASLDLSLDCEEATILGQGNVAMDVARILLSPVDQLKSTDITEHSLEKLSTSR 195
             WYNGLP   +L   L   + TI+GQGNVA+DVAR+LLSP+D LK+TD TE++LE LS S+
Sbjct:   152 WYNGLPGAENLAPDLSGRDVTIVGQGNVAVDVARMLLSPLDALKTTDTTEYALEALSCSQ 211

Query:   196 IKSVNLVGRRGALQVAFTIKEFREMTKLPHVQTVFRNEQLCGVHEASATLARPRKRLTEL 255
             ++ V+LVGRRG LQ AFTIKE REM KLP+V T +R E   G+      L RPRKRLTEL
Sbjct:   212 VERVHLVGRRGPLQAAFTIKELREMLKLPNVDTRWRTEDFSGIDMQLDKLQRPRKRLTEL 271

Query:   256 ILKTSNPDESKSNCSKYFRPIFLRSPTEFKLND-NGAITGINFANQQALVTEDTELIPSG 314
             +LK S  ++ + + SK F PIFLR+P      +   ++T +    + A+ T  TE +PS 
Sbjct:   272 MLK-SLKEQGRISGSKQFLPIFLRAPKAIAPGEMEFSVTELQ--QEAAVPTSSTERLPSH 328

Query:   315 IAFRSIGYQSRCVDSDIPFNEK 336
             +  RSIGY+S CVD+ I F+ +
Sbjct:   329 LILRSIGYKSSCVDTGINFDTR 350
GO:0042331 "phototaxis" evidence=NAS
GO:0006694 "steroid biosynthetic process" evidence=IEP;IDA;NAS
GO:0042048 "olfactory behavior" evidence=IMP;NAS
GO:0042810 "pheromone metabolic process" evidence=NAS
GO:0015039 "NADPH-adrenodoxin reductase activity" evidence=ISS;NAS
GO:0007619 "courtship behavior" evidence=NAS
GO:0007591 "molting cycle, chitin-based cuticle" evidence=NAS;IMP
GO:0035073 "pupariation" evidence=IMP
GO:0005739 "mitochondrion" evidence=NAS;IDA
GO:0007552 "metamorphosis" evidence=IMP
GO:0004324 "ferredoxin-NADP+ reductase activity" evidence=NAS
GO:0009055 "electron carrier activity" evidence=ISS;NAS
GO:0005759 "mitochondrial matrix" evidence=ISS;NAS
GO:0006707 "cholesterol catabolic process" evidence=ISS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
UNIPROTKB|E7EQC1 FDXR "NADPH:adrenodoxin oxidoreductase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P22570 FDXR "NADPH:adrenodoxin oxidoreductase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RDC3 FDXR "NADPH:adrenodoxin oxidoreductase, mitochondrial" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P08165 FDXR "NADPH:adrenodoxin oxidoreductase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NRB1 FDXR "NADPH:adrenodoxin oxidoreductase, mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|621648 Fdxr "ferredoxin reductase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P56522 Fdxr "NADPH:adrenodoxin oxidoreductase, mitochondrial" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:104724 Fdxr "ferredoxin reductase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1RV70 FDXR "NADPH:adrenodoxin oxidoreductase, mitochondrial" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9V3T9ADRO_DROME1, ., 1, 8, ., 1, ., 20.47580.95360.7939yesN/A
P08165ADRO_BOVIN1, ., 1, 8, ., 1, ., 20.49050.89690.7073yesN/A
O32886FPRA_MYCLE1, ., 1, 8, ., 1, ., 20.38900.81440.6929yesN/A
Q54KG7ADRO_DICDI1, ., 1, 8, ., 1, ., 20.38650.85300.6427yesN/A
P48360ADRO_YEAST1, ., 1, 8, ., 1, ., 20.37040.76540.6024yesN/A
P56522ADRO_RAT1, ., 1, 8, ., 1, ., 20.48190.87880.6902yesN/A
P22570ADRO_HUMAN1, ., 1, 8, ., 1, ., 20.49860.87620.6924yesN/A
O05783FPRA_MYCTU1, ., 1, 8, ., 1, ., 20.37940.82730.7039yesN/A
O59710ADRO_SCHPO1, ., 1, 8, ., 1, ., 20.40260.90200.7462yesN/A
Q61578ADRO_MOUSE1, ., 1, 8, ., 1, ., 20.43440.96130.7550yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.18.1.20.914
3rd Layer1.18.10.921

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query388
PLN02852491 PLN02852, PLN02852, ferredoxin-NADP+ reductase 1e-122
PTZ00188506 PTZ00188, PTZ00188, adrenodoxin reductase; Provisi 3e-46
COG0493457 COG0493, GltD, NADPH-dependent glutamate synthase 3e-27
PRK11749457 PRK11749, PRK11749, dihydropyrimidine dehydrogenas 6e-19
COG0493457 COG0493, GltD, NADPH-dependent glutamate synthase 6e-18
PRK12771564 PRK12771, PRK12771, putative glutamate synthase (N 1e-17
TIGR01316449 TIGR01316, gltA, glutamate synthase (NADPH), homot 6e-16
PRK13984604 PRK13984, PRK13984, putative oxidoreductase; Provi 1e-15
TIGR01318467 TIGR01318, gltD_gamma_fam, glutamate synthase smal 5e-15
PRK12810471 PRK12810, gltD, glutamate synthase subunit beta; R 6e-15
PRK12809639 PRK12809, PRK12809, putative oxidoreductase Fe-S b 7e-15
TIGR01317485 TIGR01317, GOGAT_sm_gam, glutamate synthases, NADH 3e-14
PRK12831464 PRK12831, PRK12831, putative oxidoreductase; Provi 5e-13
PRK12770352 PRK12770, PRK12770, putative glutamate synthase su 1e-12
PRK12814652 PRK12814, PRK12814, putative NADPH-dependent gluta 1e-12
PRK12775 1006 PRK12775, PRK12775, putative trifunctional 2-polyp 3e-11
PRK12778752 PRK12778, PRK12778, putative bifunctional 2-polypr 5e-10
PRK12779 944 PRK12779, PRK12779, putative bifunctional glutamat 4e-09
PRK12769654 PRK12769, PRK12769, putative oxidoreductase Fe-S b 4e-08
PRK09853 1019 PRK09853, PRK09853, putative selenate reductase su 3e-07
TIGR03315 1012 TIGR03315, Se_ygfK, putative selenate reductase, Y 5e-07
>gnl|CDD|215457 PLN02852, PLN02852, ferredoxin-NADP+ reductase Back     alignment and domain information 
 Score =  363 bits (933), Expect = e-122
 Identities = 181/475 (38%), Positives = 247/475 (52%), Gaps = 96/475 (20%)

Query: 7   STISQLKPNVCIVGSGPAGFYCAQQILKLLPQSTVDIYEKLPVPFGLVRYGVAPDHPEVK 66
           S+ +    +VC+VGSGPAGFY A ++LK    + VDI E+LP PFGLVR GVAPDHPE K
Sbjct: 20  SSSTSEPLHVCVVGSGPAGFYTADKLLKAHDGARVDIIERLPTPFGLVRSGVAPDHPETK 79

Query: 67  NVINTFTKTGDNPRVNFYGNICLGQDISLGDLTNAYHAVVLTYGADNDKKLNIPGEDGKN 126
           NV N F++   + RV+F+GN+ LG+D+SL +L + YH VVL YGA++D++L IPGED   
Sbjct: 80  NVTNQFSRVATDDRVSFFGNVTLGRDVSLSELRDLYHVVVLAYGAESDRRLGIPGEDLPG 139

Query: 127 IISARSFVGWYNGLPEDASL--DLSLDCEEATILGQGNVAMDVARILLSPVDQLKSTDIT 184
           ++SAR FV WYNG P+   L  DL    + A +LGQGNVA+D ARILL P D+L STDI 
Sbjct: 140 VLSAREFVWWYNGHPDCVHLPPDLKSS-DTAVVLGQGNVALDCARILLRPTDELASTDIA 198

Query: 185 EHSLEKLSTSRIKSVNLVGRRGALQVAFTIKEFREMTKLPHVQTVFRNEQLCGVHEASAT 244
           EH+LE L  S ++ V LVGRRG +Q A T KE RE+  L +V+   +   L    E    
Sbjct: 199 EHALEALRGSSVRKVYLVGRRGPVQAACTAKELRELLGLKNVRVRIKEADLTLSPEDEEE 258

Query: 245 LA--RPRKRLTELILKT-SNPDESKSNCSKYFRPIFLRSPTEFKLND--NGAITGINF-- 297
           L   RP++R+ EL+ K  +    + S   +    +F R+PT F  +   NG + G+    
Sbjct: 259 LKASRPKRRVYELLSKAAAAGKCAPSGGQRELHFVFFRNPTRFLDSGDGNGHVAGVKLER 318

Query: 298 --------ANQQALV-TEDTELIPSGIAFRSIGYQSRCVDSDIPFNEKSCTVIP------ 342
                   + +Q  V T + E +P G+  +SIGY+S  VD  +PF+ K   V+P      
Sbjct: 319 TVLEGAAGSGKQVAVGTGEFEDLPCGLVLKSIGYKSLPVDG-LPFDHKR-GVVPNVHGRV 376

Query: 343 ---------KEGVPVVTWE--------GWKAIDKEET--------ERGKLK--------- 368
                    + G+ VV W         G      EET        E+G+L+         
Sbjct: 377 LSSASGADTEPGLYVVGWLKRGPTGIIGTNLTCAEETVASIAEDLEQGRLRGVASPPKPG 436

Query: 369 -----------------------------------GKPREKIISIEEMISVSGNS 388
                                              GKPREKI SIEEM+  +   
Sbjct: 437 RDGLLELLESRGVRVVPFSGWEKIDSAEKEAGRARGKPREKITSIEEMLKAANEK 491

Length = 491
>gnl|CDD|240308 PTZ00188, PTZ00188, adrenodoxin reductase; Provisional Back     alignment and domain information
>gnl|CDD|223567 COG0493, GltD, NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|236967 PRK11749, PRK11749, dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|223567 COG0493, GltD, NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|237198 PRK12771, PRK12771, putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>gnl|CDD|130383 TIGR01316, gltA, glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>gnl|CDD|172486 PRK13984, PRK13984, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|130385 TIGR01318, gltD_gamma_fam, glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>gnl|CDD|237213 PRK12810, gltD, glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>gnl|CDD|183762 PRK12809, PRK12809, putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>gnl|CDD|162300 TIGR01317, GOGAT_sm_gam, glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>gnl|CDD|183780 PRK12831, PRK12831, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|237197 PRK12770, PRK12770, putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|139246 PRK12814, PRK12814, putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>gnl|CDD|183738 PRK12775, PRK12775, putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|237200 PRK12778, PRK12778, putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|183740 PRK12779, PRK12779, putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|183733 PRK12769, PRK12769, putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>gnl|CDD|236630 PRK09853, PRK09853, putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>gnl|CDD|132358 TIGR03315, Se_ygfK, putative selenate reductase, YgfK subunit Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 388
KOG1800|consensus468 100.0
PTZ00188506 adrenodoxin reductase; Provisional 100.0
PLN02852491 ferredoxin-NADP+ reductase 100.0
PRK12779 944 putative bifunctional glutamate synthase subunit b 100.0
PRK12831464 putative oxidoreductase; Provisional 100.0
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 100.0
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 99.98
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 99.97
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 99.97
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 99.97
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 99.97
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 99.97
PRK12814 652 putative NADPH-dependent glutamate synthase small 99.97
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 99.97
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 99.96
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 99.96
PRK12770352 putative glutamate synthase subunit beta; Provisio 99.96
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 99.95
PRK06370 463 mercuric reductase; Validated 99.95
COG1249 454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 99.95
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 99.95
TIGR01421 450 gluta_reduc_1 glutathione-disulfide reductase, ani 99.95
PRK06567 1028 putative bifunctional glutamate synthase subunit b 99.95
PRK07251 438 pyridine nucleotide-disulfide oxidoreductase; Prov 99.94
PRK13984604 putative oxidoreductase; Provisional 99.94
PRK06467 471 dihydrolipoamide dehydrogenase; Reviewed 99.94
TIGR01424 446 gluta_reduc_2 glutathione-disulfide reductase, pla 99.94
TIGR02053 463 MerA mercuric reductase. This model represents the 99.94
PRK06116 450 glutathione reductase; Validated 99.94
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 99.94
PRK05249 461 soluble pyridine nucleotide transhydrogenase; Prov 99.94
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 99.94
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 99.94
PRK08010 441 pyridine nucleotide-disulfide oxidoreductase; Prov 99.94
PLN02507 499 glutathione reductase 99.94
PLN02546 558 glutathione reductase 99.93
PTZ00058 561 glutathione reductase; Provisional 99.93
PRK10262321 thioredoxin reductase; Provisional 99.93
PRK14989 847 nitrite reductase subunit NirD; Provisional 99.93
PRK06416 462 dihydrolipoamide dehydrogenase; Reviewed 99.93
PLN02172461 flavin-containing monooxygenase FMO GS-OX 99.93
PRK06115 466 dihydrolipoamide dehydrogenase; Reviewed 99.93
TIGR01423 486 trypano_reduc trypanothione-disulfide reductase. T 99.93
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 99.93
PRK07845 466 flavoprotein disulfide reductase; Reviewed 99.93
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 99.92
PRK05976 472 dihydrolipoamide dehydrogenase; Validated 99.92
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 99.92
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 99.92
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 99.92
PRK07846 451 mycothione reductase; Reviewed 99.92
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 99.92
PRK13748 561 putative mercuric reductase; Provisional 99.92
PRK09564 444 coenzyme A disulfide reductase; Reviewed 99.92
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 99.92
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 99.91
PRK06912 458 acoL dihydrolipoamide dehydrogenase; Validated 99.91
PRK06292 460 dihydrolipoamide dehydrogenase; Validated 99.91
PRK14727 479 putative mercuric reductase; Provisional 99.91
PRK06327 475 dihydrolipoamide dehydrogenase; Validated 99.91
TIGR01350 461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 99.91
PRK07818 466 dihydrolipoamide dehydrogenase; Reviewed 99.91
TIGR01438 484 TGR thioredoxin and glutathione reductase selenopr 99.91
KOG0404|consensus322 99.91
KOG0399|consensus2142 99.91
PTZ00318424 NADH dehydrogenase-like protein; Provisional 99.91
PRK14694 468 putative mercuric reductase; Provisional 99.9
PRK13512 438 coenzyme A disulfide reductase; Provisional 99.9
PTZ00052 499 thioredoxin reductase; Provisional 99.9
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 99.9
PTZ00153 659 lipoamide dehydrogenase; Provisional 99.9
TIGR03452 452 mycothione_red mycothione reductase. Mycothiol, a 99.89
KOG1336|consensus478 99.89
KOG1335|consensus 506 99.89
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 99.88
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 99.88
KOG0405|consensus 478 99.87
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 99.85
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 99.85
KOG1399|consensus448 99.85
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 99.84
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 99.82
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 99.81
KOG4716|consensus 503 99.79
TIGR03385 427 CoA_CoA_reduc CoA-disulfide reductase. Members of 99.77
KOG2495|consensus491 99.73
COG0446 415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 99.6
KOG1346|consensus 659 99.42
PRK09897 534 hypothetical protein; Provisional 99.22
COG1148 622 HdrA Heterodisulfide reductase, subunit A and rela 99.13
COG4529474 Uncharacterized protein conserved in bacteria [Fun 99.13
KOG2755|consensus334 99.12
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 99.08
COG2081408 Predicted flavoproteins [General function predicti 99.03
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 98.93
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.88
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.72
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 98.62
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 98.61
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.58
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 98.5
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 98.49
PRK10157428 putative oxidoreductase FixC; Provisional 98.49
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.48
PRK06847375 hypothetical protein; Provisional 98.47
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 98.45
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 98.43
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 98.43
PRK10015429 oxidoreductase; Provisional 98.42
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.42
PRK12842 574 putative succinate dehydrogenase; Reviewed 98.4
PLN02463447 lycopene beta cyclase 98.38
TIGR00275400 flavoprotein, HI0933 family. The model when search 98.36
PLN02661357 Putative thiazole synthesis 98.33
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 98.29
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.27
PRK06834 488 hypothetical protein; Provisional 98.23
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.22
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.21
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.21
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 98.2
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 98.19
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 98.17
KOG0029|consensus 501 98.16
PRK06184 502 hypothetical protein; Provisional 98.16
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 98.13
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 98.12
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.12
PRK05976472 dihydrolipoamide dehydrogenase; Validated 98.12
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.12
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.12
COG0579429 Predicted dehydrogenase [General function predicti 98.11
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 98.1
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 98.1
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.1
PLN02697529 lycopene epsilon cyclase 98.1
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 98.08
PRK11445351 putative oxidoreductase; Provisional 98.08
PRK13512438 coenzyme A disulfide reductase; Provisional 98.08
PRK07236386 hypothetical protein; Provisional 98.06
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.06
PRK09564444 coenzyme A disulfide reductase; Reviewed 98.05
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.04
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 98.04
PRK07208 479 hypothetical protein; Provisional 98.02
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 98.01
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 98.01
COG1233 487 Phytoene dehydrogenase and related proteins [Secon 98.01
PRK07190 487 hypothetical protein; Provisional 98.01
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 98.01
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 98.0
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 98.0
TIGR02053463 MerA mercuric reductase. This model represents the 98.0
PRK06370463 mercuric reductase; Validated 97.98
PRK11728393 hydroxyglutarate oxidase; Provisional 97.98
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 97.98
PRK11883451 protoporphyrinogen oxidase; Reviewed 97.97
PRK08401466 L-aspartate oxidase; Provisional 97.96
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.96
PLN02507499 glutathione reductase 97.96
PRK06116450 glutathione reductase; Validated 97.96
PRK06327475 dihydrolipoamide dehydrogenase; Validated 97.96
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 97.95
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 97.95
PRK14694468 putative mercuric reductase; Provisional 97.95
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 97.94
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 97.93
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 97.92
PRK07845466 flavoprotein disulfide reductase; Reviewed 97.92
KOG2415|consensus 621 97.9
PRK07846451 mycothione reductase; Reviewed 97.9
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 97.89
PLN02576 496 protoporphyrinogen oxidase 97.89
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 97.88
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 97.87
PRK13748561 putative mercuric reductase; Provisional 97.87
KOG1335|consensus506 97.87
PLN02268435 probable polyamine oxidase 97.87
COG3349 485 Uncharacterized conserved protein [Function unknow 97.87
PRK14727479 putative mercuric reductase; Provisional 97.86
PRK07233434 hypothetical protein; Provisional 97.86
KOG3851|consensus446 97.85
PTZ00318424 NADH dehydrogenase-like protein; Provisional 97.84
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 97.84
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 97.82
PRK14989 847 nitrite reductase subunit NirD; Provisional 97.81
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 97.8
TIGR01292 300 TRX_reduct thioredoxin-disulfide reductase. This m 97.8
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 97.79
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 97.78
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 97.78
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.78
TIGR02733 492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 97.78
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 97.77
PTZ00058561 glutathione reductase; Provisional 97.77
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 97.77
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 97.77
PRK12416463 protoporphyrinogen oxidase; Provisional 97.76
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 97.75
PRK08163396 salicylate hydroxylase; Provisional 97.75
PTZ00052499 thioredoxin reductase; Provisional 97.74
PRK06292460 dihydrolipoamide dehydrogenase; Validated 97.73
TIGR02734 502 crtI_fam phytoene desaturase. Phytoene is converte 97.72
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 97.72
PRK07045388 putative monooxygenase; Reviewed 97.71
PLN02568 539 polyamine oxidase 97.71
PTZ00153659 lipoamide dehydrogenase; Provisional 97.71
PLN02546558 glutathione reductase 97.71
TIGR00551 488 nadB L-aspartate oxidase. L-aspartate oxidase is t 97.69
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 97.68
PRK09126392 hypothetical protein; Provisional 97.67
PRK08013400 oxidoreductase; Provisional 97.66
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.65
KOG1276|consensus 491 97.65
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 97.64
PRK06753373 hypothetical protein; Provisional 97.63
TIGR02730 493 carot_isom carotene isomerase. Members of this fam 97.63
PRK13977 576 myosin-cross-reactive antigen; Provisional 97.63
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 97.63
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 97.63
PRK10262321 thioredoxin reductase; Provisional 97.61
KOG1336|consensus478 97.61
COG2081 408 Predicted flavoproteins [General function predicti 97.59
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.58
PLN02529 738 lysine-specific histone demethylase 1 97.57
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 97.57
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 97.57
PRK05868372 hypothetical protein; Validated 97.56
PLN02676487 polyamine oxidase 97.56
KOG0685|consensus 498 97.55
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 97.55
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 97.55
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 97.53
PRK07538413 hypothetical protein; Provisional 97.53
PRK06847 375 hypothetical protein; Provisional 97.52
PRK06475400 salicylate hydroxylase; Provisional 97.52
PRK08244 493 hypothetical protein; Provisional 97.52
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 97.52
PRK07588391 hypothetical protein; Provisional 97.5
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 97.5
PRK06185407 hypothetical protein; Provisional 97.5
TIGR02732 474 zeta_caro_desat carotene 7,8-desaturase. Carotene 97.49
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 97.48
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 97.48
COG1231450 Monoamine oxidase [Amino acid transport and metabo 97.46
PLN02487 569 zeta-carotene desaturase 97.46
PLN02328 808 lysine-specific histone demethylase 1 homolog 97.46
COG2907447 Predicted NAD/FAD-binding protein [General functio 97.44
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 97.44
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 97.44
PLN02172 461 flavin-containing monooxygenase FMO GS-OX 97.43
PF03486 409 HI0933_like: HI0933-like protein; InterPro: IPR004 97.43
PRK06126 545 hypothetical protein; Provisional 97.42
PRK08132 547 FAD-dependent oxidoreductase; Provisional 97.4
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 97.39
PLN02612 567 phytoene desaturase 97.39
PRK06481506 fumarate reductase flavoprotein subunit; Validated 97.39
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 97.38
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 97.38
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.38
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 97.37
PRK08274466 tricarballylate dehydrogenase; Validated 97.36
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 97.36
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 97.36
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 97.35
KOG2404|consensus477 97.33
PLN02985514 squalene monooxygenase 97.33
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 97.32
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 97.31
PRK11259376 solA N-methyltryptophan oxidase; Provisional 97.3
PTZ00367 567 squalene epoxidase; Provisional 97.29
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 97.29
PF01134 392 GIDA: Glucose inhibited division protein A; InterP 97.29
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 97.27
PRK07121492 hypothetical protein; Validated 97.27
PRK12266 508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 97.25
PRK08294 634 phenol 2-monooxygenase; Provisional 97.25
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 97.25
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 97.23
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 97.22
PRK07236 386 hypothetical protein; Provisional 97.21
PLN03000 881 amine oxidase 97.2
PRK13369 502 glycerol-3-phosphate dehydrogenase; Provisional 97.2
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 97.19
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 97.19
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 97.19
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 97.18
KOG2820|consensus399 97.18
TIGR03140 515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 97.17
KOG2495|consensus491 97.17
PRK15317 517 alkyl hydroperoxide reductase subunit F; Provision 97.16
PRK05257 494 malate:quinone oxidoreductase; Validated 97.16
PF01494 356 FAD_binding_3: FAD binding domain; InterPro: IPR00 97.16
PRK12837 513 3-ketosteroid-delta-1-dehydrogenase; Provisional 97.15
PLN02976 1713 amine oxidase 97.15
COG0644 396 FixC Dehydrogenases (flavoproteins) [Energy produc 97.15
TIGR01320 483 mal_quin_oxido malate:quinone-oxidoreductase. This 97.14
PRK07045 388 putative monooxygenase; Reviewed 97.14
PRK12834 549 putative FAD-binding dehydrogenase; Reviewed 97.14
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 97.12
KOG0405|consensus478 97.12
PRK06996398 hypothetical protein; Provisional 97.07
PRK07804 541 L-aspartate oxidase; Provisional 97.06
COG0029 518 NadB Aspartate oxidase [Coenzyme metabolism] 97.05
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.04
COG0493 457 GltD NADPH-dependent glutamate synthase beta chain 97.02
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 97.02
PRK12839 572 hypothetical protein; Provisional 97.01
PRK12844 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.0
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 97.0
PRK05868 372 hypothetical protein; Validated 97.0
TIGR02462 544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 97.0
PLN02463 447 lycopene beta cyclase 96.99
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 96.98
PRK06175433 L-aspartate oxidase; Provisional 96.98
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 96.98
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 96.97
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 96.96
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 96.96
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 96.95
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 96.95
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 96.95
PRK12845 564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 96.95
KOG2614|consensus420 96.94
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 96.94
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 96.92
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 96.92
PRK13339 497 malate:quinone oxidoreductase; Reviewed 96.91
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 96.9
PRK07364 415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 96.89
COG3573 552 Predicted oxidoreductase [General function predict 96.89
PRK10157 428 putative oxidoreductase FixC; Provisional 96.88
PTZ00383497 malate:quinone oxidoreductase; Provisional 96.88
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 96.88
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 96.86
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 96.86
PRK08773 392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 96.85
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 96.84
COG1148 622 HdrA Heterodisulfide reductase, subunit A and rela 96.83
PLN02815 594 L-aspartate oxidase 96.83
PLN02464 627 glycerol-3-phosphate dehydrogenase 96.83
PRK06834 488 hypothetical protein; Provisional 96.83
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 96.8
PRK06184 502 hypothetical protein; Provisional 96.79
PF06100 500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 96.78
PRK07588 391 hypothetical protein; Provisional 96.77
PRK12770352 putative glutamate synthase subunit beta; Provisio 96.77
PRK12831464 putative oxidoreductase; Provisional 96.76
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 96.75
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 96.74
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 96.74
PRK12779 944 putative bifunctional glutamate synthase subunit b 96.73
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 96.73
PRK06753 373 hypothetical protein; Provisional 96.7
COG4529 474 Uncharacterized protein conserved in bacteria [Fun 96.69
PRK08071 510 L-aspartate oxidase; Provisional 96.69
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 96.68
PRK08275 554 putative oxidoreductase; Provisional 96.68
PRK06475 400 salicylate hydroxylase; Provisional 96.67
PRK07395 553 L-aspartate oxidase; Provisional 96.67
PLN02697 529 lycopene epsilon cyclase 96.67
COG0654 387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 96.66
KOG2960|consensus328 96.65
PRK08163 396 salicylate hydroxylase; Provisional 96.65
PRK11445 351 putative oxidoreductase; Provisional 96.64
PRK09897 534 hypothetical protein; Provisional 96.63
PRK07608 388 ubiquinone biosynthesis hydroxylase family protein 96.63
PRK12843 578 putative FAD-binding dehydrogenase; Reviewed 96.62
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.62
PRK09077 536 L-aspartate oxidase; Provisional 96.61
PRK10015 429 oxidoreductase; Provisional 96.59
PRK07333 403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 96.59
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 96.57
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 96.57
TIGR01813 439 flavo_cyto_c flavocytochrome c. This model describ 96.55
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 96.55
TIGR01790 388 carotene-cycl lycopene cyclase family protein. Thi 96.54
KOG2311|consensus 679 96.53
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 96.52
KOG3923|consensus342 96.51
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 96.51
PRK06185 407 hypothetical protein; Provisional 96.5
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 96.5
PRK09126 392 hypothetical protein; Provisional 96.46
TIGR01988 385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 96.42
PRK08020 391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 96.41
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 96.39
TIGR01984 382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 96.39
PRK08132 547 FAD-dependent oxidoreductase; Provisional 96.39
PRK08244 493 hypothetical protein; Provisional 96.38
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.38
PRK08849 384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 96.37
KOG1399|consensus 448 96.36
COG1053 562 SdhA Succinate dehydrogenase/fumarate reductase, f 96.36
PLN02852 491 ferredoxin-NADP+ reductase 96.36
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 96.35
TIGR01318 467 gltD_gamma_fam glutamate synthase small subunit fa 96.33
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 96.32
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 96.29
PRK07538 413 hypothetical protein; Provisional 96.29
PTZ00188 506 adrenodoxin reductase; Provisional 96.27
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 96.25
TIGR01317 485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 96.24
PRK05714 405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 96.23
PRK02106 560 choline dehydrogenase; Validated 96.22
PRK06126 545 hypothetical protein; Provisional 96.21
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 96.21
KOG1298|consensus509 96.2
PRK08013 400 oxidoreductase; Provisional 96.19
COG0578 532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 96.12
PRK02705 459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.12
PRK07190 487 hypothetical protein; Provisional 96.09
PF12831 428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 96.07
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 96.06
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 96.06
KOG1346|consensus659 96.06
TIGR03219 414 salicylate_mono salicylate 1-monooxygenase. Member 96.04
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 96.03
PRK08243 392 4-hydroxybenzoate 3-monooxygenase; Validated 96.01
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 96.01
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 96.01
PLN02985 514 squalene monooxygenase 95.99
PLN02661357 Putative thiazole synthesis 95.99
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 95.94
PRK06481 506 fumarate reductase flavoprotein subunit; Validated 95.91
PRK06567 1028 putative bifunctional glutamate synthase subunit b 95.89
PRK08850 405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 95.86
PRK07121 492 hypothetical protein; Validated 95.85
PRK07512 513 L-aspartate oxidase; Provisional 95.83
PRK07494 388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 95.8
COG0569225 TrkA K+ transport systems, NAD-binding component [ 95.78
KOG4254|consensus 561 95.77
PRK06617 374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 95.77
PF05834 374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 95.76
COG2303 542 BetA Choline dehydrogenase and related flavoprotei 95.75
PRK06996 398 hypothetical protein; Provisional 95.72
TIGR02023 388 BchP-ChlP geranylgeranyl reductase. This model rep 95.71
TIGR01789 370 lycopene_cycl lycopene cyclase. This model represe 95.68
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 95.65
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 95.64
KOG2665|consensus453 95.54
TIGR02028 398 ChlP geranylgeranyl reductase. This model represen 95.53
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 95.52
PRK05732 395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 95.49
TIGR01810 532 betA choline dehydrogenase. This enzyme is a membe 95.49
PF00890 417 FAD_binding_2: FAD binding domain of the Pfam fami 95.48
PRK12814652 putative NADPH-dependent glutamate synthase small 95.46
PRK06719157 precorrin-2 dehydrogenase; Validated 95.45
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 95.39
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 95.39
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 95.27
PRK08274 466 tricarballylate dehydrogenase; Validated 95.27
PLN02785 587 Protein HOTHEAD 95.25
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 95.21
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 95.19
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 95.17
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 95.16
KOG1238|consensus 623 95.14
KOG2853|consensus509 95.08
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 95.02
TIGR01989 437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 94.96
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 94.94
PRK01747 662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 94.85
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 94.82
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 94.79
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 94.76
PRK06175 433 L-aspartate oxidase; Provisional 94.76
TIGR00551 488 nadB L-aspartate oxidase. L-aspartate oxidase is t 94.73
TIGR00275 400 flavoprotein, HI0933 family. The model when search 94.7
PF06039 488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 94.68
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 94.68
TIGR02360 390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 94.65
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 94.62
KOG4716|consensus503 94.62
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 94.52
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 94.51
PLN00093 450 geranylgeranyl diphosphate reductase; Provisional 94.46
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 94.43
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 94.43
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 94.38
PRK08275 554 putative oxidoreductase; Provisional 94.36
PRK07804 541 L-aspartate oxidase; Provisional 94.32
KOG2852|consensus380 94.29
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 94.24
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 94.21
PRK08294 634 phenol 2-monooxygenase; Provisional 94.17
PRK15116268 sulfur acceptor protein CsdL; Provisional 94.13
PRK13984 604 putative oxidoreductase; Provisional 94.12
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 93.96
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 93.79
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 93.74
KOG3851|consensus 446 93.68
PRK06718202 precorrin-2 dehydrogenase; Reviewed 93.62
KOG2404|consensus 477 93.58
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 93.53
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 93.47
PTZ00367 567 squalene epoxidase; Provisional 93.46
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 93.45
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 93.4
KOG3855|consensus481 93.34
>KOG1800|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.9e-56  Score=404.21  Aligned_cols=375  Identities=53%  Similarity=0.890  Sum_probs=332.1

Q ss_pred             CCCCcEEEECccHHHHHHHHHHHhhCCCCcEEEEcCCCCCCCceeeCCCCCCcchhHHHHHHHHhhcCCCcEEEceEEEE
Q psy4525          11 QLKPNVCIVGSGPAGFYCAQQILKLLPQSTVDIYEKLPVPFGLVRYGVAPDHPEVKNVINTFTKTGDNPRVNFYGNICLG   90 (388)
Q Consensus        11 ~~~~~vvIIGaG~aGl~aA~~l~~~~~g~~v~lie~~~~~gg~~~~g~~p~~~~~~~~~~~~~~~~~~~~i~~~~~~~v~   90 (388)
                      ..+++|+|||+||||+++|..|.++.+++.|+|+|+.+.++|+.+||++|++++.+.+...+.+.+++..+.|..|..++
T Consensus        18 s~~p~vcIVGsGPAGfYtA~~LLk~~~~~~Vdi~Ek~PvPFGLvRyGVAPDHpEvKnvintFt~~aE~~rfsf~gNv~vG   97 (468)
T KOG1800|consen   18 SSTPRVCIVGSGPAGFYTAQHLLKRHPNAHVDIFEKLPVPFGLVRYGVAPDHPEVKNVINTFTKTAEHERFSFFGNVKVG   97 (468)
T ss_pred             cCCceEEEECCCchHHHHHHHHHhcCCCCeeEeeecCCcccceeeeccCCCCcchhhHHHHHHHHhhccceEEEecceec
Confidence            44569999999999999999999977889999999999999999999999999999999999999999999999999999


Q ss_pred             EEeeecccccccCEEEEeeCCCCCCCCCCCCCCCCCeeecccccccccCCCCccccCcCCCCCeEEEEcCChHHHHHHHH
Q psy4525          91 QDISLGDLTNAYHAVVLTYGADNDKKLNIPGEDGKNIISARSFVGWYNGLPEDASLDLSLDCEEATILGQGNVAMDVARI  170 (388)
Q Consensus        91 ~~~~~~~~~~~yd~lvlAtG~~~~~~~~i~g~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~vvVIGgG~sg~e~a~~  170 (388)
                      .++++.+.+..||+||||+|+...|.++|||.++.+|++++.|.+||+++|...++..+..+.+|+|||.|++++|+|+.
T Consensus        98 ~dvsl~eL~~~ydavvLaYGa~~dR~L~IPGe~l~~V~Sarefv~Wyng~P~~~~le~dls~~~vvIvG~GNVAlDvARi  177 (468)
T KOG1800|consen   98 RDVSLKELTDNYDAVVLAYGADGDRRLDIPGEELSGVISAREFVGWYNGLPENQNLEPDLSGRKVVIVGNGNVALDVARI  177 (468)
T ss_pred             ccccHHHHhhcccEEEEEecCCCCcccCCCCcccccceehhhhhhhccCCCcccccCcccccceEEEEccCchhhhhhhh
Confidence            99999999999999999999998899999999999999999999999999999888778889999999999999999999


Q ss_pred             hccCCcccc-cccCchhHHHhhhcCCCcEEEEEeecCcccccCCHHHHHHHhcCCCceEEecccccccchhhhccc--cc
Q psy4525         171 LLSPVDQLK-STDITEHSLEKLSTSRIKSVNLVGRRGALQVAFTIKEFREMTKLPHVQTVFRNEQLCGVHEASATL--AR  247 (388)
Q Consensus       171 L~~~~~~~~-~~~~~~~~~~~~~~~~~~~V~~i~r~~~~~~~~~~~el~~l~~~~~~~~~~~~~~~~~~~~~~~~l--~~  247 (388)
                      |......+. .|||+..++..++...++.|+++.|+++.+..||.+||||+..+|+.+..+++.++...-......  .|
T Consensus       178 Lls~~~~l~~~TDi~~~aL~~L~~s~VkdV~lvgRRgp~~~aFTiKELRE~~~l~~~~~r~~~~~~~~~~~~~~~~~~~R  257 (468)
T KOG1800|consen  178 LLSPQGPLFRRTDIPKLALNLLKRSNVKDVKLVGRRGPLQVAFTIKELREVLELPGARPRLDPVDFSGKWMDESETPQHR  257 (468)
T ss_pred             hhCCccccccccCCcHHHHhhhhcCCcceEEEEeccCccceeeeHHHHHHHhCCCCcccccCchhccceeCCcccccccC
Confidence            998888775 999999999999999999999999999999999999999999999999998887776333222333  48


Q ss_pred             hhhHHHHHHHhhCCCCCC----CCCCceeEEEEecCcceeeeeCCCCceeEEEEccC-----ccccCCceeEEecceEEE
Q psy4525         248 PRKRLTELILKTSNPDES----KSNCSKYFRPIFLRSPTEFKLNDNGAITGINFANQ-----QALVTEDTELIPSGIAFR  318 (388)
Q Consensus       248 ~~~~~~~~~~~~~~~~~~----~~~~~~gv~~~~~~~~~~i~~~~~~~v~~v~~~~~-----~~~~~~~~~~l~~D~Vi~  318 (388)
                      +++|+.+.+.+.+.++..    .....+-..++|...+.+|.++..+ +..+.+...     ..+.+++.+.++|++++.
T Consensus       258 pRkrl~ell~k~~~e~~~~~~~~~~~~k~w~~~f~r~P~~i~~~~~~-v~~~~~~~t~l~~~~~~~tg~~e~~p~~l~i~  336 (468)
T KOG1800|consen  258 PRKRLTELLLKWAREHRAKASEEAGGSKQWHLRFFRTPGAILPGADG-VSGVRFQVTILEGTQAVPTGAFETLPCGLLIR  336 (468)
T ss_pred             chhHHHHHHHHHHHhhhhccccccCccchhHHHHhcCHHHhccCccc-ccceEEEeeeehhhcccccCceEeeccceeEe
Confidence            899999999888765321    2334456788899999999876433 666655522     145678889999999999


Q ss_pred             ccccCCccCCCCCcccCCCccc----------------------------------------------------------
Q psy4525         319 SIGYQSRCVDSDIPFNEKSCTV----------------------------------------------------------  340 (388)
Q Consensus       319 a~G~~p~~~~~~l~~~~~~gi~----------------------------------------------------------  340 (388)
                      ++||+..+.+.++|||.+.|++                                                          
T Consensus       337 sIGYks~pv~~gipFd~~kgvv~n~~GrV~~s~~~pglY~sGW~k~GP~GvIattm~dAf~v~d~I~qD~~~~~~~ss~~  416 (468)
T KOG1800|consen  337 SIGYKSVPVDSGIPFDDKKGVVPNVNGRVLVSGCSPGLYASGWVKHGPTGVIATTMQDAFEVADTIVQDLKIQFLDSSSA  416 (468)
T ss_pred             eeeecccccCCCCCcccccCcccCCCceEEeeccCCceEEEeeeccCCcceeeehhhhHHHHHHHHHHHHHHhhccchHH
Confidence            9999998888899999887765                                                          


Q ss_pred             -----cCCCCCCeecchhhHHhHHHHHHccccCCCCccccCCHHHHHhhhc
Q psy4525         341 -----IPKEGVPVVTWEGWKAIDKEETERGKLKGKPREKIISIEEMISVSG  386 (388)
Q Consensus       341 -----l~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~~  386 (388)
                           ++.++...+.|++|++||+.|+++|+..|+.|+||++++||++.+.
T Consensus       417 ~l~~~l~~~~v~~v~w~dWe~I~~~E~~~Gk~~~k~reKf~t~Eeml~~~~  467 (468)
T KOG1800|consen  417 GLEALLESRGVRVVSWSDWEKIDAKEVARGKGTGKPREKFVTFEEMLRLLG  467 (468)
T ss_pred             HHHHhhhccCCceecchhHHHhhHHHHhhccccCCchHhcCCHHHHHHHhc
Confidence                 5678889999999999999999999999999999999999998764

>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>KOG0404|consensus Back     alignment and domain information
>KOG0399|consensus Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>KOG1336|consensus Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0405|consensus Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG4716|consensus Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>KOG2495|consensus Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>KOG1346|consensus Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2755|consensus Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>KOG0029|consensus Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>KOG2415|consensus Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>KOG3851|consensus Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>KOG1276|consensus Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>KOG1336|consensus Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>KOG0685|consensus Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>KOG2404|consensus Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2820|consensus Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>KOG2495|consensus Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>KOG0405|consensus Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>KOG2614|consensus Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>KOG2960|consensus Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>KOG2311|consensus Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG3923|consensus Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>KOG1298|consensus Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG1346|consensus Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4254|consensus Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>KOG2665|consensus Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>KOG1238|consensus Back     alignment and domain information
>KOG2853|consensus Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG4716|consensus Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>KOG2852|consensus Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>KOG3851|consensus Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>KOG2404|consensus Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG3855|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query388
1cjc_A460 Structure Of Adrenodoxin Reductase Of Mitochondrial 2e-92
1cjc_A460 Structure Of Adrenodoxin Reductase Of Mitochondrial 2e-04
1lqt_A456 A Covalent Modification Of Nadp+ Revealed By The At 2e-58
2c7g_A456 Fpra From Mycobacterium Tuberculosis: His57gln Muta 1e-57
2vdc_G456 The 9.5 A Resolution Structure Of Glutamate Synthas 1e-04
>pdb|1CJC|A Chain A, Structure Of Adrenodoxin Reductase Of Mitochondrial P450 Systems Length = 460 Back     alignment and structure 
Iteration: 1

 Score =  335 bits (860), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 177/361 (49%), Positives = 232/361 (64%), Gaps = 20/361 (5%)
Query: 14  PNVCIVGSGPAGFYCAQQILKLLPQSTVDIYEKLPVPFGLVRYGVAPDHPEVKNVINTFT 73
           P +C+VGSGPAGFY AQ +LK   ++ VDIYEK  VPFGLVR+GVAPDHPEVKNVINTFT
Sbjct: 7   PQICVVGSGPAGFYTAQHLLKHHSRAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFT 66
Query: 74  KTGDNPRVNFYGNICLGQDISLGDLTNAYHAVVLTYGADNDKKLNIPGEDGKNIISARSF 133
           +T  + R  FYGN+ +G+D+++ +L +AYHAVVL+YGA++ + L+IPGE+   + SAR+F
Sbjct: 67  QTARSDRCAFYGNVEVGRDVTVQELQDAYHAVVLSYGAEDHQALDIPGEELPGVFSARAF 126
Query: 134 VGWYNGLPEDASLDLSLDCEEATILGQGNVAMDVARILLSPVDQLKSTDITEHSLEKLST 193
           VGWYNGLPE+  L   L C+ A ILGQGNVA+DVARILL+P D L+ TDITE +L  L  
Sbjct: 127 VGWYNGLPENRELAPDLSCDTAVILGQGNVALDVARILLTPPDHLEKTDITEAALGALRQ 186
Query: 194 SRIKSVNLVGRRGALQVAFTIKEFREMTKLPHVQTVFRNEQLCGVHEASATLARPRKRLT 253
           SR+K+V +VGRRG LQVAFTIKE REM +LP  + +       G+ +     ARPRKRL 
Sbjct: 187 SRVKTVWIVGRRGPLQVAFTIKELREMIQLPGTRPMLDPADFLGLQDRIKEAARPRKRLM 246
Query: 254 ELILKTSNPDESKSNCSKYFRPI------FLRSPTEFKLNDNG-AITGINFA-------- 298
           EL+L+T+         ++           F RSP +   + +G    GI  A        
Sbjct: 247 ELLLRTATEKPGVEEAARRASASRAWGLRFFRSPQQVLPSPDGRRAAGIRLAVTRLEGIG 306
Query: 299 -NQQALVTEDTELIPSGIAFRSIGYQSRCVDSDIPFNEKSCTVIPKEG----VPVVTWEG 353
              +A+ T D E +P G+   SIGY+SR +D  +PF+ K   V   EG    VP +   G
Sbjct: 307 EATRAVPTGDVEDLPCGLVLSSIGYKSRPIDPSVPFDPKLGVVPNMEGRVVDVPGLYCSG 366
Query: 354 W 354
           W
Sbjct: 367 W 367
>pdb|1CJC|A Chain A, Structure Of Adrenodoxin Reductase Of Mitochondrial P450 Systems Length = 460 Back     alignment and structure
>pdb|1LQT|A Chain A, A Covalent Modification Of Nadp+ Revealed By The Atomic Resolution Structure Of Fpra, A Mycobacterium Tuberculosis Oxidoreductase Length = 456 Back     alignment and structure
>pdb|2C7G|A Chain A, Fpra From Mycobacterium Tuberculosis: His57gln Mutant Length = 456 Back     alignment and structure
>pdb|2VDC|G Chain G, The 9.5 A Resolution Structure Of Glutamate Synthase From Cryo-Electron Microscopy And Its Oligomerization Behavior In Solution: Functional Implications. Length = 456 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query388
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 1e-128
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 1e-119
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 5e-18
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 2e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 4e-05
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 2e-04
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 4e-04
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 6e-04
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Length = 460 Back     alignment and structure
 Score =  375 bits (964), Expect = e-128
 Identities = 187/454 (41%), Positives = 253/454 (55%), Gaps = 80/454 (17%)

Query: 14  PNVCIVGSGPAGFYCAQQILKLLPQSTVDIYEKLPVPFGLVRYGVAPDHPEVKNVINTFT 73
           P +C+VGSGPAGFY AQ +LK   ++ VDIYEK  VPFGLVR+GVAPDHPEVKNVINTFT
Sbjct: 7   PQICVVGSGPAGFYTAQHLLKHHSRAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFT 66

Query: 74  KTGDNPRVNFYGNICLGQDISLGDLTNAYHAVVLTYGADNDKKLNIPGEDGKNIISARSF 133
           +T  + R  FYGN+ +G+D+++ +L +AYHAVVL+YGA++ + L+IPGE+   + SAR+F
Sbjct: 67  QTARSDRCAFYGNVEVGRDVTVQELQDAYHAVVLSYGAEDHQALDIPGEELPGVFSARAF 126

Query: 134 VGWYNGLPEDASLDLSLDCEEATILGQGNVAMDVARILLSPVDQLKSTDITEHSLEKLST 193
           VGWYNGLPE+  L   L C+ A ILGQGNVA+DVARILL+P D L+ TDITE +L  L  
Sbjct: 127 VGWYNGLPENRELAPDLSCDTAVILGQGNVALDVARILLTPPDHLEKTDITEAALGALRQ 186

Query: 194 SRIKSVNLVGRRGALQVAFTIKEFREMTKLPHVQTVFRNEQLCGVHEASATLARPRKRLT 253
           SR+K+V +VGRRG LQVAFTIKE REM +LP  + +       G+ +     ARPRKRL 
Sbjct: 187 SRVKTVWIVGRRGPLQVAFTIKELREMIQLPGTRPMLDPADFLGLQDRIKEAARPRKRLM 246

Query: 254 ELILKTS------NPDESKSNCSKYFRPIFLRSPTEFKLNDNGA-ITGINFA-------- 298
           EL+L+T+           +++ S+ +   F RSP +   + +G    GI  A        
Sbjct: 247 ELLLRTATEKPGVEEAARRASASRAWGLRFFRSPQQVLPSPDGRRAAGIRLAVTRLEGIG 306

Query: 299 -NQQALVTEDTELIPSGIAFRSIGYQSRCVDSDIPFNEKSCT-------VIPKEGVPVVT 350
              +A+ T D E +P G+   SIGY+SR +D  +PF+ K          V+   G+    
Sbjct: 307 EATRAVPTGDVEDLPCGLVLSSIGYKSRPIDPSVPFDPKLGVVPNMEGRVVDVPGLYCSG 366

Query: 351 W-------------------------------------EGWKAIDKEETER--------- 364
           W                                      G   I      R         
Sbjct: 367 WVKRGPTGVITTTMTDSFLTGQILLQDLKAGHLPSGPRPGSAFIKALLDSRGVWPVSFSD 426

Query: 365 -----------GKLKGKPREKIISIEEMISVSGN 387
                      G+  GKPREK++  +EM+ + G+
Sbjct: 427 WEKLDAEEVSRGQASGKPREKLLDPQEMLRLLGH 460
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Length = 456 Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Length = 456 Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Length = 1025 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Length = 671 Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} SCOP: c.3.1.6 PDB: 3fpz_A* Length = 326 Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Length = 344 Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Length = 721 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query388
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 100.0
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 100.0
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 99.97
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 99.95
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 99.94
3oc4_A 452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 99.94
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 99.94
3r9u_A315 Thioredoxin reductase; structural genomics, center 99.94
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 99.94
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 99.94
1zmd_A 474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 99.93
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 99.93
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 99.93
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 99.93
1mo9_A 523 ORF3; nucleotide binding motifs, nucleotide bindin 99.93
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 99.93
2qae_A 468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 99.93
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 99.93
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 99.93
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 99.93
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 99.93
1ebd_A 455 E3BD, dihydrolipoamide dehydrogenase; redox-active 99.93
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 99.93
1dxl_A 470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 99.93
3ef6_A 410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 99.93
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 99.93
2hqm_A 479 GR, grase, glutathione reductase; glutathione redu 99.93
1ges_A 450 Glutathione reductase; oxidoreductase(flavoenzyme) 99.93
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 99.93
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 99.92
2wpf_A 495 Trypanothione reductase; oxidoreductase, trypanoso 99.92
1onf_A 500 GR, grase, glutathione reductase; oxidoreductase; 99.92
2r9z_A 463 Glutathione amide reductase; NAD, FAD, substrate s 99.92
3l8k_A 466 Dihydrolipoyl dehydrogenase; redox-active center, 99.92
3urh_A 491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 99.92
3dk9_A 478 Grase, GR, glutathione reductase; flavoenzyme, nic 99.92
1xdi_A 499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 99.92
2a8x_A 464 Dihydrolipoyl dehydrogenase, E3 component of alpha 99.92
3lad_A 476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.92
1fec_A 490 Trypanothione reductase; redox-active center, oxid 99.92
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 99.92
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 99.92
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 99.92
1v59_A 478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 99.92
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 99.92
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 99.92
2yqu_A 455 2-oxoglutarate dehydrogenase E3 component; lipoami 99.92
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 99.92
1zk7_A 467 HGII, reductase, mercuric reductase; mercuric ION 99.92
2eq6_A 464 Pyruvate dehydrogenase complex, dihydrolipoamide d 99.91
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 99.91
4b1b_A 542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 99.91
1q1r_A 431 Putidaredoxin reductase; glutathione reductase fol 99.91
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 99.91
4dna_A 463 Probable glutathione reductase; structural genomic 99.91
4eqs_A 437 Coenzyme A disulfide reductase; oxidoreductase; HE 99.91
2bc0_A 490 NADH oxidase; flavoprotein, pyridine nucleotide di 99.91
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 99.91
2cdu_A 452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 99.91
1lvl_A 458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.91
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.91
3o0h_A 484 Glutathione reductase; ssgcid, structur genomics, 99.91
3ic9_A 492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 99.91
1ojt_A 482 Surface protein; redox-active center, glycolysis, 99.91
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 99.91
3qfa_A 519 Thioredoxin reductase 1, cytoplasmic; protein-prot 99.91
3dgh_A 483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 99.91
1nhp_A 447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 99.91
3dgz_A 488 Thioredoxin reductase 2; oxidoreductase, rossmann, 99.91
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 99.91
4fk1_A304 Putative thioredoxin reductase; structural genomic 99.91
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 99.9
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 99.9
2gqw_A 408 Ferredoxin reductase; flavoprotein, oxidoreductase 99.9
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 99.9
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 99.9
3cgb_A 480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 99.9
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 99.9
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 99.9
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 99.9
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 99.89
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 99.88
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 99.88
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 99.88
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 99.87
1m6i_A 493 Programmed cell death protein 8; apoptosis, AIF, o 99.87
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 99.86
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 99.83
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 99.83
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 99.81
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 99.8
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 99.78
3h28_A 430 Sulfide-quinone reductase; monotopic membrane prot 99.77
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 99.2
2ywl_A180 Thioredoxin reductase related protein; uncharacter 98.9
2gqf_A401 Hypothetical protein HI0933; structural genomics, 98.89
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 98.85
2ywl_A180 Thioredoxin reductase related protein; uncharacter 98.82
2cul_A232 Glucose-inhibited division protein A-related PROT 98.71
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.7
2bry_A497 NEDD9 interacting protein with calponin homology a 98.68
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.67
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 98.62
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.6
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 98.59
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 98.54
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 98.49
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 98.46
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 98.45
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.41
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.38
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 98.38
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 98.35
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 98.33
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.31
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.3
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 98.29
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.28
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 98.28
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.27
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.27
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 98.27
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.27
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 98.23
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 98.22
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.22
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 98.22
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 98.2
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 98.19
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 98.19
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 98.18
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.17
3atr_A453 Conserved archaeal protein; saturating double bond 98.17
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 98.17
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.16
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 98.15
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 98.15
4gde_A 513 UDP-galactopyranose mutase; flavin adenine dinucle 98.14
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 98.14
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.13
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.13
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 98.11
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 98.1
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 98.1
2bry_A 497 NEDD9 interacting protein with calponin homology a 98.1
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 98.09
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 98.06
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.06
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 98.04
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 98.03
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.03
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 98.02
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 98.02
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 98.02
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 98.01
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.01
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.0
1ojt_A482 Surface protein; redox-active center, glycolysis, 98.0
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 97.99
1rsg_A 516 FMS1 protein; FAD binding motif, oxidoreductase; H 97.99
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 97.99
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 97.99
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 97.99
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 97.98
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 97.98
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 97.98
1s3e_A 520 Amine oxidase [flavin-containing] B; human monoami 97.97
2jae_A 489 L-amino acid oxidase; oxidoreductase, dimerisation 97.95
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 97.95
2cul_A232 Glucose-inhibited division protein A-related PROT 97.95
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 97.94
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 97.93
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 97.92
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 97.9
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 97.9
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 97.89
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 97.88
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 97.88
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 97.87
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 97.87
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 97.87
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 97.87
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 97.87
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 97.86
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 97.85
1fec_A490 Trypanothione reductase; redox-active center, oxid 97.84
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 97.84
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 97.84
1sez_A 504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 97.83
3dme_A369 Conserved exported protein; structural genomics, P 97.83
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 97.83
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 97.83
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 97.82
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 97.82
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 97.82
3h8l_A 409 NADH oxidase; membrane protein, complete form, ros 97.8
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 97.8
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 97.79
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 97.78
4hb9_A412 Similarities with probable monooxygenase; flavin, 97.78
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.78
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 97.78
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 97.77
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 97.76
4dsg_A 484 UDP-galactopyranose mutase; rossmann fold, flavin 97.76
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 97.75
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 97.75
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 97.74
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 97.74
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 97.73
4dna_A463 Probable glutathione reductase; structural genomic 97.72
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 97.72
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 97.72
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 97.72
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 97.71
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 97.7
3vrd_B 401 FCCB subunit, flavocytochrome C flavin subunit; su 97.69
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 97.65
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 97.65
3nlc_A 549 Uncharacterized protein VP0956; FAD-binding protei 97.64
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 97.64
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 97.63
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 97.62
3lzw_A 332 Ferredoxin--NADP reductase 2; ferredoxin reductase 97.6
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 97.59
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 97.58
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 97.57
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 97.55
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 97.55
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 97.55
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 97.55
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 97.54
3fbs_A 297 Oxidoreductase; structural genomics, PSI2, MCSG, p 97.54
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 97.53
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 97.53
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 97.53
3f8d_A 323 Thioredoxin reductase (TRXB-3); redox protein, nuc 97.53
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 97.52
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 97.5
3h28_A 430 Sulfide-quinone reductase; monotopic membrane prot 97.49
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 97.49
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 97.49
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 97.49
4a9w_A 357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 97.49
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 97.48
3v76_A 417 Flavoprotein; structural genomics, PSI-biology, NE 97.47
3cgv_A 397 Geranylgeranyl reductase related protein; NP_39399 97.47
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 97.47
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 97.42
3nix_A 421 Flavoprotein/dehydrogenase; structural genomics, P 97.42
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 97.4
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 97.4
2vou_A 397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 97.39
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 97.39
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 97.37
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 97.36
2x3n_A 399 Probable FAD-dependent monooxygenase; oxidoreducta 97.36
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 97.36
3atr_A 453 Conserved archaeal protein; saturating double bond 97.35
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 97.35
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 97.35
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 97.34
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 97.34
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 97.33
3alj_A 379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 97.33
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 97.33
3r9u_A315 Thioredoxin reductase; structural genomics, center 97.32
2pyx_A 526 Tryptophan halogenase; structural genomics, JOI fo 97.32
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 97.32
4fk1_A 304 Putative thioredoxin reductase; structural genomic 97.31
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 97.31
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 97.31
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 97.3
2i0z_A 447 NAD(FAD)-utilizing dehydrogenases; structural geno 97.29
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 97.29
3oz2_A 397 Digeranylgeranylglycerophospholipid reductase; str 97.29
4gut_A776 Lysine-specific histone demethylase 1B; histone de 97.26
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 97.26
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 97.26
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 97.22
2gqf_A 401 Hypothetical protein HI0933; structural genomics, 97.21
4at0_A 510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 97.19
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 97.18
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 97.17
1y0p_A 571 Fumarate reductase flavoprotein subunit; flavocyto 97.16
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 97.14
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 97.14
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 97.12
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 97.12
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 97.11
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 97.09
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 97.09
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 97.06
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 97.06
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 97.06
3rp8_A 407 Flavoprotein monooxygenase; FAD-binding protein, o 97.05
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 97.05
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 97.04
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 97.03
3dme_A369 Conserved exported protein; structural genomics, P 96.99
1qo8_A 566 Flavocytochrome C3 fumarate reductase; oxidoreduct 96.99
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 96.99
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 96.96
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 96.95
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 96.95
2xdo_A 398 TETX2 protein; tetracycline degradation, tigecycli 96.94
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 96.94
1d4d_A 572 Flavocytochrome C fumarate reductase; oxidoreducta 96.93
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 96.91
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 96.9
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 96.89
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 96.87
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 96.86
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 96.85
3dje_A 438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 96.84
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 96.82
2gag_B 405 Heterotetrameric sarcosine oxidase beta-subunit; f 96.81
1yvv_A 336 Amine oxidase, flavin-containing; oxidoreductase, 96.8
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 96.79
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 96.76
1kdg_A 546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 96.76
1k0i_A 394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 96.76
3t37_A 526 Probable dehydrogenase; BET alpha beta fold, ADP b 96.72
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 96.72
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 96.71
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 96.7
4hb9_A 412 Similarities with probable monooxygenase; flavin, 96.69
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 96.69
4g65_A461 TRK system potassium uptake protein TRKA; structur 96.65
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 96.61
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 96.61
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 96.6
1y56_B 382 Sarcosine oxidase; dehydrogenase, protein-protein 96.56
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 96.56
2jbv_A 546 Choline oxidase; alcohol oxidation, flavoenyzme ox 96.54
3c96_A 410 Flavin-containing monooxygenase; FAD, oxidoreducta 96.54
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 96.53
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 96.51
2uzz_A 372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 96.44
3nyc_A 381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 96.43
3qj4_A 342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 96.42
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 96.41
3qvp_A 583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 96.34
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 96.26
2pyx_A 526 Tryptophan halogenase; structural genomics, JOI fo 96.23
1n4w_A 504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 96.18
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 96.18
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 96.17
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 96.17
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 96.16
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 96.15
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 96.15
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 96.14
2gf3_A 389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 96.07
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 96.05
1coy_A 507 Cholesterol oxidase; oxidoreductase(oxygen recepto 96.01
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 96.0
2e5v_A 472 L-aspartate oxidase; archaea, oxidoreductase; HET: 95.98
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 95.93
4b63_A 501 L-ornithine N5 monooxygenase; oxidoreductase, side 95.9
1ju2_A 536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 95.86
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 95.83
3fim_B 566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 95.74
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 95.7
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 95.66
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 95.61
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 95.47
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 95.45
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 95.4
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 95.33
1id1_A153 Putative potassium channel protein; RCK domain, E. 95.31
1gpe_A 587 Protein (glucose oxidase); oxidoreductase(flavopro 95.3
3c4n_A 405 Uncharacterized protein DR_0571; alpha-beta protei 95.12
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 95.07
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 95.05
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 94.93
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 94.93
1lss_A140 TRK system potassium uptake protein TRKA homolog; 94.91
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 94.78
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 94.36
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 94.09
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 94.02
3kkj_A 336 Amine oxidase, flavin-containing; oxidoreductase, 93.95
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 93.95
3c85_A183 Putative glutathione-regulated potassium-efflux S 93.84
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 93.71
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 93.64
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 93.57
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 93.07
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 93.04
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 93.04
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 92.6
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 92.5
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 92.4
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 92.28
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 92.04
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 91.84
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 91.57
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 91.53
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 91.5
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 91.35
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 91.35
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 91.32
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 91.31
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 91.24
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 91.21
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 91.13
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 91.04
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 90.92
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 90.84
4hv4_A 494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 90.8
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 90.73
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 90.58
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 90.53
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 90.37
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 90.33
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 90.31
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 90.3
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 90.26
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 90.2
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 90.08
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 90.05
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 89.93
4gde_A 513 UDP-galactopyranose mutase; flavin adenine dinucle 89.81
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 89.72
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 89.56
3orq_A377 N5-carboxyaminoimidazole ribonucleotide synthetas; 89.51
3q2o_A389 Phosphoribosylaminoimidazole carboxylase, ATPase; 89.48
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 89.39
3nks_A 477 Protoporphyrinogen oxidase; FAD containing protein 89.37
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 89.3
3qha_A296 Putative oxidoreductase; seattle structural genomi 89.25
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 89.22
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 89.14
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 89.13
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 89.11
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 89.09
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 89.04
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 89.03
3tl2_A315 Malate dehydrogenase; center for structural genomi 89.03
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 89.02
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 89.02
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 88.96
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 88.96
3nrn_A 421 Uncharacterized protein PF1083; alpha-beta protein 88.8
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 88.76
2iid_A 498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 88.73
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 88.69
2rir_A300 Dipicolinate synthase, A chain; structural genomic 88.61
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 88.58
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 88.57
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 88.43
3ka7_A 425 Oxidoreductase; structural genomics, PSI-2, protei 88.41
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 88.36
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 88.29
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 88.28
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 88.13
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 88.11
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 88.09
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 88.01
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 87.92
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 87.75
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 87.7
3l6d_A306 Putative oxidoreductase; structural genomics, prot 87.52
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 87.43
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 87.4
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 87.39
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 87.37
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 87.37
3ihm_A 430 Styrene monooxygenase A; rossman fold, anti-parall 87.34
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 87.32
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 87.31
3c4a_A 381 Probable tryptophan hydroxylase VIOD; alpha-beta p 87.3
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 87.29
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 87.29
2b9w_A 424 Putative aminooxidase; isomerase, conjugated linol 87.27
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 87.23
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 87.22
3nkl_A141 UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo 87.1
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 87.07
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 87.02
3ius_A286 Uncharacterized conserved protein; APC63810, silic 87.02
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 86.99
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 86.91
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 86.82
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 86.79
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 86.73
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 86.7
1rsg_A 516 FMS1 protein; FAD binding motif, oxidoreductase; H 86.7
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 86.66
3g5s_A 443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 86.65
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 86.64
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 86.63
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 86.63
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 86.62
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 86.58
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 86.57
3k5i_A403 Phosphoribosyl-aminoimidazole carboxylase; purine 86.46
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 86.41
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 86.41
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
Probab=100.00  E-value=3.2e-50  Score=396.56  Aligned_cols=375  Identities=51%  Similarity=0.877  Sum_probs=300.5

Q ss_pred             CCCCcEEEECccHHHHHHHHHHHhhCCCCcEEEEcCCCCCCCceeeCCCCCCcchhHHHHHHHHhhcCCCcEEEceEEEE
Q psy4525          11 QLKPNVCIVGSGPAGFYCAQQILKLLPQSTVDIYEKLPVPFGLVRYGVAPDHPEVKNVINTFTKTGDNPRVNFYGNICLG   90 (388)
Q Consensus        11 ~~~~~vvIIGaG~aGl~aA~~l~~~~~g~~v~lie~~~~~gg~~~~g~~p~~~~~~~~~~~~~~~~~~~~i~~~~~~~v~   90 (388)
                      ..+++|+||||||||+++|..|++..++.+|+|||+.+.+||.|++++.|.++..+++..++.+++++.+++++.++.++
T Consensus         4 ~~~~~vvIIG~G~aGl~aA~~l~~~g~~~~V~vie~~~~~gg~~~~g~~p~~~~~~~~~~~~~~~~~~~gv~~~~~~~v~   83 (460)
T 1cjc_A            4 EQTPQICVVGSGPAGFYTAQHLLKHHSRAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFTQTARSDRCAFYGNVEVG   83 (460)
T ss_dssp             --CCEEEEECCSHHHHHHHHHHHHHCSSCEEEEECSSSSSCTHHHHTSCTTCGGGGGHHHHHHHHHTSTTEEEEBSCCBT
T ss_pred             CCCceEEEECcCHHHHHHHHHHHhcCCCCCEEEEeCCCcCCceeecccCCCCccHHHHHHHHHHHHHhCCcEEEeeeEEe
Confidence            34689999999999999999999942339999999999999999999988888888888888899999999999887775


Q ss_pred             EEeeecccccccCEEEEeeCCCCCCCCCCCCCCCCCeeecccccccccCCCCccccCcCCCCCeEEEEcCChHHHHHHHH
Q psy4525          91 QDISLGDLTNAYHAVVLTYGADNDKKLNIPGEDGKNIISARSFVGWYNGLPEDASLDLSLDCEEATILGQGNVAMDVARI  170 (388)
Q Consensus        91 ~~~~~~~~~~~yd~lvlAtG~~~~~~~~i~g~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~vvVIGgG~sg~e~a~~  170 (388)
                      .+++..+....||+||+|||+.+++.+++||.+.++++++.++..+++.++++........+++|+|||+|++|+|+|..
T Consensus        84 ~~V~~~~~~~~~d~lVlAtGs~~~~~~~ipG~~~~gv~~~~~~~~~~~~~~d~~~~~~~~~~~~vvVIGgG~~g~e~A~~  163 (460)
T 1cjc_A           84 RDVTVQELQDAYHAVVLSYGAEDHQALDIPGEELPGVFSARAFVGWYNGLPENRELAPDLSCDTAVILGQGNVALDVARI  163 (460)
T ss_dssp             TTBCHHHHHHHSSEEEECCCCCEECCCCCTTTTSTTEEEHHHHHHHHTTCGGGTTCCCCTTSSEEEEESCSHHHHHHHHH
T ss_pred             eEEEeccceEEcCEEEEecCcCCCCCCCCCCCCCCcEEEHHHHHHHhhcCccccccccCCCCCEEEEECCCHHHHHHHHH
Confidence            44555444458999999999986567899999889999999999888887766543323368999999999999999999


Q ss_pred             hccCCcccccccCchhHHHhhhcCCCcEEEEEeecCcccccCCHHHHHHHhcCCCceEEecccccccchhhhccccchhh
Q psy4525         171 LLSPVDQLKSTDITEHSLEKLSTSRIKSVNLVGRRGALQVAFTIKEFREMTKLPHVQTVFRNEQLCGVHEASATLARPRK  250 (388)
Q Consensus       171 L~~~~~~~~~~~~~~~~~~~~~~~~~~~V~~i~r~~~~~~~~~~~el~~l~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~  250 (388)
                      |+...++|.+|||+.++++.+++.+.++|+++.|+++++.+|+++|+++|.++|.++..+++++++........+++..+
T Consensus       164 L~~~~~~l~~tdi~~~a~~~l~~~g~~~V~lv~r~~~~~~~ft~~el~~l~~lp~~~~~~~~~~~~~~~~~~~~~~~~~~  243 (460)
T 1cjc_A          164 LLTPPDHLEKTDITEAALGALRQSRVKTVWIVGRRGPLQVAFTIKELREMIQLPGTRPMLDPADFLGLQDRIKEAARPRK  243 (460)
T ss_dssp             HHSCGGGGTTSCCCHHHHHHHHTCCCCEEEEECSSCGGGCCCCHHHHHHHHTCTTEEEECCGGGGTTHHHHTTTSCHHHH
T ss_pred             HhhchhhhccccccHHHHHHHhhCCCcEEEEEEcCChHhhccCHHHHHHhhcCCCceeEechhhhcchhhhhhhccHHHH
Confidence            99999999999999999999999998899999999999999999999999999998888777765432222223455556


Q ss_pred             HHHHHHHhhCCCC----C--CCCCCceeEEEEecCcceeeeeCCCC-ceeEEEEccCc---------cccCCceeEEecc
Q psy4525         251 RLTELILKTSNPD----E--SKSNCSKYFRPIFLRSPTEFKLNDNG-AITGINFANQQ---------ALVTEDTELIPSG  314 (388)
Q Consensus       251 ~~~~~~~~~~~~~----~--~~~~~~~gv~~~~~~~~~~i~~~~~~-~v~~v~~~~~~---------~~~~~~~~~l~~D  314 (388)
                      ++.+.+.+.+...    .  ......+||.++++..++++..++++ ++.++++....         .+.+++.++++||
T Consensus       244 ~~~~~l~~~~~~~~~~~~~~~~~~~~~gv~~~~~~~~~~i~~~~~~~~v~~v~~~~~~l~~~~~~~~~~~~g~~~~i~~d  323 (460)
T 1cjc_A          244 RLMELLLRTATEKPGVEEAARRASASRAWGLRFFRSPQQVLPSPDGRRAAGIRLAVTRLEGIGEATRAVPTGDVEDLPCG  323 (460)
T ss_dssp             HHHHHHHHHHHSCCCHHHHHHHHTCSEEEEEECSEEEEEEEECTTSSSEEEEEEEEEEEESSGGGCEEEEEEEEEEEECS
T ss_pred             HHHHHHHHHHHhccccccccCCCCCCceEEEECCCChheEEcCCCCceEEEEEEEEEEEccccCCCcccCCCceEEEEcC
Confidence            6666555443210    0  00012489999999999999875435 77777765311         1113445789999


Q ss_pred             eEEEccccCCccCCCCC-cccCCCccc-------------------------------------------------c---
Q psy4525         315 IAFRSIGYQSRCVDSDI-PFNEKSCTV-------------------------------------------------I---  341 (388)
Q Consensus       315 ~Vi~a~G~~p~~~~~~l-~~~~~~gi~-------------------------------------------------l---  341 (388)
                      +||+|+|++|+++ .++ ++++++|++                                                 +   
T Consensus       324 ~Vi~a~G~~p~~l-~gl~~~d~~g~i~vn~~~rt~~~p~vya~Gd~~~g~~~~i~~a~~~g~~aa~~i~~~l~~~~~~~~  402 (460)
T 1cjc_A          324 LVLSSIGYKSRPI-DPSVPFDPKLGVVPNMEGRVVDVPGLYCSGWVKRGPTGVITTTMTDSFLTGQILLQDLKAGHLPSG  402 (460)
T ss_dssp             EEEECCCEECCCC-CTTSCCBTTTTBCCEETTEETTCTTEEECTHHHHCTTCCHHHHHHHHHHHHHHHHHHHHHTCSCCS
T ss_pred             EEEECCCCCCCCC-CCCcccccCCCeeECCCCcCcCCCCEEEEEeCCcCCCccHHHHHHHHHHHHHHHHHHHHhCcCCCC
Confidence            9999999999986 478 888666654                                                 1   


Q ss_pred             ------------CCCCCCeecchhhHHhHHHHHHccccCCCCccccCCHHHHHhhhc
Q psy4525         342 ------------PKEGVPVVTWEGWKAIDKEETERGKLKGKPREKIISIEEMISVSG  386 (388)
Q Consensus       342 ------------~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~~  386 (388)
                                  ..++..+++|++|++||++|+++|+..||+|.||++++|||++++
T Consensus       403 ~~~~~~~~~~~l~~~g~~~~~~~~w~~id~~e~~~g~~~g~~r~k~~~~~~m~~~~~  459 (460)
T 1cjc_A          403 PRPGSAFIKALLDSRGVWPVSFSDWEKLDAEEVSRGQASGKPREKLLDPQEMLRLLG  459 (460)
T ss_dssp             CCCTHHHHHHHHHHHTCCCBCHHHHHHHHHHHHHHHHHHTSSCCCCCCHHHHHHHTT
T ss_pred             CCCchhHHHHHHHHcCCCeecHHHHHHHHHHHHHhhhhcCCCceeeCCHHHHHHHhc
Confidence                        123556789999999999999999999999999999999999876
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 388
d1cjca1225 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitoc 3e-47
d1lqta1216 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA 3e-45
d1cjca2230 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase 8e-26
d1cjca2230 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase 3e-15
d1lqta2239 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reduct 3e-25
d1lqta2239 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reduct 9e-14
d1ps9a3179 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA redu 4e-10
d1gtea4196 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine de 1e-08
d2gjca1311 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th 1e-05
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 3e-05
d2gv8a1335 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monox 4e-05
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 7e-05
d1nhpa1198 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enter 0.001
d1djqa3233 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehyd 0.001
d2voua1265 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr 0.003
d1seza1373 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox 0.004
d2ivda1347 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox 0.004
d3c96a1288 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps 0.004
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Length = 225 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: C-terminal domain of adrenodoxin reductase-like
domain: Adrenodoxin reductase of mitochondrial p450 systems
species: Cow (Bos taurus) [TaxId: 9913]

 Score =  158 bits (400), Expect = 3e-47
 Identities = 100/224 (44%), Positives = 134/224 (59%), Gaps = 16/224 (7%)

Query: 115 KKLNIPGEDGKNIISARSFVGWYNGLPEDASLDLSLDCEEATILGQGNVAMDVARILLSP 174
           + L+IPGE+   + SAR+FVGWYNGLPE+  L   L C+ A ILGQGNVA+DVARILL+P
Sbjct: 2   QALDIPGEELPGVFSARAFVGWYNGLPENRELAPDLSCDTAVILGQGNVALDVARILLTP 61

Query: 175 VDQLKSTDITEHSLEKLSTSRIKSVNLVGRRGALQVAFTIKEFREMTKLPHVQTVFRNEQ 234
            D L+ TDITE +L  L  SR+K+V +VGRRG LQVAFTIKE REM +LP  + +     
Sbjct: 62  PDHLEKTDITEAALGALRQSRVKTVWIVGRRGPLQVAFTIKELREMIQLPGTRPMLDPAD 121

Query: 235 LCGVHEASATLARPRKRLTELILKTS------NPDESKSNCSKYFRPIFLRSPTEFKLND 288
             G+ +     ARPRKRL EL+L+T+           +++ S+ +   F RSP +   + 
Sbjct: 122 FLGLQDRIKEAARPRKRLMELLLRTATEKPGVEEAARRASASRAWGLRFFRSPQQVLPSP 181

Query: 289 NG-AITGINF---------ANQQALVTEDTELIPSGIAFRSIGY 322
           +G    GI              +A+ T D E +P G+   SIGY
Sbjct: 182 DGRRAAGIRLAVTRLEGIGEATRAVPTGDVEDLPCGLVLSSIGY 225
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 216 Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Length = 230 Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Length = 230 Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 239 Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 239 Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Length = 196 Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 335 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 198 Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Length = 233 Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query388
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 99.95
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 99.94
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 99.89
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 99.89
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 99.78
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 99.72
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.52
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.5
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 99.49
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 99.48
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.47
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.46
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.45
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 99.44
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.43
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 99.42
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 99.42
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.41
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.38
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.38
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.37
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 99.37
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 99.36
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.36
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.35
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 99.34
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 99.34
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 99.33
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 99.3
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 99.28
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.27
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.24
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 99.24
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 99.18
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.17
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.14
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.12
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.11
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.05
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.02
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 99.02
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.0
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.98
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 98.96
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.96
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.95
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 98.94
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 98.93
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 98.91
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 98.91
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.91
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.9
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.9
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 98.89
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 98.89
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 98.88
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.84
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.84
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.83
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.83
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.82
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.82
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.81
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.8
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.8
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 98.79
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 98.76
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.71
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.68
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 98.68
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.68
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.68
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 98.67
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 98.65
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.64
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.63
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 98.62
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 98.62
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.61
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.6
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 98.6
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 98.59
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 98.59
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.58
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.58
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 98.57
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.55
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.55
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 98.54
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.53
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.53
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 98.52
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.49
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 98.49
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 98.44
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.44
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 98.42
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.42
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.39
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.38
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.33
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 98.26
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 98.25
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 98.23
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.1
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 98.09
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 98.05
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 98.02
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.99
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 97.97
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 97.96
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 97.95
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 97.88
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 97.87
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 97.86
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 97.86
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 97.84
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 97.84
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 97.78
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 97.72
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 97.71
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.7
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 97.7
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 97.62
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 97.59
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 97.58
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.56
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.55
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 97.55
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 97.5
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 97.46
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 97.37
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 97.33
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 97.32
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 97.3
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 97.26
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.23
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 97.21
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 97.2
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 97.15
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 97.15
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 97.13
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 97.11
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.04
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 96.91
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 96.91
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 96.9
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 96.88
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 96.84
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 96.81
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 96.76
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 96.73
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 96.72
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 96.7
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 96.69
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 96.68
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.64
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 96.63
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 96.57
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.42
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 96.4
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 96.39
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 96.38
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 96.03
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 95.98
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 95.96
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 95.95
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 95.83
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 95.76
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 95.74
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 95.73
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 95.72
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.69
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 95.62
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 95.6
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 95.59
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.55
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 95.19
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 95.17
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 95.06
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 94.85
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 94.79
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 94.6
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 94.52
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 94.49
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 94.45
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 94.42
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 94.26
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 94.09
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 94.0
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 93.9
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 93.89
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 93.66
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 93.65
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 93.6
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 93.42
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 93.36
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 93.26
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 93.26
d1vg0a1 491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 93.09
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 92.99
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 92.97
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 92.94
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 92.91
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 92.84
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 92.8
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 92.63
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 92.48
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 92.46
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 92.4
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 92.39
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 92.23
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 92.22
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 92.13
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 91.91
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 91.89
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 91.68
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 91.65
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 91.63
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 91.49
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 91.41
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 91.34
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 91.3
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 91.28
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 91.22
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 91.14
d1id1a_153 Rck domain from putative potassium channel Kch {Es 91.14
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 91.01
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 90.95
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 90.68
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 90.42
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 90.16
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 90.06
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 90.04
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 89.94
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 89.9
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 89.82
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 89.79
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 89.76
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 89.41
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 89.4
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 89.1
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 89.0
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 88.97
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 88.86
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 88.76
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 88.73
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 88.68
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 88.13
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 87.75
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 87.48
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 87.41
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 86.96
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 86.83
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 86.21
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 86.19
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 86.05
d2gmha1 380 Electron transfer flavoprotein-ubiquinone oxidored 86.01
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 85.84
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 85.64
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 85.62
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 85.56
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 85.43
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 85.32
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 85.31
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 85.13
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 84.96
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 84.9
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 84.16
d2f5va1 379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 83.89
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 83.78
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 83.76
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 83.17
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 83.15
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 83.11
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 82.93
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 82.92
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 82.57
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 82.22
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 81.75
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 81.73
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 81.41
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 81.19
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 80.84
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 80.79
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 80.68
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 80.61
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 80.46
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: C-terminal domain of adrenodoxin reductase-like
domain: Adrenodoxin reductase of mitochondrial p450 systems
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.95  E-value=2e-27  Score=209.50  Aligned_cols=208  Identities=49%  Similarity=0.809  Sum_probs=178.2

Q ss_pred             CCCCCCCCCCCCeeecccccccccCCCCccccCcCCCCCeEEEEcCChHHHHHHHHhccCCcccccccCchhHHHhhhcC
Q psy4525         115 KKLNIPGEDGKNIISARSFVGWYNGLPEDASLDLSLDCEEATILGQGNVAMDVARILLSPVDQLKSTDITEHSLEKLSTS  194 (388)
Q Consensus       115 ~~~~i~g~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~vvVIGgG~sg~e~a~~L~~~~~~~~~~~~~~~~~~~~~~~  194 (388)
                      |.++|||.+++||+.+.+|+.||+++++.........+++|+|||+|++|+|+|+.+.++.++|.+|||+.+.++.+...
T Consensus         2 R~L~IPGedl~gV~~A~dfl~~~N~~p~~~~~~~~~~gk~VvVIGgGNVAlD~aR~l~r~~~~l~~tdi~~~~l~~l~~~   81 (225)
T d1cjca1           2 QALDIPGEELPGVFSARAFVGWYNGLPENRELAPDLSCDTAVILGQGNVALDVARILLTPPDHLEKTDITEAALGALRQS   81 (225)
T ss_dssp             CCCCCTTTTSTTEEEHHHHHHHHTTCGGGTTCCCCTTSSEEEEESCSHHHHHHHHHHHSCGGGGTTSCCCHHHHHHHHTC
T ss_pred             CCCCCCCCCCCCcEeHHHHHHHHhCCccccccCccccCceEEEECCchhHHHHHHHHhcCHHhhcCCCCcHHHHHHHhcc
Confidence            57899999999999999999999999888766666779999999999999999999999999999999999999999999


Q ss_pred             CCcEEEEEeecCcccccCCHHHHHHHhcCCCceEEecccccccchhhhccccchhhHHHHHHHhhCCCCCC------CCC
Q psy4525         195 RIKSVNLVGRRGALQVAFTIKEFREMTKLPHVQTVFRNEQLCGVHEASATLARPRKRLTELILKTSNPDES------KSN  268 (388)
Q Consensus       195 ~~~~V~~i~r~~~~~~~~~~~el~~l~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~------~~~  268 (388)
                      ++++|++++|+++.+++|+++|++++.+++.+...+++.++.........+.+..++....+.+.......      ...
T Consensus        82 g~~~V~iv~RRg~~~~~ft~~Elre~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  161 (225)
T d1cjca1          82 RVKTVWIVGRRGPLQVAFTIKELREMIQLPGTRPMLDPADFLGLQDRIKEAARPRKRLMELLLRTATEKPGVEEAARRAS  161 (225)
T ss_dssp             CCCEEEEECSSCGGGCCCCHHHHHHHHTCTTEEEECCGGGGTTHHHHTTTSCHHHHHHHHHHHHHHHSCCCHHHHHHHHT
T ss_pred             CCCeEEEEEEcChHhCCCCchhhhcccccCCCcceechhhhccchhhhhhhhhHHHHHHHHHHHHHHhcccccccccccc
Confidence            99999999999999999999999999999999999998888776666666777777777766555433221      124


Q ss_pred             CceeEEEEecCcceeeeeCCCC-ceeEEEEcc---------CccccCCceeEEecceEEEcccc
Q psy4525         269 CSKYFRPIFLRSPTEFKLNDNG-AITGINFAN---------QQALVTEDTELIPSGIAFRSIGY  322 (388)
Q Consensus       269 ~~~gv~~~~~~~~~~i~~~~~~-~v~~v~~~~---------~~~~~~~~~~~l~~D~Vi~a~G~  322 (388)
                      ..+++.++|...++++.+++++ ++.++++..         +..+.+++..+++||+||.|+||
T Consensus       162 ~~~~i~~~f~~~p~~i~~~~~g~~v~~v~~~~~~~~~~~~~~~~~~tg~~~~ipadlVi~AiGf  225 (225)
T d1cjca1         162 ASRAWGLRFFRSPQQVLPSPDGRRAAGIRLAVTRLEGIGEATRAVPTGDVEDLPCGLVLSSIGY  225 (225)
T ss_dssp             CSEEEEEECSEEEEEEEECTTSSSEEEEEEEEEEEESSGGGCEEEEEEEEEEEECSEEEECCCE
T ss_pred             cccceEEEeecccccccccCCCCeEEEEEEEEeEECCCCCCCcccCCCcEEEEECCEEEECCCC
Confidence            4689999999999999987654 788887762         22345677788999999999997
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure