Psyllid ID: psy4651
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 721 | ||||||
| 242006231 | 1978 | myosin-9, putative [Pediculus humanus co | 0.682 | 0.248 | 0.721 | 0.0 | |
| 312370898 | 755 | hypothetical protein AND_22909 [Anophele | 0.798 | 0.762 | 0.633 | 0.0 | |
| 2546939 | 1201 | muscle myosin heavy chain [Drosophila me | 0.758 | 0.455 | 0.616 | 1e-167 | |
| 2546938 | 1201 | muscle myosin heavy chain [Drosophila me | 0.758 | 0.455 | 0.616 | 1e-167 | |
| 2546936 | 1175 | muscle myosin heavy chain [Drosophila me | 0.748 | 0.459 | 0.620 | 1e-167 | |
| 2546937 | 1175 | muscle myosin heavy chain [Drosophila me | 0.748 | 0.459 | 0.620 | 1e-167 | |
| 195579654 | 749 | GD24081 [Drosophila simulans] gi|1941916 | 0.758 | 0.730 | 0.613 | 1e-166 | |
| 289742061 | 761 | myosin heavy chain [Glossina morsitans m | 0.758 | 0.718 | 0.615 | 1e-166 | |
| 307190724 | 1141 | Myosin heavy chain, muscle [Camponotus f | 0.750 | 0.474 | 0.617 | 1e-165 | |
| 234204034 | 918 | myosin heavy chain variant C [Bombyx man | 0.748 | 0.588 | 0.613 | 1e-158 |
| >gi|242006231|ref|XP_002423957.1| myosin-9, putative [Pediculus humanus corporis] gi|212507227|gb|EEB11219.1| myosin-9, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 662 bits (1708), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 412/571 (72%), Positives = 441/571 (77%), Gaps = 79/571 (13%)
Query: 150 RRKLQARLAEAEETIESLNQKVIALEKTKQRLATEVEDLQLEVDRANAIANAAEKKAKAI 209
+RKLQARLAEAEETIESLNQKVIALEKTKQRLATEVEDLQLEVDRA AIANAAEKK KA
Sbjct: 1390 KRKLQARLAEAEETIESLNQKVIALEKTKQRLATEVEDLQLEVDRATAIANAAEKKQKAF 1449
Query: 210 DKIIGEWKLKVDDLAAELDASQKECRNYSTELFRLKGAYEEAQEQLEAVRRENKNLADEV 269
DKIIGEWKLKVDDLAAELDASQKECRNYSTELFRLK AYEE QEQLEAVRRENKNLADEV
Sbjct: 1450 DKIIGEWKLKVDDLAAELDASQKECRNYSTELFRLKNAYEEGQEQLEAVRRENKNLADEV 1509
Query: 270 KDLLDQIGEGGRNIHEVEKARKRLEVEKDELQAALEEAEAALEQEENKVLRAQLELSQAN 329
KDLLDQIGEGGRNIHE+EKARKRLEVEKDELQAALEEAEAALEQEENKVLRAQLELSQ
Sbjct: 1510 KDLLDQIGEGGRNIHEIEKARKRLEVEKDELQAALEEAEAALEQEENKVLRAQLELSQVR 1569
Query: 330 AEAQKNI-----------KRYQQQLKDVQTALEEEQRARDDAREQLGIVE---------- 368
E + I K +Q+ L +Q +LE E + R +A +E
Sbjct: 1570 QEIDRRIQEKEEEFENTRKNHQRALDSMQASLEAEAKGRAEALRMKKKLEADINELEIAL 1629
Query: 369 ---RRANA--------LQNELEESRQLLEQADRGR------------------------- 392
+ANA Q +L++ + LE+ R R
Sbjct: 1630 DHANKANAEAQKNIKRYQQQLKDVQTALEEEQRARDDAREQLGIAERRANALQNELEESR 1689
Query: 393 ----------RQAETELADAHEQLNELSAQATSISAAKRKLEGELQTLHSDLDELLNEAK 442
RQAE EL+DAHEQLNELSAQ S+SAAKRKLE ELQTLHSDLDELLNEAK
Sbjct: 1690 TLLEQADRGRRQAEQELSDAHEQLNELSAQNASMSAAKRKLESELQTLHSDLDELLNEAK 1749
Query: 443 NSEEKAKKAMVDAARLADELRAEQDHAQTQEKLRKALETQIKELQIRLDEAENNALKGGK 502
NSEEKAKKAMVDAARLADELRAEQDHAQTQEKLRKALE QIK+LQ+RLDEAE NALKGGK
Sbjct: 1750 NSEEKAKKAMVDAARLADELRAEQDHAQTQEKLRKALEQQIKDLQVRLDEAEANALKGGK 1809
Query: 503 KAIQKLEQRVRELENELDGEQRRHADAQKNLRKTERRIKELSFQAEEDRKNHERMQDLVD 562
KAIQKLEQRVRELENELDGEQRRHADAQKNLRKTERRIKELSFQAEEDRKNHERMQDLVD
Sbjct: 1810 KAIQKLEQRVRELENELDGEQRRHADAQKNLRKTERRIKELSFQAEEDRKNHERMQDLVD 1869
Query: 563 KLQQKIKTYKRQIEEAEEIAALNLAKFRKAQQELEEAEERADLAEQAVSKIRTKGGSVAR 622
KLQQKIKTYKRQIEEAEEIAALNLAKFRKAQQELEEAEERAD AEQA++K R KG +
Sbjct: 1870 KLQQKIKTYKRQIEEAEEIAALNLAKFRKAQQELEEAEERADFAEQAIAKFRQKGRA--- 1926
Query: 623 GSSPLKLVCSVTFCRQITVQITSKLVLHLFL 653
GS+P L +V+ SKLV++L+
Sbjct: 1927 GSAPRALSPAVS---------VSKLVINLYF 1948
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|312370898|gb|EFR19201.1| hypothetical protein AND_22909 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|2546939|emb|CAA37311.1| muscle myosin heavy chain [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|2546938|emb|CAA37310.1| muscle myosin heavy chain [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|2546936|emb|CAA37308.1| muscle myosin heavy chain [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|2546937|emb|CAA37309.1| muscle myosin heavy chain [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195579654|ref|XP_002079676.1| GD24081 [Drosophila simulans] gi|194191685|gb|EDX05261.1| GD24081 [Drosophila simulans] | Back alignment and taxonomy information |
|---|
| >gi|289742061|gb|ADD19778.1| myosin heavy chain [Glossina morsitans morsitans] | Back alignment and taxonomy information |
|---|
| >gi|307190724|gb|EFN74639.1| Myosin heavy chain, muscle [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|234204034|gb|ACQ91271.1| myosin heavy chain variant C [Bombyx mandarina] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 721 | ||||||
| FB|FBgn0264695 | 1962 | Mhc "Myosin heavy chain" [Dros | 0.553 | 0.203 | 0.602 | 1.4e-128 | |
| WB|WBGene00006789 | 1966 | unc-54 [Caenorhabditis elegans | 0.545 | 0.199 | 0.412 | 2.8e-76 | |
| UNIPROTKB|Q90WH5 | 891 | LOC429272 "Atrial myosin heacy | 0.650 | 0.526 | 0.336 | 6.7e-75 | |
| UNIPROTKB|F1NPC8 | 767 | LOC429272 "Uncharacterized pro | 0.650 | 0.611 | 0.336 | 6.7e-75 | |
| ZFIN|ZDB-GENE-060531-50 | 1933 | myha "myosin, heavy chain a" [ | 0.642 | 0.239 | 0.338 | 1.3e-73 | |
| ZFIN|ZDB-GENE-070705-73 | 1937 | myhz1.2 "myosin, heavy polypep | 0.654 | 0.243 | 0.330 | 2.2e-73 | |
| ZFIN|ZDB-GENE-070705-74 | 1937 | myhz1.3 "myosin, heavy polypep | 0.654 | 0.243 | 0.330 | 2.8e-73 | |
| ZFIN|ZDB-GENE-030131-5336 | 1936 | wu:fd14a01 "wu:fd14a01" [Danio | 0.644 | 0.240 | 0.331 | 9.6e-73 | |
| ZFIN|ZDB-GENE-020604-1 | 1935 | myhz2 "myosin, heavy polypepti | 0.642 | 0.239 | 0.336 | 9.6e-73 | |
| UNIPROTKB|K7GMH0 | 1130 | K7GMH0 "Uncharacterized protei | 0.647 | 0.413 | 0.341 | 1.9e-72 |
| FB|FBgn0264695 Mhc "Myosin heavy chain" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 1074 (383.1 bits), Expect = 1.4e-128, Sum P(2) = 1.4e-128
Identities = 253/420 (60%), Positives = 276/420 (65%)
Query: 231 QKECRNYSTELFRLKGAYEEAQEQLEAVRRENKNLADEVKDLLDQIG-EGGRNIHEVEK- 288
+K + E L+ A EEA+ LE + ENK L +++ L Q+ E R I E E+
Sbjct: 1526 EKARKRLEAEKDELQAALEEAEAALE--QEENKVLRAQLE--LSQVRQEIDRRIQEKEEE 1581
Query: 289 ---ARKRLEVEKDXXXXXXXXXXXXXXXXXN--KVLRA---QLELS-----QANAEAQKN 335
RK + D K L A +LE++ +ANAEAQKN
Sbjct: 1582 FENTRKNHQRALDSMQASLEAEAKGKAEALRMKKKLEADINELEIALDHANKANAEAQKN 1641
Query: 336 IKRYQQQLKDVQTALXXXXXXXXXXXXXLGIVERRANALQNELEESRQLLEQADRGRRQA 395
IKRYQQQLKD+QTAL LGI ERRANALQNELEESR LLEQADRGRRQA
Sbjct: 1642 IKRYQQQLKDIQTALEEEQRARDDAREQLGISERRANALQNELEESRTLLEQADRGRRQA 1701
Query: 396 ETELADAHEQLNELSAQATSISAAKRKLEGELQTLHSDLDELLXXXXXXXXXXXXXMVDA 455
E ELADAHEQLNE+SAQ SISAAKRKLE ELQTLHSDLDELL MVDA
Sbjct: 1702 EQELADAHEQLNEVSAQNASISAAKRKLESELQTLHSDLDELLNEAKNSEEKAKKAMVDA 1761
Query: 456 ARLADELRAEQDHAQTQEKLRKALETQIKELQIRLDEAENNALKGGKKAIQKLEQRVREL 515
ARLADELRAEQDHAQTQEKLRKALE QIKELQ+RLDEAE NALKGGKKAIQKLEQRVREL
Sbjct: 1762 ARLADELRAEQDHAQTQEKLRKALEQQIKELQVRLDEAEANALKGGKKAIQKLEQRVREL 1821
Query: 516 ENELDGEQRRHADAQKNLRKTERRIKELSFQAEEDRKNHERMQDLVDKLQQKIKTYKRQX 575
ENELDGEQRRHADAQKNLRK+ERR+KELSFQ+EEDRKNHERMQDLVDKLQQKIKTYKRQ
Sbjct: 1822 ENELDGEQRRHADAQKNLRKSERRVKELSFQSEEDRKNHERMQDLVDKLQQKIKTYKRQI 1881
Query: 576 XXXXXXXXXXXXKFRKXXXXXXXXXXXXXXXXXXVSKIRTKG--GSVARGSSPLKLVCSV 633
KFRK +SK R KG GSV RG+SP SV
Sbjct: 1882 EEAEEIAALNLAKFRKAQQELEEAEERADLAEQAISKFRAKGRAGSVGRGASPAPRATSV 1941
|
|
| WB|WBGene00006789 unc-54 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q90WH5 LOC429272 "Atrial myosin heacy chain" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NPC8 LOC429272 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060531-50 myha "myosin, heavy chain a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070705-73 myhz1.2 "myosin, heavy polypeptide 1.2, skeletal muscle" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070705-74 myhz1.3 "myosin, heavy polypeptide 1.3, skeletal muscle" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-5336 wu:fd14a01 "wu:fd14a01" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-020604-1 myhz2 "myosin, heavy polypeptide 2, fast muscle specific" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7GMH0 K7GMH0 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 721 | |||
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 1e-124 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 1e-31 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 6e-22 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 3e-17 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-16 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 4e-15 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-14 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-14 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 4e-13 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 5e-12 | |
| PRK04863 | 1486 | PRK04863, mukB, cell division protein MukB; Provis | 5e-12 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-11 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-11 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 1e-11 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-11 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 5e-11 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 6e-11 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-10 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 3e-10 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 3e-10 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 3e-10 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 4e-10 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-09 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 3e-09 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 4e-09 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 6e-09 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 5e-08 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 5e-08 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 6e-08 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 6e-08 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 8e-08 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 1e-07 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 1e-07 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 1e-07 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 2e-07 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 3e-07 | |
| pfam09726 | 680 | pfam09726, Macoilin, Transmembrane protein | 3e-07 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 5e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 9e-07 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 2e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-06 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-06 | |
| PRK04863 | 1486 | PRK04863, mukB, cell division protein MukB; Provis | 1e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 1e-05 | |
| TIGR02680 | 1353 | TIGR02680, TIGR02680, TIGR02680 family protein | 1e-05 | |
| TIGR03007 | 498 | TIGR03007, pepcterm_ChnLen, polysaccharide chain l | 2e-05 | |
| COG1269 | 660 | COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase su | 2e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 3e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-05 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 5e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 6e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 9e-05 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 9e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 1e-04 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 1e-04 | |
| PRK10929 | 1109 | PRK10929, PRK10929, putative mechanosensitive chan | 1e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 2e-04 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 2e-04 | |
| COG3096 | 1480 | COG3096, MukB, Uncharacterized protein involved in | 3e-04 | |
| COG0497 | 557 | COG0497, RecN, ATPase involved in DNA repair [DNA | 3e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-04 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 4e-04 | |
| COG0497 | 557 | COG0497, RecN, ATPase involved in DNA repair [DNA | 4e-04 | |
| TIGR01843 | 423 | TIGR01843, type_I_hlyD, type I secretion membrane | 4e-04 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 6e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 6e-04 | |
| pfam13514 | 1118 | pfam13514, AAA_27, AAA domain | 6e-04 | |
| TIGR01843 | 423 | TIGR01843, type_I_hlyD, type I secretion membrane | 7e-04 | |
| PRK11281 | 1113 | PRK11281, PRK11281, hypothetical protein; Provisio | 7e-04 | |
| COG1566 | 352 | COG1566, EmrA, Multidrug resistance efflux pump [D | 8e-04 | |
| TIGR00606 | 1311 | TIGR00606, rad50, rad50 | 0.001 | |
| pfam04111 | 356 | pfam04111, APG6, Autophagy protein Apg6 | 0.001 | |
| pfam05622 | 713 | pfam05622, HOOK, HOOK protein | 0.001 | |
| pfam05622 | 713 | pfam05622, HOOK, HOOK protein | 0.001 | |
| pfam05667 | 536 | pfam05667, DUF812, Protein of unknown function (DU | 0.001 | |
| PRK10246 | 1047 | PRK10246, PRK10246, exonuclease subunit SbcC; Prov | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 0.002 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.002 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 0.002 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 0.002 | |
| COG4026 | 290 | COG4026, COG4026, Uncharacterized protein containi | 0.002 | |
| COG3264 | 835 | COG3264, COG3264, Small-conductance mechanosensiti | 0.002 | |
| PRK05771 | 646 | PRK05771, PRK05771, V-type ATP synthase subunit I; | 0.002 | |
| pfam09726 | 680 | pfam09726, Macoilin, Transmembrane protein | 0.003 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 0.003 | |
| pfam07888 | 546 | pfam07888, CALCOCO1, Calcium binding and coiled-co | 0.003 | |
| PRK03598 | 331 | PRK03598, PRK03598, putative efflux pump membrane | 0.003 | |
| pfam01496 | 707 | pfam01496, V_ATPase_I, V-type ATPase 116kDa subuni | 0.003 | |
| PLN03223 | 1634 | PLN03223, PLN03223, Polycystin cation channel prot | 0.003 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.004 | |
| TIGR02680 | 1353 | TIGR02680, TIGR02680, TIGR02680 family protein | 0.004 | |
| PRK01156 | 895 | PRK01156, PRK01156, chromosome segregation protein | 0.004 | |
| pfam05557 | 722 | pfam05557, MAD, Mitotic checkpoint protein | 0.004 | |
| TIGR03794 | 421 | TIGR03794, NHLM_micro_HlyD, NHLM bacteriocin syste | 0.004 |
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
Score = 390 bits (1004), Expect = e-124
Identities = 286/537 (53%), Positives = 367/537 (68%), Gaps = 67/537 (12%)
Query: 150 RRKLQARLAEAEETIESLNQKVIALEKTKQRLATEVEDLQLEVDRANAIANAAEKKAKAI 209
++KL +++E EE E+ N K +LEKTK RL +E+EDLQ+E++RANA A+ EKK K
Sbjct: 323 KKKLNQKISELEEAAEAANAKCDSLEKTKSRLQSELEDLQIELERANAAASELEKKQKNF 382
Query: 210 DKIIGEWKLKVDDLAAELDASQKECRNYSTELFRLKGAYEEAQEQLEAVRRENKNLADEV 269
DKI+ EWK KVD+L AELD +Q+E RN STELFRLK EE ++Q+EA+RRENKNL DE+
Sbjct: 383 DKILAEWKRKVDELQAELDTAQREARNLSTELFRLKNELEELKDQVEALRRENKNLQDEI 442
Query: 270 KDLLDQIGEGGRNIHEVEKARKRLEVEKDELQAALEEAEAALEQEENKVLRAQLELSQAN 329
DL DQ+GEGGRN+HE+EKAR+RLE EKDELQAALEEAEAALE EE+KVLRAQ+ELSQ
Sbjct: 443 HDLTDQLGEGGRNVHELEKARRRLEAEKDELQAALEEAEAALELEESKVLRAQVELSQIR 502
Query: 330 AEAQKNI-----------KRYQQQLKDVQTALEEEQRARDDA------------------ 360
+E ++ + K +Q+ ++ +Q LE E + + +A
Sbjct: 503 SEIERRLAEKEEEFENTRKNHQRAIESLQATLEAEAKGKAEASRLKKKLEGDINELEIAL 562
Query: 361 -----------------REQLGIVERRANALQNELEESRQLLEQADRGRRQAETELAD-- 401
++Q+ ++ + Q E++R+ L A+R E EL +
Sbjct: 563 DHANKANAEAQKNVKKYQQQVKELQTQVEEEQRAREDAREQLAVAERRATALEAELEELR 622
Query: 402 ------------AHEQLNELSAQATSISA-------AKRKLEGELQTLHSDLDELLNEAK 442
A +L E S + ++A KRKLEGEL L SDLDE +NE K
Sbjct: 623 SALEQAERARKQAETELAEASERVNELTAQNSSLIAQKRKLEGELAALQSDLDEAVNELK 682
Query: 443 NSEEKAKKAMVDAARLADELRAEQDHAQTQEKLRKALETQIKELQIRLDEAENNALKGGK 502
+EE+AKKA DAARLA+ELR EQ+H+Q E+LRK LE+Q+KELQ+RLDEAE ALKGGK
Sbjct: 683 AAEERAKKAQADAARLAEELRQEQEHSQHLERLRKQLESQVKELQVRLDEAEAAALKGGK 742
Query: 503 KAIQKLEQRVRELENELDGEQRRHADAQKNLRKTERRIKELSFQAEEDRKNHERMQDLVD 562
K IQKLE RVRELE ELDGEQRRHA+ QKNLRK ERR+KEL FQ EED+KN ER+QDLVD
Sbjct: 743 KMIQKLEARVRELEAELDGEQRRHAETQKNLRKMERRVKELQFQVEEDKKNLERLQDLVD 802
Query: 563 KLQQKIKTYKRQIEEAEEIAALNLAKFRKAQQELEEAEERADLAEQAVSKIRTKGGS 619
KLQ KIKTYKRQ+EEAEE+A +NL+K+RKAQ+ELE+AEERAD AE++++K+R K
Sbjct: 803 KLQAKIKTYKRQLEEAEEVAQINLSKYRKAQRELEDAEERADTAERSLNKLRAKSRR 859
|
The myosin molecule is a multi-subunit complex made up of two heavy chains and four light chains it is a fundamental contractile protein found in all eukaryote cell types. This family consists of the coiled-coil myosin heavy chain tail region. The coiled-coil is composed of the tail from two molecules of myosin. These can then assemble into the macromolecular thick filament. The coiled-coil region provides the structural backbone the thick filament. Length = 859 |
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|220365 pfam09726, Macoilin, Transmembrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|234084 TIGR03007, pepcterm_ChnLen, polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|224188 COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase subunit I [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|236798 PRK10929, PRK10929, putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|225638 COG3096, MukB, Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|223571 COG0497, RecN, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|223571 COG0497, RecN, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|130902 TIGR01843, type_I_hlyD, type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|205692 pfam13514, AAA_27, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|130902 TIGR01843, type_I_hlyD, type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >gnl|CDD|236892 PRK11281, PRK11281, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224482 COG1566, EmrA, Multidrug resistance efflux pump [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|129694 TIGR00606, rad50, rad50 | Back alignment and domain information |
|---|
| >gnl|CDD|217902 pfam04111, APG6, Autophagy protein Apg6 | Back alignment and domain information |
|---|
| >gnl|CDD|218661 pfam05622, HOOK, HOOK protein | Back alignment and domain information |
|---|
| >gnl|CDD|218661 pfam05622, HOOK, HOOK protein | Back alignment and domain information |
|---|
| >gnl|CDD|218681 pfam05667, DUF812, Protein of unknown function (DUF812) | Back alignment and domain information |
|---|
| >gnl|CDD|182330 PRK10246, PRK10246, exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|226513 COG4026, COG4026, Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|225803 COG3264, COG3264, Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|235600 PRK05771, PRK05771, V-type ATP synthase subunit I; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|220365 pfam09726, Macoilin, Transmembrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|116500 pfam07888, CALCOCO1, Calcium binding and coiled-coil domain (CALCOCO1) like | Back alignment and domain information |
|---|
| >gnl|CDD|235136 PRK03598, PRK03598, putative efflux pump membrane fusion protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216531 pfam01496, V_ATPase_I, V-type ATPase 116kDa subunit family | Back alignment and domain information |
|---|
| >gnl|CDD|215637 PLN03223, PLN03223, Polycystin cation channel protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|100796 PRK01156, PRK01156, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218636 pfam05557, MAD, Mitotic checkpoint protein | Back alignment and domain information |
|---|
| >gnl|CDD|163506 TIGR03794, NHLM_micro_HlyD, NHLM bacteriocin system secretion protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 721 | |||
| KOG0161|consensus | 1930 | 100.0 | ||
| KOG0161|consensus | 1930 | 100.0 | ||
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 100.0 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 100.0 | |
| KOG0933|consensus | 1174 | 99.81 | ||
| KOG4674|consensus | 1822 | 99.79 | ||
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 99.76 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 99.75 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 99.73 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 99.72 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 99.7 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 99.69 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 99.68 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 99.66 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 99.66 | |
| KOG0964|consensus | 1200 | 99.65 | ||
| KOG4674|consensus | 1822 | 99.64 | ||
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 99.64 | |
| KOG0996|consensus | 1293 | 99.62 | ||
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 99.51 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 99.46 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 99.45 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 99.36 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 99.06 | |
| KOG0996|consensus | 1293 | 99.04 | ||
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 99.03 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 99.01 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 98.95 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 98.92 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 98.9 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 98.78 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 98.77 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.73 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.71 | |
| KOG4643|consensus | 1195 | 98.68 | ||
| KOG0977|consensus | 546 | 98.68 | ||
| KOG0977|consensus | 546 | 98.66 | ||
| KOG4643|consensus | 1195 | 98.57 | ||
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 98.55 | |
| KOG0971|consensus | 1243 | 98.53 | ||
| KOG0976|consensus | 1265 | 98.52 | ||
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 98.47 | |
| KOG0933|consensus | 1174 | 98.45 | ||
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 98.34 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 98.26 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 98.19 | |
| KOG0976|consensus | 1265 | 98.18 | ||
| KOG0971|consensus | 1243 | 98.12 | ||
| KOG0964|consensus | 1200 | 98.11 | ||
| KOG0612|consensus | 1317 | 98.05 | ||
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 98.01 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 97.98 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 97.98 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 97.89 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 97.82 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 97.79 | |
| KOG0612|consensus | 1317 | 97.76 | ||
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 97.73 | |
| KOG0978|consensus | 698 | 97.71 | ||
| KOG0994|consensus | 1758 | 97.65 | ||
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 97.6 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 97.53 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 97.51 | |
| KOG0994|consensus | 1758 | 97.5 | ||
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 97.48 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 97.45 | |
| PRK11637 | 428 | AmiB activator; Provisional | 97.44 | |
| KOG0250|consensus | 1074 | 97.42 | ||
| KOG0250|consensus | 1074 | 97.32 | ||
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 97.31 | |
| KOG0018|consensus | 1141 | 97.28 | ||
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 97.27 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 97.21 | |
| PRK11637 | 428 | AmiB activator; Provisional | 97.21 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 97.19 | |
| KOG4673|consensus | 961 | 97.19 | ||
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 97.17 | |
| KOG4673|consensus | 961 | 97.11 | ||
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 97.11 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.06 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 97.06 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 97.03 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 97.03 | |
| KOG1003|consensus | 205 | 96.99 | ||
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 96.89 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 96.74 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 96.69 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 96.67 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 96.62 | |
| PRK09039 | 343 | hypothetical protein; Validated | 96.62 | |
| KOG0995|consensus | 581 | 96.6 | ||
| KOG0995|consensus | 581 | 96.49 | ||
| PRK09039 | 343 | hypothetical protein; Validated | 96.41 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 96.36 | |
| KOG1003|consensus | 205 | 96.24 | ||
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 96.18 | |
| KOG0946|consensus | 970 | 96.06 | ||
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 96.02 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 95.97 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 95.85 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 95.78 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 95.76 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 95.7 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 95.65 | |
| KOG1029|consensus | 1118 | 95.57 | ||
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 95.51 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 95.4 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 95.36 | |
| KOG0978|consensus | 698 | 95.33 | ||
| KOG0018|consensus | 1141 | 95.08 | ||
| KOG0980|consensus | 980 | 94.68 | ||
| KOG0963|consensus | 629 | 94.59 | ||
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 94.43 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 94.15 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 94.08 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 94.05 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 93.51 | |
| KOG4593|consensus | 716 | 93.25 | ||
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 92.96 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 92.84 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 92.8 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 92.72 | |
| KOG0962|consensus | 1294 | 92.62 | ||
| PF08826 | 61 | DMPK_coil: DMPK coiled coil domain like; InterPro: | 92.45 | |
| KOG0980|consensus | 980 | 92.21 | ||
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 92.1 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 91.88 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 91.54 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 91.2 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 91.15 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 90.31 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 90.29 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 89.93 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 89.3 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 88.95 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 88.77 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 88.76 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 88.64 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 88.58 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 88.48 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 88.32 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 88.12 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 87.78 | |
| KOG0963|consensus | 629 | 87.25 | ||
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 87.18 | |
| PF15397 | 258 | DUF4618: Domain of unknown function (DUF4618) | 86.01 | |
| PF05384 | 159 | DegS: Sensor protein DegS; InterPro: IPR008595 Thi | 85.97 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 85.78 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 85.48 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 85.46 | |
| KOG1853|consensus | 333 | 85.23 | ||
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 85.18 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 84.67 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 84.17 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 83.79 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 83.13 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 82.91 | |
| KOG0249|consensus | 916 | 82.52 | ||
| KOG0962|consensus | 1294 | 82.23 | ||
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 82.19 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 81.33 | |
| PF13514 | 1111 | AAA_27: AAA domain | 80.51 | |
| PF14073 | 178 | Cep57_CLD: Centrosome localisation domain of Cep57 | 80.47 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 80.36 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 80.02 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 80.01 |
| >KOG0161|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.3e-35 Score=343.17 Aligned_cols=680 Identities=26% Similarity=0.340 Sum_probs=576.6
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy4651 11 LKTKRKLQARLAEAEETIESLNQKVIALEKTKQRLATEVEDLQLEVDRANAIANAAEKKAKAIDKIIGEWKLKVSLQLEV 90 (721)
Q Consensus 11 ~~~~k~l~~~~~~l~~~le~~~~~~~~~~~~~~~~~~e~~~l~~~l~~~~~~~~~l~~~~~~le~~~~~~~~~~~l~~e~ 90 (721)
....++....|..+...+++....+.++..++...+..+..+..++..+...++.|.+..+.++..+.+ ...+++.+.
T Consensus 928 e~~~~~~~~e~~~l~~~~~~~E~~~~k~~~Ek~~~e~~~~~l~~e~~~~~e~~~kL~kekk~lEe~~~~--l~~~l~~~e 1005 (1930)
T KOG0161|consen 928 ERKKRKLEQEVQELKEQLEELELTLQKLELEKNAAENKLKNLEEEINSLDENISKLSKEKKELEERIRE--LQDDLQAEE 1005 (1930)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHH
Confidence 355778889999999999999999999999999999999999999999999999999999999999887 556789999
Q ss_pred HHHHHHHHHHHHHHHHHhHHHhHHHhhchhhhhchHhHHHHhhhhhhhhh----------cCCCccchhhHHHHHHHHHH
Q psy4651 91 DRANAIANAAEKKAKAIDKIIGEWKLKGSLDFINTLYCLLFIPFLNEKSL----------KHPYPLFFPRRKLQARLAEA 160 (721)
Q Consensus 91 ~~~~~l~~~~~~~~~~~~~l~~~~~l~~~i~~~~~~e~~~l~~~le~~~~----------~~~~~le~~~k~l~~~l~~l 160 (721)
++++.+.+...+++..++.++..+.-++.. +.+++..+++++.++. .....+....++...++..+
T Consensus 1006 ek~~~l~k~~~kle~~l~~le~~le~e~~~----r~e~Ek~~rkle~el~~~~e~~~~~~~~~~el~~~l~kke~El~~l 1081 (1930)
T KOG0161|consen 1006 EKAKSLNKAKAKLEQQLDDLEVTLEREKRI----RMELEKAKRKLEGELKDLQESIEELKKQKEELDNQLKKKESELSQL 1081 (1930)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 999999999999999999888766322221 1256666666666553 23344555555666677777
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHH
Q psy4651 161 EETIESLNQKVIALEKTKQRLATEVEDLQLEVDRANAIANAAEKKAKAIDKIIGEWKLKVDDLAAELDASQKECRNYSTE 240 (721)
Q Consensus 161 ~~~le~~~~~~~~le~~~~~le~ei~~l~~~le~~~~~~~~~e~~~~~le~~l~e~~~~~~~~~~~~~~~~~~~~~le~e 240 (721)
...++.....+..+++.+..++..|.++..+++.....++.+++..+.+..++.+++..+++..........--...+.+
T Consensus 1082 ~~k~e~e~~~~~~l~k~i~eL~~~i~el~e~le~er~~r~K~ek~r~dL~~ele~l~~~Lee~~~~t~~q~e~~~k~e~e 1161 (1930)
T KOG0161|consen 1082 QSKLEDEQAEVAQLQKQIKELEARIKELEEELEAERASRAKAERQRRDLSEELEELKEELEEQGGTTAAQLELNKKREAE 1161 (1930)
T ss_pred HHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHH
Confidence 88888888888899999999999999999999999999999999999999999999999998855443333333668899
Q ss_pred HHHHHHHHHHHHHHHHHHH-HHhHhHHHHHHHHHHHHhhcccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy4651 241 LFRLKGAYEEAQEQLEAVR-RENKNLADEVKDLLDQIGEGGRNIHEVEKARKRLEVEKDELQAALEEAEAALEQEENKVL 319 (721)
Q Consensus 241 ~~~l~~ele~~~~~~e~~~-~~~~~l~~e~~~l~~~l~~~~~~~~~l~~~~~~le~e~~~l~~~le~~~~~l~~~e~~~~ 319 (721)
+..++..++.....++... .....+...+..+..++++.......+.+.+..+..++..+..+++.+.......+..+.
T Consensus 1162 ~~~l~~~leee~~~~e~~~~~lr~~~~~~~~el~~qle~l~~~k~~lekek~~lq~e~~~l~~ev~~~~~~k~~~e~~~k 1241 (1930)
T KOG0161|consen 1162 VQKLRRDLEEETLDHEAQIEELRKKHADSLAELQEQLEQLQKDKAKLEKEKSDLQREIADLAAELEQLSSEKKDLEKKDK 1241 (1930)
T ss_pred HHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhccHHHHHH
Confidence 9999999999988887654 467888889999999999777777777777777777777777777766665555555555
Q ss_pred HHHHHHHH---HHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHH----
Q psy4651 320 RAQLELSQ---ANAEAQKNIKRYQQQLKDVQTALEEEQRARDDAREQLGIVERRANALQNELEESRQLLEQADRGR---- 392 (721)
Q Consensus 320 ~~~~~l~~---~~~~~~~~~~~l~~~l~~l~~~lee~~~~~~~~~~~~~~l~~~~~~l~~ele~~~~~~~~~~~~~---- 392 (721)
.++..+.. -..++...+..+-.+...++.++.+..+...+.+.....+.+....+..+++.++.+++...+.+
T Consensus 1242 ~~E~~l~elq~k~~~~~~~~~~l~~q~~~l~~E~~~l~~~lee~e~~~~~~~r~~~~~~~qle~~k~qle~e~r~k~~l~ 1321 (1930)
T KOG0161|consen 1242 KLEAQLSELQLKLDEQERLRNDLTAKRSRLQNENEELSRQLEEAEAKLSALSRDKQALESQLEELKRQLEEETREKSALE 1321 (1930)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHhhHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 55544333 23344444555556666677777777777777777777778888888888888888888766544
Q ss_pred ---HHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHhhHHHHHHH-HHhHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy4651 393 ---RQAETELADAHEQLNELSAQATSISAAKRKLEGELQTLHSDLDELLNE-AKNSEEKAKKAMVDAARLADELRAEQDH 468 (721)
Q Consensus 393 ---~~l~~el~~l~~~l~~~~~~~~~l~~~~~~le~el~~lk~~le~~~~~-~~~~e~~~~~l~~e~~~l~~~l~~~~~~ 468 (721)
++++.+++.++.++++.......+...+.+...++..|+.+++..... .+.+++..+.+...+..+...+......
T Consensus 1322 ~~l~~l~~e~~~l~e~leee~e~~~~l~r~lsk~~~e~~~~~~k~e~~~~~~~eelee~kk~l~~~lq~~qe~~e~~~~~ 1401 (1930)
T KOG0161|consen 1322 NALRQLEHELDLLREQLEEEQEAKNELERKLSKANAELAQWKKKFEEEVLQRLEELEELKKKLQQRLQELEEQIEAANAK 1401 (1930)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHH
Confidence 788888999999999999999999999999999999999999965554 8889999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHhHh------hcchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy4651 469 AQTQEKLRKALETQIKELQIRLDEAENNAL------KGGKKAIQKLEQRVRELENELDGEQRRHADAQKNLRKTERRIKE 542 (721)
Q Consensus 469 ~~~le~~k~~Le~e~~~L~~~l~~~e~~~~------~~~~~~~~~~~~~~~~l~~ele~~~~~~~~~~~~~~~l~~~l~e 542 (721)
+..+++.+.+|..++.++...++....... +.+++.+..|......+..+++......+...+.+.++...+.+
T Consensus 1402 ~~~Lek~k~~l~~el~d~~~d~~~~~~~~~~le~k~k~f~k~l~e~k~~~e~l~~Eld~aq~e~r~~~tel~kl~~~lee 1481 (1930)
T KOG0161|consen 1402 NASLEKAKNRLQQELEDLQLDLERSRAAVAALEKKQKRFEKLLAEWKKKLEKLQAELDAAQRELRQLSTELQKLKNALEE 1481 (1930)
T ss_pred HHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHH
Confidence 999999999999999999999876644332 46888999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccCCCCC
Q psy4651 543 LSFQAEEDRKNHERMQDLVDKLQQKIKTYKRQIEEAEEIAALNLAKFRKAQQELEEAEERADLAEQAVSKIRTKGGSVAR 622 (721)
Q Consensus 543 l~~~l~~~~~~~~~l~~~~~~l~~~l~~~~~~lee~~~~~~~l~~~~~~l~~~l~e~e~~~~~~e~~~~~l~~~~~~~~~ 622 (721)
+..+++.+.+.+..+...+..+...+..+.+.+++++.....+...+.+++..+.+++..+...++.. ++.+
T Consensus 1482 ~~e~~e~l~renk~l~~ei~dl~~~~~e~~k~v~elek~~r~le~e~~elQ~aLeElE~~le~eE~~~--lr~~------ 1553 (1930)
T KOG0161|consen 1482 LLEQLEELRRENKNLSQEIEDLEEQKDEGGKRVHELEKEKRRLEQEKEELQAALEELEAALEAEEDKK--LRLQ------ 1553 (1930)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhHH--HHHH------
Confidence 99999999999999999999999999999999999999999999999999999999999999998888 7766
Q ss_pred CCCcccchhhhhhhhhHHHHHHHHHhhhhhhchHHHHHhHhhHHHHHHHHHHhHHHHHhcHHHHHHHHHHHHHHHHHHHH
Q psy4651 623 GSSPLKLVCSVTFCRQITVQITSKLVLHLFLLEEEFENTRKNHQRALDSMQASLEAEAKGKAEALRMKKKLEADINELEI 702 (721)
Q Consensus 623 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~ee~e~~rk~~~~~v~~l~~~le~e~~~~~~~~~~k~~le~~i~~l~~ 702 (721)
+++ .+.+.++++ +|..++++++..++++++.|.+|++.++.+.++++.+.++|++|+++|++|+.
T Consensus 1554 ----~~~-------~~~r~e~er----~l~ek~Ee~E~~rk~~~~~i~~~q~~Le~E~r~k~e~~r~KKkle~di~elE~ 1618 (1930)
T KOG0161|consen 1554 ----LEL-------QQLRSEIER----RLQEKDEEIEELRKNLQRQLESLQAELEAETRSKSEALRSKKKLEGDINELEI 1618 (1930)
T ss_pred ----HHH-------HHHHHHHHH----HHHhhhHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHhhhhhhhcchHHHHH
Confidence 555 367777665 49999999999999999999999999999999999999999999999999999
Q ss_pred HHhHHHHhHHHHHhhcc
Q psy4651 703 ALDHANKVRVAAISRKK 719 (721)
Q Consensus 703 ~l~~~~~~~~~~~~~~~ 719 (721)
+|+|||+++.++++..+
T Consensus 1619 ~ld~ank~~~d~~K~lk 1635 (1930)
T KOG0161|consen 1619 QLDHANKANEDAQKQLK 1635 (1930)
T ss_pred HHHHHHHhhHHHHHHHH
Confidence 99999999999999764
|
|
| >KOG0161|consensus | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >KOG0933|consensus | Back alignment and domain information |
|---|
| >KOG4674|consensus | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >KOG0964|consensus | Back alignment and domain information |
|---|
| >KOG4674|consensus | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG0996|consensus | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0996|consensus | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG4643|consensus | Back alignment and domain information |
|---|
| >KOG0977|consensus | Back alignment and domain information |
|---|
| >KOG0977|consensus | Back alignment and domain information |
|---|
| >KOG4643|consensus | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >KOG0971|consensus | Back alignment and domain information |
|---|
| >KOG0976|consensus | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0933|consensus | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >KOG0976|consensus | Back alignment and domain information |
|---|
| >KOG0971|consensus | Back alignment and domain information |
|---|
| >KOG0964|consensus | Back alignment and domain information |
|---|
| >KOG0612|consensus | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >KOG0612|consensus | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >KOG0978|consensus | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >KOG0250|consensus | Back alignment and domain information |
|---|
| >KOG0250|consensus | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >KOG0018|consensus | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG4673|consensus | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >KOG4673|consensus | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >KOG1003|consensus | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0995|consensus | Back alignment and domain information |
|---|
| >KOG0995|consensus | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >KOG1003|consensus | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >KOG0946|consensus | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >KOG0978|consensus | Back alignment and domain information |
|---|
| >KOG0018|consensus | Back alignment and domain information |
|---|
| >KOG0980|consensus | Back alignment and domain information |
|---|
| >KOG0963|consensus | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >KOG4593|consensus | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >KOG0962|consensus | Back alignment and domain information |
|---|
| >PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure | Back alignment and domain information |
|---|
| >KOG0980|consensus | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >KOG0963|consensus | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF15397 DUF4618: Domain of unknown function (DUF4618) | Back alignment and domain information |
|---|
| >PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >KOG1853|consensus | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >KOG0249|consensus | Back alignment and domain information |
|---|
| >KOG0962|consensus | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PF14073 Cep57_CLD: Centrosome localisation domain of Cep57 | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 721 | |||
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-29 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-27 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 7e-27 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 4e-24 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 4e-22 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 4e-18 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-13 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-12 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-10 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-06 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-21 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-14 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 5e-12 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-11 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 4e-11 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-10 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-05 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-11 | |
| 2xs1_A | 704 | Programmed cell death 6-interacting protein; prote | 3e-11 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 1e-08 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 1e-06 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 4e-04 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 3e-08 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 1e-05 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 3e-05 | |
| 1m1j_C | 409 | Fibrinogen gamma chain; coiled coils, disulfide ri | 5e-05 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 5e-05 | |
| 3fpp_A | 341 | Macrolide-specific efflux protein MACA; hexameric | 5e-05 | |
| 2zuo_A | 861 | MVP, major vault protein; repeat domains, protein- | 1e-04 | |
| 2zuo_A | 861 | MVP, major vault protein; repeat domains, protein- | 1e-04 | |
| 2zuo_A | 861 | MVP, major vault protein; repeat domains, protein- | 3e-04 | |
| 1yvl_A | 683 | Signal transducer and activator of transcription 1 | 5e-04 | |
| 4dk0_A | 369 | Putative MACA; alpha-hairpin, lipoyl, beta-barrel, | 6e-04 |
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
Score = 124 bits (314), Expect = 2e-29
Identities = 70/336 (20%), Positives = 150/336 (44%), Gaps = 12/336 (3%)
Query: 231 QKECRNYSTELFRLKGAYEEAQEQLEAVRRENKNLADEVKDLLDQIGEGGRNIHEVEKAR 290
++E + EL R K ++A+ +L+ + +++ L +E L +++ E E+ R
Sbjct: 856 EEEMQAKDEELQRTKERQQKAEAELKELEQKHTQLCEEKNLLQEKLQAETELYAEAEEMR 915
Query: 291 KRLEVEKDELQAALEEAEAALEQEENKVLRAQLELSQANAEAQKNIKRYQQQLKDVQTAL 350
RL +K EL+ L E EA +E+EE + + + Q K+ QQQ+ D++ L
Sbjct: 916 VRLAAKKQELEEILHEMEARIEEEE-----------ERSQQLQAEKKKMQQQMLDLEEQL 964
Query: 351 EEEQRARDDAREQLGIVERRANALQNELEESRQLLEQADRGRRQAETELADAHEQLNELS 410
EEE+ AR + + + + +++++ + + R+ E ++D L E
Sbjct: 965 EEEEAARQKLQLEKVTADGKIKKMEDDILIMEDQNNKLTKERKLLEERVSDLTTNLAEEE 1024
Query: 411 AQATSISAAKRKLEGELQTLHSDLDELLNEAKNSEEKAKKAMVDAARLADELRAEQDHAQ 470
+A +++ K K E + L L + + E+ +K +++ L +++ Q
Sbjct: 1025 EKAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKIKRKLEGESSDLHEQIAELQAQIA 1084
Query: 471 TQEKLRKALETQIKELQIRLDEAENNALKGGKKAIQKLEQRVRELENELDGEQRRHADAQ 530
+ E +++ RL++ E + K I++LE + +L+ +L+ E+ A+
Sbjct: 1085 ELKAQLAKKEEELQAALARLED-ETSQKNNALKKIRELESHISDLQEDLESEKAARNKAE 1143
Query: 531 KNLRKTERRIKELSFQAEEDRKNHERMQDLVDKLQQ 566
K R ++ L + E+ Q+L +
Sbjct: 1144 KQKRDLSEELEALKTELEDTLDTTATQQELRGSDYK 1179
|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Length = 562 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >1m1j_C Fibrinogen gamma chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_C Length = 409 | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 | Back alignment and structure |
|---|
| >3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} Length = 341 | Back alignment and structure |
|---|
| >2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 | Back alignment and structure |
|---|
| >2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 | Back alignment and structure |
|---|
| >2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 | Back alignment and structure |
|---|
| >1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Length = 683 | Back alignment and structure |
|---|
| >4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A Length = 369 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 721 | |||
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 99.18 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 99.17 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 98.93 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 98.9 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 97.68 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 97.52 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 97.18 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 97.09 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 97.08 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 96.77 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 96.53 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 96.18 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 96.02 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 95.69 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 95.52 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 95.4 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 95.36 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 95.26 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 94.88 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 94.84 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 94.75 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 94.51 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 94.04 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 93.21 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 92.78 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 92.45 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 92.33 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 92.1 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 92.05 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 91.62 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 90.76 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 90.59 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 90.09 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 88.24 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 88.17 | |
| 2e7s_A | 135 | RAB guanine nucleotide exchange factor SEC2; coile | 88.14 | |
| 2e7s_A | 135 | RAB guanine nucleotide exchange factor SEC2; coile | 87.29 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 85.32 | |
| 1wt6_A | 81 | Myotonin-protein kinase; coiled-coil, kinase activ | 83.73 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 83.28 | |
| 3jsv_C | 94 | NF-kappa-B essential modulator; ubiquitin, coiled- | 80.3 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 80.21 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 80.16 |
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
Probab=99.18 E-value=2.7e-06 Score=85.64 Aligned_cols=16 Identities=19% Similarity=0.084 Sum_probs=6.6
Q ss_pred HHHHHHHHHHHHHHHH
Q psy4651 294 EVEKDELQAALEEAEA 309 (721)
Q Consensus 294 e~e~~~l~~~le~~~~ 309 (721)
...+..++..++.+..
T Consensus 5 ~~~~~~l~~~~~~~~~ 20 (284)
T 1c1g_A 5 KKKMQMLKLDKENALD 20 (284)
T ss_dssp HHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHhHHHHHH
Confidence 3334444444444433
|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00