Psyllid ID: psy4653


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MPLRLDIKRKLTARSDRVKCCDLHPTEPWMLASLYNGHVHVWNHETNQNVKSFEVCDLPVRAAKFVPRKNWIVTGSDDMQVCVFNYNTLERFHSFEAHSDYVRCVAVHPTQPFLLTSSDDMLIKLWNWEKAWACQQVFEGHTHYVMQIVINPKDNNTFASASLDRTVKVWQLGSASPNFTLEGHEKGVNCVDYYHGGDKPYLISGADDRLVKIWDYQNKTCVQTLESGI
ccccccEEEEEEEccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEEEEccccEEEEEEEccccEEEEEEccccEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEEEEcccccEEEEEEccccccEEEEEEccccEEEEEcccccccEEEccccccEEEEEEEEcccccEEEEEEccccEEEEEcccccEEEEccccc
ccccccEEEEEccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEcccccEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEcccccEEEEEEccccHHHHHHcccccccEEEEEEccccccEEEEEccccEEEEEEcccccEEEEEccccccEEEEEEccccccEEEEEEccccEEEEEEcccccEEEEEcccc
MPLRLDIKRKLTarsdrvkccdlhptepwmLASLYNGHVHVWnhetnqnvksfevcdlpvraakfvprknwivtgsddmQVCVFNYntlerfhsfeahsDYVRcvavhptqpflltssDDMLIKLWNWEKAWACQQVFEGHTHYVMQIVInpkdnntfasaslDRTVKVWqlgsaspnftleghekgvncvdyyhggdkpylisgaddRLVKIWDYQNKTCVQTLESGI
mplrldikrkltarsdrvkccDLHPTEPWMLASLYNGHVHVWNHETNQNVKSFEVCDLPVRAAKFvprknwivtgsddmQVCVFNYNTLERFHSFEAHSDYVRCVAVHPTQPFLLTSSDDMLIKLWNWEKAWACQQVFEGHTHYVMQIVINPKDNNTFASASLDRTVKVWQLGSAspnftleghekGVNCVDYYHGGDKPYLISGADDRLVKIWDYQNKTCVQTLESGI
MPLRLDIKRKLTARSDRVKCCDLHPTEPWMLASLYNGHVHVWNHETNQNVKSFEVCDLPVRAAKFVPRKNWIVTGSDDMQVCVFNYNTLERFHSFEAHSDYVRCVAVHPTQPFLLTSSDDMLIKLWNWEKAWACQQVFEGHTHYVMQIVINPKDNNTFASASLDRTVKVWQLGSASPNFTLEGHEKGVNCVDYYHGGDKPYLISGADDRLVKIWDYQNKTCVQTLESGI
**************SDRVKCCDLHPTEPWMLASLYNGHVHVWNHETNQNVKSFEVCDLPVRAAKFVPRKNWIVTGSDDMQVCVFNYNTLERFHSFEAHSDYVRCVAVHPTQPFLLTSSDDMLIKLWNWEKAWACQQVFEGHTHYVMQIVINPKDNNTFASASLDRTVKVWQLGSASPNFTLEGHEKGVNCVDYYHGGDKPYLISGADDRLVKIWDYQNKTCVQ******
MPLRLDIKRKLTARSDRVKCCDLHPTEPWMLASLYNGHVHVWNHETNQNVKSFEVCDLPVRAAKFVPRKNWIVTGSDDMQVCVFNYNTLERFHSFEAHSDYVRCVAVHPTQPFLLTSSDDMLIKLWNWEKAWACQQVFEGHTHYVMQIVINPKDNNTFASASLDRTVKVWQLGSASPNFTLEGHEKGVNCVDYYHGGDKPYLISGADDRLVKIWDYQNKTCVQTLESGI
MPLRLDIKRKLTARSDRVKCCDLHPTEPWMLASLYNGHVHVWNHETNQNVKSFEVCDLPVRAAKFVPRKNWIVTGSDDMQVCVFNYNTLERFHSFEAHSDYVRCVAVHPTQPFLLTSSDDMLIKLWNWEKAWACQQVFEGHTHYVMQIVINPKDNNTFASASLDRTVKVWQLGSASPNFTLEGHEKGVNCVDYYHGGDKPYLISGADDRLVKIWDYQNKTCVQTLESGI
***RLDIKRKLTARSDRVKCCDLHPTEPWMLASLYNGHVHVWNHETNQNVKSFEVCDLPVRAAKFVPRKNWIVTGSDDMQVCVFNYNTLERFHSFEAHSDYVRCVAVHPTQPFLLTSSDDMLIKLWNWEKAWACQQVFEGHTHYVMQIVINPKDNNTFASASLDRTVKVWQLGSASPNFTLEGHEKGVNCVDYYHGGDKPYLISGADDRLVKIWDYQNKTCVQTLE***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPLRLDIKRKLTARSDRVKCCDLHPTEPWMLASLYNGHVHVWNHETNQNVKSFEVCDLPVRAAKFVPRKNWIVTGSDDMQVCVFNYNTLERFHSFEAHSDYVRCVAVHPTQPFLLTSSDDMLIKLWNWEKAWACQQVFEGHTHYVMQIVINPKDNNTFASASLDRTVKVWQLGSASPNFTLEGHEKGVNCVDYYHGGDKPYLISGADDRLVKIWDYQNKTCVQTLESGI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query229 2.2.26 [Sep-21-2011]
P35605 906 Coatomer subunit beta' OS yes N/A 0.751 0.189 0.872 1e-122
Q5R664 906 Coatomer subunit beta' OS yes N/A 0.751 0.189 0.872 1e-122
O55029 905 Coatomer subunit beta' OS yes N/A 0.751 0.190 0.872 1e-122
P35606 906 Coatomer subunit beta' OS yes N/A 0.751 0.189 0.872 1e-122
Q4R4I8 906 Coatomer subunit beta' OS N/A N/A 0.751 0.189 0.872 1e-122
O35142 905 Coatomer subunit beta' OS yes N/A 0.751 0.190 0.863 1e-120
O62621 914 Coatomer subunit beta' OS yes N/A 0.790 0.198 0.850 1e-120
Q20168 1000 Probable coatomer subunit yes N/A 0.986 0.226 0.783 1e-112
Q6H8D5 910 Coatomer subunit beta'-2 yes N/A 0.781 0.196 0.704 1e-102
Q6H8D6 910 Putative coatomer subunit yes N/A 0.790 0.198 0.696 1e-101
>sp|P35605|COPB2_BOVIN Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3 Back     alignment and function desciption
 Score =  437 bits (1123), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 198/227 (87%), Positives = 211/227 (92%)

Query: 1   MPLRLDIKRKLTARSDRVKCCDLHPTEPWMLASLYNGHVHVWNHETNQNVKSFEVCDLPV 60
           MPLRLDIKRKLTARSDRVK  DLHPTEPWMLASLYNG V VWNHET   VK+FEVCDLPV
Sbjct: 1   MPLRLDIKRKLTARSDRVKSVDLHPTEPWMLASLYNGSVCVWNHETQTLVKTFEVCDLPV 60

Query: 61  RAAKFVPRKNWIVTGSDDMQVCVFNYNTLERFHSFEAHSDYVRCVAVHPTQPFLLTSSDD 120
           RAAKFV RKNW+VTG+DDMQ+ VFNYNTLER H FEAHSDY+RC+AVHPTQPF+LTSSDD
Sbjct: 61  RAAKFVARKNWVVTGADDMQIRVFNYNTLERVHMFEAHSDYIRCIAVHPTQPFILTSSDD 120

Query: 121 MLIKLWNWEKAWACQQVFEGHTHYVMQIVINPKDNNTFASASLDRTVKVWQLGSASPNFT 180
           MLIKLW+W+K W+C QVFEGHTHYVMQIVINPKDNN FASASLDRT+KVWQLGS+SPNFT
Sbjct: 121 MLIKLWDWDKKWSCSQVFEGHTHYVMQIVINPKDNNQFASASLDRTIKVWQLGSSSPNFT 180

Query: 181 LEGHEKGVNCVDYYHGGDKPYLISGADDRLVKIWDYQNKTCVQTLES 227
           LEGHEKGVNC+DYY GGDKPYLISGADDRLVKIWDYQNKTCVQTLE 
Sbjct: 181 LEGHEKGVNCIDYYSGGDKPYLISGADDRLVKIWDYQNKTCVQTLEG 227




This coatomer complex protein, essential for Golgi budding and vesicular trafficking, is a selective binding protein (RACK) for protein kinase C, epsilon type. It binds to Golgi membranes in a GTP-dependent manner.
Bos taurus (taxid: 9913)
>sp|Q5R664|COPB2_PONAB Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1 Back     alignment and function description
>sp|O55029|COPB2_MOUSE Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=2 SV=2 Back     alignment and function description
>sp|P35606|COPB2_HUMAN Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2 Back     alignment and function description
>sp|Q4R4I8|COPB2_MACFA Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1 Back     alignment and function description
>sp|O35142|COPB2_RAT Coatomer subunit beta' OS=Rattus norvegicus GN=Copb2 PE=1 SV=3 Back     alignment and function description
>sp|O62621|COPB2_DROME Coatomer subunit beta' OS=Drosophila melanogaster GN=beta'Cop PE=2 SV=2 Back     alignment and function description
>sp|Q20168|COPB2_CAEEL Probable coatomer subunit beta' OS=Caenorhabditis elegans GN=F38E11.5 PE=3 SV=3 Back     alignment and function description
>sp|Q6H8D5|COB22_ORYSJ Coatomer subunit beta'-2 OS=Oryza sativa subsp. japonica GN=Os02g0209100 PE=2 SV=1 Back     alignment and function description
>sp|Q6H8D6|COB23_ORYSJ Putative coatomer subunit beta'-3 OS=Oryza sativa subsp. japonica GN=Os02g0209000 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query229
427788645 927 hypothetical protein [Rhipicephalus pulc 0.781 0.193 0.889 1e-123
241701693 927 vesicle coat complex COPI, beta' subunit 0.781 0.193 0.885 1e-122
242008111 989 Coatomer subunit beta', putative [Pedicu 0.759 0.175 0.881 1e-122
321478188 950 hypothetical protein DAPPUDRAFT_220713 [ 0.777 0.187 0.885 1e-122
345496540 932 PREDICTED: coatomer subunit beta' [Nason 0.790 0.194 0.881 1e-122
270007308 904 hypothetical protein TcasGA2_TC013867 [T 0.790 0.200 0.854 1e-121
307180125 938 Coatomer subunit beta' [Camponotus flori 0.991 0.242 0.876 1e-121
91082013 910 PREDICTED: similar to coatomer [Triboliu 0.790 0.198 0.850 1e-121
193664638 935 PREDICTED: coatomer subunit beta'-like [ 0.790 0.193 0.867 1e-120
334329688 913 PREDICTED: coatomer subunit beta'-like [ 0.751 0.188 0.872 1e-120
>gi|427788645|gb|JAA59774.1| hypothetical protein [Rhipicephalus pulchellus] Back     alignment and taxonomy information
 Score =  446 bits (1147), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 202/227 (88%), Positives = 213/227 (93%)

Query: 1   MPLRLDIKRKLTARSDRVKCCDLHPTEPWMLASLYNGHVHVWNHETNQNVKSFEVCDLPV 60
           MPL+LD+KRKL ARSDRVKC DLHPTEPWMLASLYNG+VHVWN E+ Q VK+FEVCDLPV
Sbjct: 1   MPLKLDVKRKLLARSDRVKCVDLHPTEPWMLASLYNGNVHVWNCESQQLVKTFEVCDLPV 60

Query: 61  RAAKFVPRKNWIVTGSDDMQVCVFNYNTLERFHSFEAHSDYVRCVAVHPTQPFLLTSSDD 120
           RAAKFVPRKNW++TGSDDMQV VFNYNTLER H FEAHSDY+R + VHPTQPF+LTSSDD
Sbjct: 61  RAAKFVPRKNWVITGSDDMQVRVFNYNTLERVHMFEAHSDYIRSIVVHPTQPFILTSSDD 120

Query: 121 MLIKLWNWEKAWACQQVFEGHTHYVMQIVINPKDNNTFASASLDRTVKVWQLGSASPNFT 180
           MLIKLWNWEK WAC QVFEGHTHYVMQIVINPKDNNTFASASLDRTVKVWQLGS +PNFT
Sbjct: 121 MLIKLWNWEKQWACTQVFEGHTHYVMQIVINPKDNNTFASASLDRTVKVWQLGSVTPNFT 180

Query: 181 LEGHEKGVNCVDYYHGGDKPYLISGADDRLVKIWDYQNKTCVQTLES 227
           LEGHEKGVNCVDYYHGGDKPYLISGADDRLVKIWDYQNKTCVQTLE 
Sbjct: 181 LEGHEKGVNCVDYYHGGDKPYLISGADDRLVKIWDYQNKTCVQTLEG 227




Source: Rhipicephalus pulchellus

Species: Rhipicephalus pulchellus

Genus: Rhipicephalus

Family: Ixodidae

Order: Ixodida

Class: Arachnida

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|241701693|ref|XP_002413181.1| vesicle coat complex COPI, beta' subunit, putative [Ixodes scapularis] gi|215506995|gb|EEC16489.1| vesicle coat complex COPI, beta' subunit, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|242008111|ref|XP_002424856.1| Coatomer subunit beta', putative [Pediculus humanus corporis] gi|212508406|gb|EEB12118.1| Coatomer subunit beta', putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|321478188|gb|EFX89146.1| hypothetical protein DAPPUDRAFT_220713 [Daphnia pulex] Back     alignment and taxonomy information
>gi|345496540|ref|XP_001603000.2| PREDICTED: coatomer subunit beta' [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|270007308|gb|EFA03756.1| hypothetical protein TcasGA2_TC013867 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307180125|gb|EFN68169.1| Coatomer subunit beta' [Camponotus floridanus] Back     alignment and taxonomy information
>gi|91082013|ref|XP_969905.1| PREDICTED: similar to coatomer [Tribolium castaneum] Back     alignment and taxonomy information
>gi|193664638|ref|XP_001947746.1| PREDICTED: coatomer subunit beta'-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|334329688|ref|XP_001375924.2| PREDICTED: coatomer subunit beta'-like [Monodelphis domestica] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query229
UNIPROTKB|E1C016 913 COPB2 "Uncharacterized protein 0.986 0.247 0.876 2.2e-112
UNIPROTKB|P35605 906 COPB2 "Coatomer subunit beta'" 0.986 0.249 0.876 2.2e-112
UNIPROTKB|E2R667 906 COPB2 "Uncharacterized protein 0.986 0.249 0.876 2.2e-112
UNIPROTKB|P35606 906 COPB2 "Coatomer subunit beta'" 0.986 0.249 0.876 2.2e-112
UNIPROTKB|F1SL54 906 COPB2 "Uncharacterized protein 0.986 0.249 0.876 2.2e-112
MGI|MGI:1354962 905 Copb2 "coatomer protein comple 0.986 0.249 0.876 2.2e-112
ZFIN|ZDB-GENE-010724-7 934 copb2 "coatomer protein comple 0.986 0.241 0.858 3.3e-111
RGD|628746 905 Copb2 "coatomer protein comple 0.986 0.249 0.867 5.3e-111
FB|FBgn0025724 914 beta'Cop "beta'-coatomer prote 0.986 0.247 0.853 1.1e-110
WB|WBGene00009542 1000 F38E11.5 [Caenorhabditis elega 0.986 0.226 0.783 1.4e-103
UNIPROTKB|E1C016 COPB2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 1109 (395.4 bits), Expect = 2.2e-112, P = 2.2e-112
 Identities = 198/226 (87%), Positives = 211/226 (93%)

Query:     1 MPLRLDIKRKLTARSDRVKCCDLHPTEPWMLASLYNGHVHVWNHETNQNVKSFEVCDLPV 60
             MPLRLDIKRKLTARSDRVK  DLHPTEPWMLASLYNG V VWNHET   VK+FEVCDLPV
Sbjct:     1 MPLRLDIKRKLTARSDRVKSVDLHPTEPWMLASLYNGSVCVWNHETQTLVKTFEVCDLPV 60

Query:    61 RAAKFVPRKNWIVTGSDDMQVCVFNYNTLERFHSFEAHSDYVRCVAVHPTQPFLLTSSDD 120
             RAAKFV RKNW+VTG+DDMQ+ VFNYNTLER H FEAHSDY+RC+AVHPTQPF+LTSSDD
Sbjct:    61 RAAKFVARKNWVVTGADDMQIRVFNYNTLERVHMFEAHSDYIRCIAVHPTQPFILTSSDD 120

Query:   121 MLIKLWNWEKAWACQQVFEGHTHYVMQIVINPKDNNTFASASLDRTVKVWQLGSASPNFT 180
             MLIKLW+W+K W+C QVFEGHTHYVMQIVINPKDNN FASASLDRT+KVWQLGS+SPNFT
Sbjct:   121 MLIKLWDWDKKWSCSQVFEGHTHYVMQIVINPKDNNQFASASLDRTIKVWQLGSSSPNFT 180

Query:   181 LEGHEKGVNCVDYYHGGDKPYLISGADDRLVKIWDYQNKTCVQTLE 226
             LEGHEKGVNC+DYY GGDKPYLISGADDRLVKIWDYQNKTCVQTLE
Sbjct:   181 LEGHEKGVNCIDYYSGGDKPYLISGADDRLVKIWDYQNKTCVQTLE 226


GO:0005198 "structural molecule activity" evidence=IEA
GO:0006886 "intracellular protein transport" evidence=IEA
GO:0006891 "intra-Golgi vesicle-mediated transport" evidence=IEA
GO:0015629 "actin cytoskeleton" evidence=IEA
GO:0030126 "COPI vesicle coat" evidence=IEA
UNIPROTKB|P35605 COPB2 "Coatomer subunit beta'" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R667 COPB2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P35606 COPB2 "Coatomer subunit beta'" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SL54 COPB2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1354962 Copb2 "coatomer protein complex, subunit beta 2 (beta prime)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-010724-7 copb2 "coatomer protein complex, subunit beta 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|628746 Copb2 "coatomer protein complex, subunit beta 2 (beta prime)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0025724 beta'Cop "beta'-coatomer protein" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00009542 F38E11.5 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P35605COPB2_BOVINNo assigned EC number0.87220.75100.1898yesN/A
P35606COPB2_HUMANNo assigned EC number0.87220.75100.1898yesN/A
P41811COPB2_YEASTNo assigned EC number0.59730.98250.2530yesN/A
O35142COPB2_RATNo assigned EC number0.86340.75100.1900yesN/A
Q6H8D6COB23_ORYSJNo assigned EC number0.69600.79030.1989yesN/A
Q6H8D5COB22_ORYSJNo assigned EC number0.70480.78160.1967yesN/A
O42937COPB2_SCHPONo assigned EC number0.60440.96060.2763yesN/A
O55029COPB2_MOUSENo assigned EC number0.87220.75100.1900yesN/A
Q5R664COPB2_PONABNo assigned EC number0.87220.75100.1898yesN/A
Q8L828COB23_ARATHNo assigned EC number0.69600.79030.1991yesN/A
Q20168COPB2_CAEELNo assigned EC number0.78310.98680.226yesN/A
Q5VQ78COB21_ORYSJNo assigned EC number0.66960.78160.1973yesN/A
Q54YD8COPB2_DICDINo assigned EC number0.68720.98680.2248yesN/A
O62621COPB2_DROMENo assigned EC number0.85020.79030.1980yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query229
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 6e-52
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 7e-46
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-43
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-26
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-22
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-22
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 4e-20
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 4e-20
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-18
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 4e-09
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 2e-07
smart0032040 smart00320, WD40, WD40 repeats 4e-07
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 2e-06
smart0032040 smart00320, WD40, WD40 repeats 7e-06
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 9e-06
smart0032040 smart00320, WD40, WD40 repeats 2e-05
PTZ00420 568 PTZ00420, PTZ00420, coronin; Provisional 4e-05
PTZ00421 493 PTZ00421, PTZ00421, coronin; Provisional 3e-04
PTZ00421 493 PTZ00421, PTZ00421, coronin; Provisional 8e-04
COG5170 460 COG5170, CDC55, Serine/threonine protein phosphata 0.002
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
 Score =  169 bits (430), Expect = 6e-52
 Identities = 65/220 (29%), Positives = 102/220 (46%), Gaps = 4/220 (1%)

Query: 8   KRKLTARSDRVKCCDLHPTEPWMLASLYNGHVHVWNHETNQNVKSFEVCDLPVRAAKFVP 67
           +R L   +  V C    P    +     +G + VW+ ET + +++ +    PVR      
Sbjct: 2   RRTLKGHTGGVTCVAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDVAASA 61

Query: 68  RKNWIVTGSDDMQVCVFNYNTLERFHSFEAHSDYVRCVAVHPTQPFLLTSSDDMLIKLWN 127
              ++ +GS D  + +++  T E   +   H+ YV  VA  P    L +SS D  IK+W+
Sbjct: 62  DGTYLASGSSDKTIRLWDLETGECVRTLTGHTSYVSSVAFSPDGRILSSSSRDKTIKVWD 121

Query: 128 WEKAWACQQVFEGHTHYVMQIVINPKDNNTFASASLDRTVKVWQLGSASPNFTLEGHEKG 187
            E    C     GHT +V  +  +P D    AS+S D T+K+W L +     TL GH   
Sbjct: 122 VETG-KCLTTLRGHTDWVNSVAFSP-DGTFVASSSQDGTIKLWDLRTGKCVATLTGHTGE 179

Query: 188 VNCVDYYHGGDKPYLISGADDRLVKIWDYQNKTCVQTLES 227
           VN V +   G+K  L+S + D  +K+WD     C+ TL  
Sbjct: 180 VNSVAFSPDGEK--LLSSSSDGTIKLWDLSTGKCLGTLRG 217


Length = 289

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|240412 PTZ00420, PTZ00420, coronin; Provisional Back     alignment and domain information
>gnl|CDD|173611 PTZ00421, PTZ00421, coronin; Provisional Back     alignment and domain information
>gnl|CDD|173611 PTZ00421, PTZ00421, coronin; Provisional Back     alignment and domain information
>gnl|CDD|227498 COG5170, CDC55, Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 229
KOG0276|consensus 794 100.0
KOG0272|consensus459 100.0
KOG0272|consensus459 100.0
KOG0271|consensus480 100.0
KOG0263|consensus707 100.0
KOG0286|consensus343 100.0
KOG0279|consensus315 100.0
KOG0279|consensus315 100.0
KOG0271|consensus480 100.0
KOG0295|consensus406 100.0
KOG0645|consensus312 100.0
KOG0266|consensus456 100.0
KOG0266|consensus456 100.0
KOG0286|consensus343 100.0
KOG0263|consensus707 100.0
KOG0315|consensus311 100.0
KOG0284|consensus 464 100.0
KOG0273|consensus524 100.0
KOG0295|consensus406 100.0
KOG0285|consensus460 100.0
KOG0292|consensus 1202 100.0
PTZ00421 493 coronin; Provisional 100.0
KOG0291|consensus 893 100.0
KOG0292|consensus 1202 100.0
KOG0281|consensus499 100.0
KOG0316|consensus307 100.0
KOG0276|consensus 794 100.0
KOG0296|consensus 399 100.0
KOG0265|consensus338 100.0
KOG0282|consensus503 100.0
KOG0284|consensus 464 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0277|consensus311 100.0
KOG0319|consensus 775 100.0
KOG0282|consensus503 100.0
PTZ00420 568 coronin; Provisional 100.0
KOG0645|consensus312 100.0
KOG0285|consensus460 100.0
KOG0281|consensus499 100.0
KOG0315|consensus311 100.0
KOG0319|consensus 775 100.0
KOG0293|consensus519 100.0
KOG0277|consensus311 100.0
KOG0275|consensus508 100.0
KOG0274|consensus537 100.0
PLN00181793 protein SPA1-RELATED; Provisional 100.0
KOG0291|consensus 893 99.98
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.98
KOG0294|consensus362 99.98
KOG0273|consensus524 99.98
KOG0313|consensus423 99.97
KOG0310|consensus 487 99.97
KOG0265|consensus338 99.97
PLN00181793 protein SPA1-RELATED; Provisional 99.97
KOG0264|consensus422 99.97
KOG0274|consensus 537 99.97
KOG0296|consensus399 99.97
PTZ00421 493 coronin; Provisional 99.97
KOG1446|consensus311 99.97
PTZ00420 568 coronin; Provisional 99.97
KOG0640|consensus430 99.97
KOG0643|consensus327 99.97
KOG0318|consensus 603 99.97
KOG0318|consensus 603 99.97
KOG0313|consensus423 99.96
KOG0283|consensus 712 99.96
KOG0310|consensus 487 99.96
KOG0283|consensus 712 99.96
KOG0264|consensus422 99.96
KOG0300|consensus481 99.96
KOG0643|consensus327 99.96
KOG0289|consensus506 99.96
KOG0640|consensus430 99.96
KOG0306|consensus 888 99.96
KOG0299|consensus 479 99.96
KOG0299|consensus479 99.96
KOG0308|consensus 735 99.96
KOG0306|consensus 888 99.96
KOG0267|consensus 825 99.96
KOG0646|consensus 476 99.95
KOG0305|consensus484 99.95
KOG0305|consensus484 99.95
KOG0269|consensus 839 99.95
KOG0268|consensus433 99.95
KOG0973|consensus 942 99.95
KOG0300|consensus481 99.95
KOG0278|consensus334 99.95
KOG0289|consensus506 99.95
KOG0772|consensus 641 99.95
KOG0275|consensus508 99.95
KOG0647|consensus347 99.95
KOG0278|consensus 334 99.95
KOG0308|consensus 735 99.94
KOG1407|consensus313 99.94
KOG0288|consensus459 99.94
KOG0267|consensus 825 99.94
KOG0302|consensus440 99.94
KOG0269|consensus 839 99.94
KOG0316|consensus 307 99.94
KOG0641|consensus350 99.94
KOG0301|consensus 745 99.94
KOG0973|consensus 942 99.94
KOG1332|consensus299 99.93
KOG1332|consensus299 99.93
KOG0301|consensus 745 99.93
KOG4283|consensus 397 99.93
KOG0772|consensus 641 99.93
KOG0270|consensus463 99.93
KOG1407|consensus313 99.93
KOG0293|consensus519 99.93
KOG0270|consensus463 99.93
KOG1036|consensus323 99.92
KOG1446|consensus311 99.92
KOG0288|consensus459 99.92
KOG0642|consensus577 99.92
KOG0647|consensus347 99.92
KOG4328|consensus498 99.91
KOG2445|consensus361 99.91
KOG1007|consensus370 99.91
KOG0302|consensus440 99.91
KOG4378|consensus 673 99.91
KOG0307|consensus 1049 99.9
KOG2096|consensus420 99.9
KOG1274|consensus 933 99.9
KOG1408|consensus 1080 99.9
KOG2919|consensus406 99.9
KOG0639|consensus705 99.89
KOG1063|consensus764 99.89
KOG0641|consensus350 99.89
KOG1273|consensus 405 99.89
KOG0307|consensus 1049 99.89
KOG4283|consensus397 99.89
KOG1408|consensus 1080 99.89
KOG1036|consensus 323 99.88
KOG0321|consensus 720 99.88
KOG0294|consensus 362 99.88
KOG2048|consensus 691 99.88
KOG0646|consensus 476 99.87
KOG0303|consensus 472 99.87
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.87
KOG2048|consensus 691 99.87
KOG0650|consensus733 99.87
KOG0290|consensus364 99.86
KOG0639|consensus705 99.86
KOG2106|consensus626 99.86
KOG1310|consensus 758 99.86
KOG2106|consensus 626 99.86
KOG1007|consensus370 99.85
KOG0322|consensus323 99.85
KOG1034|consensus385 99.85
KOG4328|consensus498 99.85
KOG1539|consensus 910 99.85
KOG1188|consensus 376 99.85
KOG1034|consensus385 99.85
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.84
KOG0649|consensus325 99.84
COG2319466 FOG: WD40 repeat [General function prediction only 99.84
KOG0268|consensus433 99.83
KOG4378|consensus 673 99.83
KOG0321|consensus 720 99.83
KOG1539|consensus 910 99.82
KOG1063|consensus 764 99.82
COG2319 466 FOG: WD40 repeat [General function prediction only 99.82
KOG2055|consensus514 99.82
KOG0644|consensus 1113 99.82
KOG1273|consensus405 99.82
KOG2919|consensus406 99.82
KOG2096|consensus420 99.82
KOG1274|consensus 933 99.81
KOG0303|consensus 472 99.8
KOG4227|consensus 609 99.8
KOG1587|consensus555 99.79
KOG0649|consensus325 99.79
KOG1188|consensus376 99.78
KOG2055|consensus514 99.77
KOG1445|consensus 1012 99.77
KOG0650|consensus733 99.77
KOG1538|consensus 1081 99.76
PRK01742429 tolB translocation protein TolB; Provisional 99.76
KOG1009|consensus 434 99.76
KOG1517|consensus1387 99.75
KOG1009|consensus 434 99.75
KOG0771|consensus398 99.74
KOG1240|consensus1431 99.73
KOG2445|consensus361 99.73
KOG1523|consensus 361 99.72
KOG0290|consensus364 99.72
KOG0322|consensus323 99.72
KOG1524|consensus 737 99.71
KOG2394|consensus 636 99.7
KOG1445|consensus 1012 99.7
KOG1272|consensus 545 99.7
KOG1334|consensus 559 99.69
KOG1310|consensus 758 99.67
KOG0642|consensus577 99.67
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.65
KOG2394|consensus 636 99.65
KOG1587|consensus555 99.65
KOG2110|consensus 391 99.64
KOG0974|consensus 967 99.64
KOG2110|consensus391 99.63
KOG1523|consensus361 99.62
KOG1064|consensus2439 99.62
PRK11028330 6-phosphogluconolactonase; Provisional 99.62
KOG3881|consensus412 99.61
KOG1524|consensus 737 99.61
PRK11028330 6-phosphogluconolactonase; Provisional 99.59
KOG1517|consensus1387 99.58
KOG0771|consensus398 99.58
KOG2321|consensus 703 99.58
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.58
PRK02889427 tolB translocation protein TolB; Provisional 99.58
PRK03629429 tolB translocation protein TolB; Provisional 99.58
KOG3881|consensus412 99.57
KOG1409|consensus404 99.57
KOG1963|consensus 792 99.57
KOG1963|consensus 792 99.56
KOG1409|consensus 404 99.56
PRK04922433 tolB translocation protein TolB; Provisional 99.56
KOG4227|consensus 609 99.56
PRK05137435 tolB translocation protein TolB; Provisional 99.55
KOG2321|consensus 703 99.53
PRK01742429 tolB translocation protein TolB; Provisional 99.51
KOG0644|consensus 1113 99.5
KOG2111|consensus346 99.49
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.48
KOG4547|consensus 541 99.48
KOG2139|consensus445 99.46
KOG1354|consensus 433 99.46
KOG1272|consensus 545 99.46
KOG0974|consensus 967 99.45
KOG0280|consensus339 99.45
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.45
KOG1538|consensus 1081 99.45
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.45
KOG0280|consensus339 99.44
KOG2139|consensus445 99.44
KOG3914|consensus 390 99.42
KOG2111|consensus 346 99.39
PRK00178430 tolB translocation protein TolB; Provisional 99.38
KOG1240|consensus 1431 99.36
KOG4714|consensus319 99.36
PRK02889427 tolB translocation protein TolB; Provisional 99.36
PRK05137435 tolB translocation protein TolB; Provisional 99.32
PRK03629429 tolB translocation protein TolB; Provisional 99.32
PRK01029428 tolB translocation protein TolB; Provisional 99.31
KOG3914|consensus 390 99.3
PRK04922433 tolB translocation protein TolB; Provisional 99.3
KOG4497|consensus 447 99.29
KOG2695|consensus425 99.28
PRK04792448 tolB translocation protein TolB; Provisional 99.28
KOG1334|consensus 559 99.27
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.22
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 99.2
KOG4547|consensus 541 99.2
KOG0309|consensus 1081 99.2
KOG0309|consensus 1081 99.2
KOG1064|consensus2439 99.17
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.11
KOG4532|consensus344 99.1
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.09
PRK01029428 tolB translocation protein TolB; Provisional 99.07
KOG2695|consensus425 99.07
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.06
KOG4190|consensus1034 99.03
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 99.02
PRK00178430 tolB translocation protein TolB; Provisional 99.02
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 99.01
KOG4497|consensus447 98.99
KOG4190|consensus 1034 98.99
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.99
KOG1354|consensus 433 98.99
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.94
KOG1912|consensus 1062 98.94
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.93
KOG4714|consensus319 98.91
KOG1832|consensus 1516 98.86
PRK04792448 tolB translocation protein TolB; Provisional 98.86
KOG0882|consensus 558 98.84
PRK04043419 tolB translocation protein TolB; Provisional 98.83
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.83
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.82
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.82
TIGR03300 377 assembly_YfgL outer membrane assembly lipoprotein 98.81
KOG2315|consensus566 98.79
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.78
KOG2315|consensus 566 98.77
TIGR02658 352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.76
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.74
KOG2066|consensus 846 98.72
KOG4532|consensus344 98.72
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.71
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.71
KOG1275|consensus 1118 98.69
KOG2114|consensus 933 98.65
KOG1912|consensus 1062 98.65
KOG1008|consensus 783 98.64
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.63
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.63
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.61
COG4946 668 Uncharacterized protein related to the periplasmic 98.61
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.57
KOG1920|consensus 1265 98.57
COG4946668 Uncharacterized protein related to the periplasmic 98.56
KOG1645|consensus463 98.54
KOG3621|consensus 726 98.53
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.51
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.5
KOG2041|consensus 1189 98.47
KOG1008|consensus 783 98.47
KOG2114|consensus 933 98.44
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 98.43
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.42
KOG0882|consensus 558 98.42
PRK11138 394 outer membrane biogenesis protein BamB; Provisiona 98.38
KOG2041|consensus 1189 98.33
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.33
KOG1832|consensus 1516 98.32
PRK04043419 tolB translocation protein TolB; Provisional 98.32
KOG1275|consensus 1118 98.29
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.28
KOG2066|consensus 846 98.28
KOG1645|consensus463 98.25
KOG4640|consensus 665 98.23
KOG3617|consensus 1416 98.21
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 98.2
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.2
KOG2444|consensus238 98.15
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.1
COG3204316 Uncharacterized protein conserved in bacteria [Fun 98.1
KOG4640|consensus 665 98.08
smart0032040 WD40 WD40 repeats. Note that these repeats are per 98.05
KOG3617|consensus 1416 98.04
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 97.99
KOG2314|consensus 698 97.93
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.88
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.87
PRK02888 635 nitrous-oxide reductase; Validated 97.86
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.86
KOG2314|consensus 698 97.82
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 97.76
KOG1920|consensus 1265 97.76
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.71
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.71
COG3490366 Uncharacterized protein conserved in bacteria [Fun 97.69
KOG4649|consensus354 97.64
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.63
KOG2444|consensus238 97.59
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.55
PRK02888 635 nitrous-oxide reductase; Validated 97.54
KOG3621|consensus 726 97.48
KOG2395|consensus644 97.43
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.43
PF03178 321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.41
PHA02713557 hypothetical protein; Provisional 97.31
PRK13616591 lipoprotein LpqB; Provisional 97.31
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.27
KOG2079|consensus 1206 97.24
PF00930 353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 97.24
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.2
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 97.2
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 97.18
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 97.18
KOG4649|consensus 354 97.1
COG3391381 Uncharacterized conserved protein [Function unknow 97.09
KOG2395|consensus 644 97.08
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.07
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 97.05
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.03
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 97.03
KOG2079|consensus 1206 96.96
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 96.8
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 96.75
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 96.69
COG3391381 Uncharacterized conserved protein [Function unknow 96.66
COG0823425 TolB Periplasmic component of the Tol biopolymer t 96.56
COG3386307 Gluconolactonase [Carbohydrate transport and metab 96.51
PHA02713557 hypothetical protein; Provisional 96.47
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 96.43
COG3386307 Gluconolactonase [Carbohydrate transport and metab 96.39
PHA03098534 kelch-like protein; Provisional 96.29
KOG1916|consensus 1283 96.24
KOG4441|consensus571 96.18
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 96.1
PRK13684334 Ycf48-like protein; Provisional 95.9
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 95.83
KOG4441|consensus571 95.76
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 95.75
KOG4499|consensus310 95.75
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 95.7
PRK13616591 lipoprotein LpqB; Provisional 95.68
KOG4499|consensus310 95.6
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 95.5
KOG1897|consensus1096 95.42
PHA02790480 Kelch-like protein; Provisional 95.36
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 95.3
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 95.11
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 95.01
KOG2377|consensus 657 95.0
PF06433 342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 94.81
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 94.69
KOG1900|consensus 1311 94.24
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 94.21
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 94.09
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 94.01
KOG2377|consensus 657 93.91
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 93.88
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 93.87
PF05694 461 SBP56: 56kDa selenium binding protein (SBP56); Int 93.79
COG5167776 VID27 Protein involved in vacuole import and degra 93.75
KOG1983|consensus 993 93.74
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 93.64
PRK10115 686 protease 2; Provisional 93.58
KOG3630|consensus 1405 93.57
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 93.22
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 93.15
COG3490366 Uncharacterized protein conserved in bacteria [Fun 93.1
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 93.08
KOG4460|consensus 741 93.02
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 92.84
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 92.81
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 92.66
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 92.5
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 92.48
PF14583 386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 92.07
PHA03098534 kelch-like protein; Provisional 91.99
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 91.96
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 91.89
COG5167 776 VID27 Protein involved in vacuole import and degra 91.79
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 91.62
COG1520370 FOG: WD40-like repeat [Function unknown] 91.58
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 91.21
PHA02790480 Kelch-like protein; Provisional 90.32
KOG3630|consensus 1405 90.2
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 89.56
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 89.44
KOG1900|consensus 1311 88.75
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 88.37
smart0056433 PQQ beta-propeller repeat. Beta-propeller repeat o 88.1
PF12768 281 Rax2: Cortical protein marker for cell polarity 87.87
KOG2247|consensus 615 86.64
PLN00033398 photosystem II stability/assembly factor; Provisio 86.43
PF0101138 PQQ: PQQ enzyme repeat family.; InterPro: IPR00237 86.02
PF07995 331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 85.76
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 85.51
smart0056433 PQQ beta-propeller repeat. Beta-propeller repeat o 85.5
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 84.48
COG4590 733 ABC-type uncharacterized transport system, permeas 84.39
KOG1896|consensus 1366 84.33
PF12768281 Rax2: Cortical protein marker for cell polarity 84.26
PF0101138 PQQ: PQQ enzyme repeat family.; InterPro: IPR00237 84.03
KOG1916|consensus 1283 83.73
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 83.72
KOG3616|consensus 1636 83.34
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 82.94
COG3204316 Uncharacterized protein conserved in bacteria [Fun 81.14
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 80.17
PRK13684334 Ycf48-like protein; Provisional 80.06
>KOG0276|consensus Back     alignment and domain information
Probab=100.00  E-value=1.6e-50  Score=326.58  Aligned_cols=225  Identities=74%  Similarity=1.287  Sum_probs=220.8

Q ss_pred             cchhhhhcccCCCceEEEEEccCCCeEEEEEecCeEEEEEcCCCCeEEEEEecCcCeEEEEEcCCCCEEEEEeCCCeEEE
Q psy4653           4 RLDIKRKLTARSDRVKCCDLHPTEPWMLASLYNGHVHVWNHETNQNVKSFEVCDLPVRAAKFVPRKNWIVTGSDDMQVCV   83 (229)
Q Consensus         4 ~~~~~~~~~~~~~~v~~~~~~p~~~~l~~~~~dg~v~~wd~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~sg~~d~~i~i   83 (229)
                      |+++++++..|+++|.+++|||..|+++++-..|.|.|||.++...++.+...+.||++..|.+..+++++|++|+.|++
T Consensus         2 ~l~~krk~~~rSdRVKsVd~HPtePw~la~LynG~V~IWnyetqtmVksfeV~~~PvRa~kfiaRknWiv~GsDD~~IrV   81 (794)
T KOG0276|consen    2 KLDFKRKFQSRSDRVKSVDFHPTEPWILAALYNGDVQIWNYETQTMVKSFEVSEVPVRAAKFIARKNWIVTGSDDMQIRV   81 (794)
T ss_pred             cchhhhHhhccCCceeeeecCCCCceEEEeeecCeeEEEecccceeeeeeeecccchhhheeeeccceEEEecCCceEEE
Confidence            67889999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EECCCcceEEEeccCCCceeEEEEcCCCCEEEEEeCCCcEEEEecCCceeeeeeeecceeeEEEEEEcCCCCCEEEEEEC
Q psy4653          84 FNYNTLERFHSFEAHSDYVRCVAVHPTQPFLLTSSDDMLIKLWNWEKAWACQQVFEGHTHYVMQIVINPKDNNTFASASL  163 (229)
Q Consensus        84 wd~~~~~~~~~~~~h~~~i~~v~~~~~~~~~~s~~~d~~v~lwd~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~l~s~~~  163 (229)
                      |+.++++.++.|.+|.+.|+|++.||+.++++|+|.|-+|++||++..+.+.++|+||.++|++++|+|.|.+.|+|++.
T Consensus        82 fnynt~ekV~~FeAH~DyIR~iavHPt~P~vLtsSDDm~iKlW~we~~wa~~qtfeGH~HyVMqv~fnPkD~ntFaS~sL  161 (794)
T KOG0276|consen   82 FNYNTGEKVKTFEAHSDYIRSIAVHPTLPYVLTSSDDMTIKLWDWENEWACEQTFEGHEHYVMQVAFNPKDPNTFASASL  161 (794)
T ss_pred             EecccceeeEEeeccccceeeeeecCCCCeEEecCCccEEEEeeccCceeeeeEEcCcceEEEEEEecCCCccceeeeec
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcEEEEeCCCCCceEEEecCCCceEEEEEEeCCCcCEEEEeeCCCeEEEEECCCCeEEEeeccC
Q psy4653         164 DRTVKVWQLGSASPNFTLEGHEKGVNCVDYYHGGDKPYLISGADDRLVKIWDYQNKTCVQTLESG  228 (229)
Q Consensus       164 d~~i~~wd~~~~~~~~~~~~h~~~v~~~~~~~~~~~~~l~s~s~d~~i~iwd~~~~~~~~~~~~~  228 (229)
                      |++|++|.+.+..+.+++++|..+|+|++|++.+++++|+||++|.+|+|||+++..|++|+++|
T Consensus       162 DrTVKVWslgs~~~nfTl~gHekGVN~Vdyy~~gdkpylIsgaDD~tiKvWDyQtk~CV~TLeGH  226 (794)
T KOG0276|consen  162 DRTVKVWSLGSPHPNFTLEGHEKGVNCVDYYTGGDKPYLISGADDLTIKVWDYQTKSCVQTLEGH  226 (794)
T ss_pred             cccEEEEEcCCCCCceeeeccccCcceEEeccCCCcceEEecCCCceEEEeecchHHHHHHhhcc
Confidence            99999999999999999999999999999999999999999999999999999999999999987



>KOG0272|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG1900|consensus Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1983|consensus Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>KOG1900|consensus Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>smart00564 PQQ beta-propeller repeat Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PF01011 PQQ: PQQ enzyme repeat family Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>smart00564 PQQ beta-propeller repeat Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>KOG1896|consensus Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF01011 PQQ: PQQ enzyme repeat family Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query229
3mkq_A 814 Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subco 8e-85
2ynp_A 604 Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 3e-84
2yno_A310 Yeast Betaprime Cop 1-304h6 Length = 310 2e-83
2ynn_A304 Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 2e-83
2ymu_A577 Structure Of A Highly Repetitive Propeller Structur 3e-18
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 1e-17
1vyh_C 410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 4e-12
2pbi_B354 The Multifunctional Nature Of Gbeta5RGS9 REVEALED F 2e-15
2pbi_B 354 The Multifunctional Nature Of Gbeta5RGS9 REVEALED F 1e-05
2ovp_B445 Structure Of The Skp1-Fbw7 Complex Length = 445 2e-14
3ow8_A321 Crystal Structure Of The Wd Repeat-Containing Prote 5e-14
3ow8_A 321 Crystal Structure Of The Wd Repeat-Containing Prote 6e-06
3ow8_A 321 Crystal Structure Of The Wd Repeat-Containing Prote 1e-04
3iz6_a380 Localization Of The Small Subunit Ribosomal Protein 5e-14
2g9a_A311 Structural Basis For The Specific Recognition Of Me 1e-13
2g9a_A 311 Structural Basis For The Specific Recognition Of Me 3e-08
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 1e-13
3emh_A 318 Structural Basis Of Wdr5-Mll Interaction Length = 3 3e-08
2h9l_A329 Wdr5delta23 Length = 329 1e-13
2h9l_A 329 Wdr5delta23 Length = 329 3e-08
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 1e-13
3psl_A 318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 3e-08
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 1e-13
4a7j_A 318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 3e-08
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 1e-13
3smr_A 312 Crystal Structure Of Human Wd Repeat Domain 5 With 3e-08
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 1e-13
2h68_A 312 Histone H3 Recognition And Presentation By The Wdr5 3e-08
2g99_A308 Structural Basis For The Specific Recognition Of Me 1e-13
2g99_A 308 Structural Basis For The Specific Recognition Of Me 3e-08
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 1e-13
2h9m_A 313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 3e-08
2gnq_A336 Structure Of Wdr5 Length = 336 1e-13
2gnq_A 336 Structure Of Wdr5 Length = 336 3e-08
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 1e-13
2h13_A 317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 3e-08
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 1e-13
3n0e_A 315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 4e-08
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 1e-13
3mxx_A 315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 8e-08
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 1e-13
3n0d_A 315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 4e-08
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 1e-13
2xl2_A 334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 3e-08
3zey_7318 High-resolution Cryo-electron Microscopy Structure 3e-13
3dm0_A694 Maltose Binding Protein Fusion With Rack1 From A. T 4e-13
3dm0_A694 Maltose Binding Protein Fusion With Rack1 From A. T 7e-09
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 4e-13
2cnx_A 315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 5e-08
1p22_A435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 6e-13
1p22_A 435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 4e-04
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 2e-12
2co0_A 315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 5e-08
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 2e-12
1erj_A 393 Crystal Structure Of The C-Terminal Wd40 Domain Of 1e-09
3fm0_A 345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 5e-12
2zkq_a317 Structure Of A Mammalian Ribosomal 40s Subunit With 2e-11
2zkq_a317 Structure Of A Mammalian Ribosomal 40s Subunit With 3e-11
4aow_A340 Crystal Structure Of The Human Rack1 Protein At A R 2e-11
4aow_A340 Crystal Structure Of The Human Rack1 Protein At A R 4e-11
1got_B340 Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimer 2e-11
1got_B 340 Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimer 8e-05
1a0r_B340 Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA- 3e-11
1a0r_B 340 Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA- 9e-05
3sn6_B351 Crystal Structure Of The Beta2 Adrenergic Receptor- 3e-11
3sn6_B 351 Crystal Structure Of The Beta2 Adrenergic Receptor- 4e-05
1gg2_B340 G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet 3e-11
1gg2_B 340 G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet 4e-05
2bcj_B340 Crystal Structure Of G Protein-coupled Receptor Kin 4e-11
2bcj_B 340 Crystal Structure Of G Protein-coupled Receptor Kin 4e-05
3c99_A432 Structural Basis Of Histone H4 Recognition By P55 L 8e-11
2xyi_A430 Crystal Structure Of Nurf55 In Complex With A H4 Pe 9e-11
2yba_A422 Crystal Structure Of Nurf55 In Complex With Histone 9e-11
3gfc_A425 Crystal Structure Of Histone-Binding Protein Rbbp4 2e-10
3iza_B1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 2e-09
3iza_B 1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 2e-05
3cfs_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 2e-09
3sfz_A1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 3e-09
3sfz_A 1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 7e-06
3shf_A1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 3e-09
3shf_A 1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 7e-06
3cfv_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 4e-09
3acp_A 417 Crystal Structure Of Yeast Rpn14, A Chaperone Of Th 6e-09
3vl1_A 420 Crystal Structure Of Yeast Rpn14 Length = 420 7e-09
3frx_A319 Crystal Structure Of The Yeast Orthologue Of Rack1, 6e-08
3jyv_R313 Structure Of The 40s Rrna And Proteins And PE TRNA 6e-08
1trj_A314 Homology Model Of Yeast Rack1 Protein Fitted Into 1 7e-08
3izb_a319 Localization Of The Small Subunit Ribosomal Protein 7e-08
3rfg_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 7e-08
3rfh_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 7e-08
2aq5_A 402 Crystal Structure Of Murine Coronin-1 Length = 402 3e-07
3mks_B 464 Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH 7e-07
1nex_B 464 Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp 8e-07
2hes_X330 Cytosolic Iron-sulphur Assembly Protein- 1 Length = 8e-07
2b4e_A 402 Crystal Structure Of Murine Coronin-1: Monoclinic F 8e-07
3odt_A313 Crystal Structure Of Wd40 Beta Propeller Domain Of 2e-06
1nr0_A 611 Two Seven-Bladed Beta-Propeller Domains Revealed By 2e-06
2xzm_R343 Crystal Structure Of The Eukaryotic 40s Ribosomal S 8e-06
4g56_B357 Crystal Structure Of Full Length Prmt5/mep50 Comple 1e-04
4a11_B 408 Structure Of The Hsddb1-Hscsa Complex Length = 408 4e-04
4gqb_B344 Crystal Structure Of The Human Prmt5:mep50 Complex 6e-04
2qxv_A 361 Structural Basis Of Ezh2 Recognition By Eed Length 8e-04
3jpx_A 402 Eed: A Novel Histone Trimethyllysine Binder Within 9e-04
>pdb|3MKQ|A Chain A, Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subcomplex Of The Copi Vesicular Coat Length = 814 Back     alignment and structure

Iteration: 1

Score = 309 bits (792), Expect = 8e-85, Method: Compositional matrix adjust. Identities = 135/226 (59%), Positives = 172/226 (76%), Gaps = 1/226 (0%) Query: 3 LRLDIKRKLTARSDRVKCCDLHPTEPWMLASLYNGHVHVWNHETNQNVKSFEVCDLPVRA 62 ++LDIK+ + RSDRVK D HPTEPW+L +LY+G V +WN+ET V+S +V + PVRA Sbjct: 1 MKLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVRA 60 Query: 63 AKFVPRKNWIVTGSDDMQVCVFNYNTLERFHSFEAHSDYVRCVAVHPTQPFLLTSSDDML 122 KF+ RKNWI+ GSDD ++ VFNYNT E+ FEAH DY+R +AVHPT+P++L+ SDD+ Sbjct: 61 GKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLT 120 Query: 123 IKLWNWEKAWACQQVFEGHTHYVMQIVINPKDNNTFASASLDRTVKVWQLGSASPNFTL- 181 +KLWNWE WA +Q FEGH H+VM + NPKD +TFAS LDRTVKVW LG ++PNFTL Sbjct: 121 VKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLT 180 Query: 182 EGHEKGVNCVDYYHGGDKPYLISGADDRLVKIWDYQNKTCVQTLES 227 G E+GVN VDYY DKPY+I+ +DD +KIWDYQ K+CV TLE Sbjct: 181 TGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEG 226
>pdb|2YNP|A Chain A, Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 604 Back     alignment and structure
>pdb|2YNO|A Chain A, Yeast Betaprime Cop 1-304h6 Length = 310 Back     alignment and structure
>pdb|2YNN|A Chain A, Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 304 Back     alignment and structure
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|2PBI|B Chain B, The Multifunctional Nature Of Gbeta5RGS9 REVEALED FROM ITS CRYSTAL Structure Length = 354 Back     alignment and structure
>pdb|2PBI|B Chain B, The Multifunctional Nature Of Gbeta5RGS9 REVEALED FROM ITS CRYSTAL Structure Length = 354 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|3OW8|A Chain A, Crystal Structure Of The Wd Repeat-Containing Protein 61 Length = 321 Back     alignment and structure
>pdb|3OW8|A Chain A, Crystal Structure Of The Wd Repeat-Containing Protein 61 Length = 321 Back     alignment and structure
>pdb|3OW8|A Chain A, Crystal Structure Of The Wd Repeat-Containing Protein 61 Length = 321 Back     alignment and structure
>pdb|3IZ6|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 380 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|3ZEY|7 Chain 7, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 318 Back     alignment and structure
>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana Length = 694 Back     alignment and structure
>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana Length = 694 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure
>pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 Back     alignment and structure
>pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 Back     alignment and structure
>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution Of 2.45 Angstrom Length = 340 Back     alignment and structure
>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution Of 2.45 Angstrom Length = 340 Back     alignment and structure
>pdb|1GOT|B Chain B, Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimera And The Gt-Beta-Gamma Subunits Length = 340 Back     alignment and structure
>pdb|1GOT|B Chain B, Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimera And The Gt-Beta-Gamma Subunits Length = 340 Back     alignment and structure
>pdb|1A0R|B Chain B, Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA-Gamma Length = 340 Back     alignment and structure
>pdb|1A0R|B Chain B, Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA-Gamma Length = 340 Back     alignment and structure
>pdb|3SN6|B Chain B, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 351 Back     alignment and structure
>pdb|3SN6|B Chain B, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 351 Back     alignment and structure
>pdb|1GG2|B Chain B, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 340 Back     alignment and structure
>pdb|1GG2|B Chain B, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 340 Back     alignment and structure
>pdb|2BCJ|B Chain B, Crystal Structure Of G Protein-coupled Receptor Kinase 2 In Complex With Galpha-q And Gbetagamma Subunits Length = 340 Back     alignment and structure
>pdb|2BCJ|B Chain B, Crystal Structure Of G Protein-coupled Receptor Kinase 2 In Complex With Galpha-q And Gbetagamma Subunits Length = 340 Back     alignment and structure
>pdb|3C99|A Chain A, Structural Basis Of Histone H4 Recognition By P55 Length = 432 Back     alignment and structure
>pdb|2XYI|A Chain A, Crystal Structure Of Nurf55 In Complex With A H4 Peptide Length = 430 Back     alignment and structure
>pdb|2YBA|A Chain A, Crystal Structure Of Nurf55 In Complex With Histone H3 Length = 422 Back     alignment and structure
>pdb|3GFC|A Chain A, Crystal Structure Of Histone-Binding Protein Rbbp4 Length = 425 Back     alignment and structure
>pdb|3CFS|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|3CFV|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|3ACP|A Chain A, Crystal Structure Of Yeast Rpn14, A Chaperone Of The 19s Reg Particle Of The Proteasome Length = 417 Back     alignment and structure
>pdb|3VL1|A Chain A, Crystal Structure Of Yeast Rpn14 Length = 420 Back     alignment and structure
>pdb|3FRX|A Chain A, Crystal Structure Of The Yeast Orthologue Of Rack1, Asc1. Length = 319 Back     alignment and structure
>pdb|3JYV|R Chain R, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 313 Back     alignment and structure
>pdb|1TRJ|A Chain A, Homology Model Of Yeast Rack1 Protein Fitted Into 11.7a Cryo-em Map Of Yeast 80s Ribosome Length = 314 Back     alignment and structure
>pdb|3IZB|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 319 Back     alignment and structure
>pdb|3RFG|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P63 Length = 319 Back     alignment and structure
>pdb|3RFH|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P21 Length = 319 Back     alignment and structure
>pdb|2AQ5|A Chain A, Crystal Structure Of Murine Coronin-1 Length = 402 Back     alignment and structure
>pdb|3MKS|B Chain B, Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH AN ALLOSTERIC Inhibitor Scf-I2 Length = 464 Back     alignment and structure
>pdb|1NEX|B Chain B, Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Complex Length = 464 Back     alignment and structure
>pdb|2HES|X Chain X, Cytosolic Iron-sulphur Assembly Protein- 1 Length = 330 Back     alignment and structure
>pdb|2B4E|A Chain A, Crystal Structure Of Murine Coronin-1: Monoclinic Form Length = 402 Back     alignment and structure
>pdb|3ODT|A Chain A, Crystal Structure Of Wd40 Beta Propeller Domain Of Doa1 Length = 313 Back     alignment and structure
>pdb|1NR0|A Chain A, Two Seven-Bladed Beta-Propeller Domains Revealed By The Structure Of A C. Elegans Homologue Of Yeast Actin Interacting Protein 1 (Aip1). Length = 611 Back     alignment and structure
>pdb|2XZM|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 343 Back     alignment and structure
>pdb|4G56|B Chain B, Crystal Structure Of Full Length Prmt5/mep50 Complexes From Xenopus Laevis Length = 357 Back     alignment and structure
>pdb|4A11|B Chain B, Structure Of The Hsddb1-Hscsa Complex Length = 408 Back     alignment and structure
>pdb|4GQB|B Chain B, Crystal Structure Of The Human Prmt5:mep50 Complex Length = 344 Back     alignment and structure
>pdb|2QXV|A Chain A, Structural Basis Of Ezh2 Recognition By Eed Length = 361 Back     alignment and structure
>pdb|3JPX|A Chain A, Eed: A Novel Histone Trimethyllysine Binder Within The Eed-Ezh2 Polycomb Complex Length = 402 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query229
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 1e-120
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 2e-45
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 9e-33
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 7e-20
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 6e-14
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 5e-43
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 1e-40
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 2e-38
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 4e-34
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 4e-34
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 2e-23
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 4e-23
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 1e-07
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 5e-42
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 2e-41
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 2e-32
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 3e-32
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 5e-23
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 3e-12
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 2e-11
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 5e-42
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 3e-40
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 1e-36
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 8e-34
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 1e-14
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 3e-39
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 2e-37
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 2e-37
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 5e-37
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 5e-35
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 1e-34
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 7e-34
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 2e-33
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 5e-33
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 9e-31
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 2e-23
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 3e-39
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 7e-37
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 1e-35
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 2e-34
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 1e-25
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 3e-22
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 1e-20
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 5e-39
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 1e-33
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 5e-28
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 2e-20
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 9e-12
3ow8_A321 WD repeat-containing protein 61; structural genomi 1e-38
3ow8_A321 WD repeat-containing protein 61; structural genomi 2e-38
3ow8_A321 WD repeat-containing protein 61; structural genomi 5e-38
3ow8_A 321 WD repeat-containing protein 61; structural genomi 2e-35
3ow8_A321 WD repeat-containing protein 61; structural genomi 8e-25
3ow8_A321 WD repeat-containing protein 61; structural genomi 4e-10
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 4e-38
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 5e-32
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 3e-30
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 4e-30
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 7e-26
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 4e-20
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 3e-19
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 1e-10
2pbi_B 354 Guanine nucleotide-binding protein subunit beta 5; 6e-38
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 2e-36
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 1e-32
2pbi_B 354 Guanine nucleotide-binding protein subunit beta 5; 1e-28
2pbi_B 354 Guanine nucleotide-binding protein subunit beta 5; 8e-22
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 1e-36
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 2e-31
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 6e-31
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 4e-26
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 1e-22
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 5e-14
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 1e-36
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 7e-33
3frx_A 319 Guanine nucleotide-binding protein subunit beta- l 1e-31
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 9e-24
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 1e-17
3iz6_A305 40S ribosomal protein SA (S2P); eukaryotic ribosom 2e-36
3iz6_A305 40S ribosomal protein SA (S2P); eukaryotic ribosom 3e-34
3iz6_A305 40S ribosomal protein SA (S2P); eukaryotic ribosom 7e-33
3iz6_A 305 40S ribosomal protein SA (S2P); eukaryotic ribosom 8e-32
3iz6_A305 40S ribosomal protein SA (S2P); eukaryotic ribosom 3e-29
3iz6_A 305 40S ribosomal protein SA (S2P); eukaryotic ribosom 3e-17
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 2e-36
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 7e-33
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 8e-29
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 4e-28
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 2e-16
1got_B 340 GT-beta; complex (GTP-binding/transducer), G prote 2e-36
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 1e-35
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 3e-32
1got_B 340 GT-beta; complex (GTP-binding/transducer), G prote 1e-28
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 3e-36
3odt_A 313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 6e-32
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 7e-31
3odt_A 313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 2e-28
3odt_A 313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 2e-18
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 1e-12
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 1e-35
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 3e-35
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 2e-32
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 2e-31
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 3e-24
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 3e-18
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 2e-35
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 6e-32
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 2e-31
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 4e-29
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 3e-28
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 2e-25
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 1e-18
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 3e-35
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 3e-35
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 1e-28
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 6e-27
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 1e-26
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 2e-21
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 2e-20
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 3e-18
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 1e-17
4e54_B435 DNA damage-binding protein 2; beta barrel, double 7e-35
4e54_B435 DNA damage-binding protein 2; beta barrel, double 1e-30
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 4e-27
4e54_B435 DNA damage-binding protein 2; beta barrel, double 1e-24
4e54_B435 DNA damage-binding protein 2; beta barrel, double 8e-16
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 9e-35
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 7e-33
4aow_A 340 Guanine nucleotide-binding protein subunit beta-2; 8e-33
4aow_A 340 Guanine nucleotide-binding protein subunit beta-2; 9e-26
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 3e-25
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 4e-17
4aow_A 340 Guanine nucleotide-binding protein subunit beta-2; 1e-10
1gxr_A 337 ESG1, transducin-like enhancer protein 1; transcri 2e-34
1gxr_A 337 ESG1, transducin-like enhancer protein 1; transcri 2e-31
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 7e-30
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 5e-28
1gxr_A 337 ESG1, transducin-like enhancer protein 1; transcri 5e-21
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 5e-20
1gxr_A 337 ESG1, transducin-like enhancer protein 1; transcri 2e-08
2xyi_A430 Probable histone-binding protein CAF1; transcripti 3e-34
2xyi_A430 Probable histone-binding protein CAF1; transcripti 5e-31
2xyi_A430 Probable histone-binding protein CAF1; transcripti 3e-25
2xyi_A 430 Probable histone-binding protein CAF1; transcripti 6e-21
2xyi_A 430 Probable histone-binding protein CAF1; transcripti 3e-11
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 6e-34
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 6e-31
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 4e-27
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 1e-25
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 3e-22
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 2e-17
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 9e-34
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 1e-33
1r5m_A 425 SIR4-interacting protein SIF2; transcription corep 2e-27
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 4e-22
1r5m_A 425 SIR4-interacting protein SIF2; transcription corep 4e-17
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 5e-33
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 5e-33
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 1e-31
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 2e-28
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 9e-26
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 7e-17
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 9e-33
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 1e-32
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 8e-30
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 1e-29
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 3e-22
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 9e-33
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 3e-31
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 3e-25
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 3e-24
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 3e-15
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 2e-32
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 7e-31
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 3e-23
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 3e-22
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 3e-32
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 3e-27
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 1e-22
4aez_A 401 CDC20, WD repeat-containing protein SLP1; cell cyc 2e-19
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 3e-16
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 3e-31
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 4e-31
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 8e-31
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 1e-30
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 4e-29
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 7e-25
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 7e-22
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 1e-30
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 1e-24
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 4e-22
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 4e-21
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 4e-14
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 5e-08
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 2e-30
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 2e-30
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 3e-27
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 6e-26
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 8e-08
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 9e-30
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 3e-29
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 1e-24
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 6e-14
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 2e-08
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 1e-29
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 9e-28
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 3e-27
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 3e-26
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 2e-21
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 9e-18
3jrp_A 379 Fusion protein of protein transport protein SEC13 2e-29
3jrp_A 379 Fusion protein of protein transport protein SEC13 4e-27
3jrp_A 379 Fusion protein of protein transport protein SEC13 7e-27
3jrp_A379 Fusion protein of protein transport protein SEC13 3e-26
3jrp_A 379 Fusion protein of protein transport protein SEC13 2e-17
3jrp_A379 Fusion protein of protein transport protein SEC13 4e-16
2pm7_B297 Protein transport protein SEC13, protein transport 3e-29
2pm7_B297 Protein transport protein SEC13, protein transport 3e-28
2pm7_B 297 Protein transport protein SEC13, protein transport 2e-27
2pm7_B297 Protein transport protein SEC13, protein transport 5e-27
2pm7_B297 Protein transport protein SEC13, protein transport 5e-18
2pm7_B 297 Protein transport protein SEC13, protein transport 2e-16
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 2e-28
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 1e-26
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 3e-25
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 3e-23
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 2e-22
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 3e-15
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 5e-14
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 3e-09
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 3e-28
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 7e-28
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 8e-28
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 6e-24
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 2e-22
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 9e-14
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 8e-13
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 8e-28
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 9e-25
3i2n_A 357 WD repeat-containing protein 92; WD40 repeats, str 4e-20
3i2n_A 357 WD repeat-containing protein 92; WD40 repeats, str 5e-20
3i2n_A 357 WD repeat-containing protein 92; WD40 repeats, str 5e-10
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 1e-27
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 9e-24
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 1e-23
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 2e-20
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 6e-18
3jro_A 753 Fusion protein of protein transport protein SEC13 2e-27
3jro_A 753 Fusion protein of protein transport protein SEC13 5e-27
3jro_A 753 Fusion protein of protein transport protein SEC13 3e-26
3jro_A 753 Fusion protein of protein transport protein SEC13 4e-26
3jro_A 753 Fusion protein of protein transport protein SEC13 5e-16
3jro_A 753 Fusion protein of protein transport protein SEC13 3e-12
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 4e-27
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 1e-25
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 5e-25
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 1e-24
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 1e-17
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 3e-24
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 7e-24
1sq9_A 397 Antiviral protein SKI8; WD repeat, beta-transducin 2e-22
1sq9_A 397 Antiviral protein SKI8; WD repeat, beta-transducin 6e-17
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 5e-16
1sq9_A 397 Antiviral protein SKI8; WD repeat, beta-transducin 3e-14
1sq9_A 397 Antiviral protein SKI8; WD repeat, beta-transducin 8e-09
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 1e-06
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 4e-24
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 1e-22
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 2e-20
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 1e-17
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 4e-09
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 3e-23
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 4e-13
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 8e-21
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 6e-14
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 3e-11
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 4e-10
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 9e-07
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 7e-04
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 1e-18
2j04_B 524 YDR362CP, TAU91; beta propeller, type 2 promoters, 9e-16
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 3e-12
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 6e-04
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 4e-18
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 9e-17
3lrv_A 343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 2e-10
3lrv_A 343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 9e-05
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 2e-15
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 3e-13
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 4e-09
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 4e-09
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 5e-07
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 3e-05
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 6e-15
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 5e-13
3vu4_A 355 KMHSV2; beta-propeller fold, protein transport; 2. 2e-07
3vu4_A 355 KMHSV2; beta-propeller fold, protein transport; 2. 2e-04
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 2e-04
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 2e-13
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 3e-05
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Length = 814 Back     alignment and structure
 Score =  359 bits (922), Expect = e-120
 Identities = 135/225 (60%), Positives = 172/225 (76%), Gaps = 1/225 (0%)

Query: 3   LRLDIKRKLTARSDRVKCCDLHPTEPWMLASLYNGHVHVWNHETNQNVKSFEVCDLPVRA 62
           ++LDIK+  + RSDRVK  D HPTEPW+L +LY+G V +WN+ET   V+S +V + PVRA
Sbjct: 1   MKLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVRA 60

Query: 63  AKFVPRKNWIVTGSDDMQVCVFNYNTLERFHSFEAHSDYVRCVAVHPTQPFLLTSSDDML 122
            KF+ RKNWI+ GSDD ++ VFNYNT E+   FEAH DY+R +AVHPT+P++L+ SDD+ 
Sbjct: 61  GKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLT 120

Query: 123 IKLWNWEKAWACQQVFEGHTHYVMQIVINPKDNNTFASASLDRTVKVWQLGSASPNFTL- 181
           +KLWNWE  WA +Q FEGH H+VM +  NPKD +TFAS  LDRTVKVW LG ++PNFTL 
Sbjct: 121 VKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLT 180

Query: 182 EGHEKGVNCVDYYHGGDKPYLISGADDRLVKIWDYQNKTCVQTLE 226
            G E+GVN VDYY   DKPY+I+ +DD  +KIWDYQ K+CV TLE
Sbjct: 181 TGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLE 225


>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Length = 814 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Length = 814 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Length = 814 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Length = 814 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Length = 445 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Length = 445 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Length = 445 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Length = 445 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Length = 445 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Length = 445 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Length = 445 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Length = 445 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A 2h13_A 3p4f_A 4a7j_A* 2h9l_A ... Length = 312 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A 2h13_A 3p4f_A 4a7j_A* 2h9l_A ... Length = 312 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A 2h13_A 3p4f_A 4a7j_A* 2h9l_A ... Length = 312 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A 2h13_A 3p4f_A 4a7j_A* 2h9l_A ... Length = 312 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A 2h13_A 3p4f_A 4a7j_A* 2h9l_A ... Length = 312 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A 2h13_A 3p4f_A 4a7j_A* 2h9l_A ... Length = 312 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A 2h13_A 3p4f_A 4a7j_A* 2h9l_A ... Length = 312 Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Length = 410 Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Length = 410 Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Length = 410 Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Length = 410 Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Length = 410 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Length = 435 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Length = 435 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Length = 435 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Length = 435 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Length = 435 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Length = 435 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Length = 435 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Length = 383 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Length = 383 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Length = 383 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Length = 383 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Length = 383 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Length = 321 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Length = 321 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Length = 321 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Length = 321 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Length = 321 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Length = 321 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Length = 354 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Length = 354 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Length = 354 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Length = 354 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Length = 354 Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Length = 694 Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Length = 694 Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Length = 694 Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Length = 694 Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Length = 694 Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Length = 694 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Length = 319 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Length = 319 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Length = 319 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Length = 319 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Length = 319 Back     alignment and structure
>3iz6_A 40S ribosomal protein SA (S2P); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Length = 305 Back     alignment and structure
>3iz6_A 40S ribosomal protein SA (S2P); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Length = 305 Back     alignment and structure
>3iz6_A 40S ribosomal protein SA (S2P); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Length = 305 Back     alignment and structure
>3iz6_A 40S ribosomal protein SA (S2P); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Length = 305 Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Length = 330 Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Length = 330 Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Length = 330 Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Length = 330 Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Length = 330 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Length = 340 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Length = 340 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Length = 340 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Length = 340 Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Length = 313 Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Length = 313 Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Length = 313 Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Length = 313 Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Length = 313 Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Length = 313 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Length = 420 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Length = 420 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Length = 420 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Length = 420 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Length = 420 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Length = 420 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Length = 464 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Length = 464 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Length = 464 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Length = 464 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Length = 464 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Length = 464 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Length = 464 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Length = 435 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Length = 435 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Length = 435 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Length = 435 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Length = 435 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Length = 340 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Length = 340 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Length = 340 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Length = 340 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Length = 340 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Length = 340 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Length = 340 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Length = 337 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Length = 337 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Length = 337 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Length = 337 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Length = 337 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Length = 337 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Length = 337 Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Length = 430 Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Length = 430 Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Length = 430 Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Length = 430 Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Length = 430 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Length = 372 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Length = 372 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Length = 372 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Length = 372 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Length = 372 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Length = 372 Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Length = 425 Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Length = 425 Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Length = 425 Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Length = 425 Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Length = 425 Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Length = 343 Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Length = 343 Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Length = 343 Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Length = 343 Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Length = 343 Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Length = 343 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Length = 345 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Length = 345 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Length = 345 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Length = 345 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Length = 345 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Length = 366 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Length = 366 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Length = 366 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Length = 366 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Length = 366 Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Length = 416 Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Length = 416 Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Length = 416 Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Length = 416 Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Length = 401 Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Length = 401 Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Length = 401 Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Length = 401 Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Length = 401 Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Length = 393 Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Length = 393 Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Length = 393 Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Length = 393 Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Length = 393 Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Length = 393 Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Length = 393 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Length = 368 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Length = 368 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Length = 368 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Length = 368 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Length = 368 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Length = 368 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Length = 408 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Length = 408 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Length = 408 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Length = 408 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Length = 408 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 377 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 377 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 377 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 377 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 377 Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Length = 316 Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Length = 316 Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Length = 316 Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Length = 316 Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Length = 316 Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Length = 316 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Length = 379 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Length = 379 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Length = 379 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Length = 379 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Length = 379 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Length = 379 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Length = 297 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Length = 297 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Length = 297 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Length = 297 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Length = 297 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Length = 297 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Length = 351 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Length = 351 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Length = 351 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Length = 351 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Length = 351 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Length = 351 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Length = 351 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Length = 351 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Length = 369 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Length = 369 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Length = 369 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Length = 369 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Length = 369 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Length = 369 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Length = 369 Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Length = 357 Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Length = 357 Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Length = 357 Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Length = 357 Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Length = 357 Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Length = 402 Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Length = 402 Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Length = 402 Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Length = 402 Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Length = 402 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, ER-golgi transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Length = 753 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, ER-golgi transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Length = 753 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, ER-golgi transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Length = 753 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, ER-golgi transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Length = 753 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, ER-golgi transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Length = 753 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, ER-golgi transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Length = 753 Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Length = 437 Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Length = 437 Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Length = 437 Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Length = 437 Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Length = 437 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Length = 397 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Length = 397 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Length = 397 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Length = 397 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Length = 397 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Length = 397 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Length = 397 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Length = 397 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Length = 342 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Length = 342 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Length = 342 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Length = 342 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Length = 342 Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Length = 450 Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Length = 450 Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Length = 902 Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Length = 902 Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Length = 902 Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Length = 902 Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Length = 902 Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Length = 902 Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Length = 524 Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Length = 524 Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Length = 524 Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Length = 524 Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 343 Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 343 Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 343 Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 343 Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Length = 447 Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Length = 447 Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Length = 447 Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Length = 447 Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Length = 447 Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Length = 447 Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Length = 355 Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Length = 355 Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Length = 355 Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Length = 355 Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Length = 355 Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Length = 434 Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Length = 434 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query229
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 100.0
3jrp_A 379 Fusion protein of protein transport protein SEC13 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 100.0
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 100.0
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
1sq9_A 397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3jro_A 753 Fusion protein of protein transport protein SEC13 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
3jrp_A379 Fusion protein of protein transport protein SEC13 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
2xyi_A430 Probable histone-binding protein CAF1; transcripti 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
3i2n_A 357 WD repeat-containing protein 92; WD40 repeats, str 100.0
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
2xyi_A430 Probable histone-binding protein CAF1; transcripti 100.0
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
2j04_B 524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
3jro_A 753 Fusion protein of protein transport protein SEC13 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.98
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.98
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.98
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.98
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.98
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.98
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.97
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.97
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.97
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.96
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.96
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.96
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.96
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.96
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.95
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.94
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.93
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.91
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.91
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 99.91
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 99.9
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.89
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.89
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.89
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.88
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.88
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.88
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.87
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.87
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.86
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.86
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 99.85
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.85
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.85
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.85
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.84
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.83
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.83
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.82
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.82
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.82
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.82
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.82
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.82
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.81
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.77
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.77
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.77
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.77
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.76
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.76
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.75
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.75
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.75
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.74
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.74
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.74
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.73
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.72
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 99.71
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.71
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.7
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.7
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.69
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.67
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.66
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.66
3c5m_A 396 Oligogalacturonate lyase; blade-shaped beta-propel 99.64
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.63
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.63
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.63
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.62
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.61
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 99.6
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.58
2oiz_A 361 Aromatic amine dehydrogenase, large subunit; oxido 99.57
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.56
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.56
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.56
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.55
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.55
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.54
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.54
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.53
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.5
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.49
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.48
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.47
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.47
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.47
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 99.46
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.44
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.42
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.41
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.4
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.4
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.4
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.37
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.36
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.34
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.28
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.26
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.25
2mad_H 373 Methylamine dehydrogenase (heavy subunit); oxidore 99.25
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.25
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.21
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.2
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 99.18
2qe8_A343 Uncharacterized protein; structural genomics, join 99.17
2qe8_A343 Uncharacterized protein; structural genomics, join 99.17
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.16
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.14
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.12
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.12
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 99.03
3c75_H 426 MADH, methylamine dehydrogenase heavy chain; coppe 99.01
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 98.97
3q7m_A 376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.97
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.96
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.96
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.94
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 98.92
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.88
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.87
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.86
2ece_A462 462AA long hypothetical selenium-binding protein; 98.85
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.81
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 98.79
3v65_B386 Low-density lipoprotein receptor-related protein; 98.79
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.79
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.76
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.76
1mda_H 368 Methylamine dehydrogenase (heavy subunit); electro 98.75
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.72
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.7
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.68
2ece_A462 462AA long hypothetical selenium-binding protein; 98.68
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.66
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 98.62
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.62
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.62
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.61
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.6
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 98.59
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.56
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 98.54
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.46
3v65_B386 Low-density lipoprotein receptor-related protein; 98.45
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 98.45
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.45
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.45
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 98.45
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.43
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.39
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 98.36
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 98.36
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 98.35
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.32
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.28
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 98.26
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.24
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.24
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 98.14
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.13
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 98.07
4a2l_A 795 BT_4663, two-component system sensor histidine kin 97.99
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 97.98
1ijq_A 316 LDL receptor, low-density lipoprotein receptor; be 97.96
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.96
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 97.94
2p4o_A306 Hypothetical protein; putative lactonase, structur 97.85
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 97.84
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.83
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.8
3v9f_A 781 Two-component system sensor histidine kinase/RESP 97.76
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 97.75
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.7
3tc9_A 430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.67
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 97.61
3v9f_A 781 Two-component system sensor histidine kinase/RESP 97.58
3kya_A496 Putative phosphatase; structural genomics, joint c 97.57
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.51
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 97.3
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.28
3kya_A496 Putative phosphatase; structural genomics, joint c 97.23
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 97.15
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.13
3amr_A 355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.03
2p9w_A 334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 96.99
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 96.99
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 96.93
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 96.86
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 96.86
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 96.83
1bpo_A 494 Protein (clathrin); clathrin endocytosis beta-prop 96.79
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 96.65
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 96.4
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 96.39
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 96.36
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 96.35
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 96.3
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 96.25
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 96.15
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 96.09
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 96.08
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 96.02
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 95.92
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 95.92
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 95.8
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 95.76
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 95.63
1bpo_A 494 Protein (clathrin); clathrin endocytosis beta-prop 95.62
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 95.47
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 95.02
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 94.85
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 94.45
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 94.29
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 94.13
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 93.74
2be1_A 339 Serine/threonine-protein kinase/endoribonuclease; 93.1
2ism_A 352 Putative oxidoreductase; BL41XU spring-8, bladed b 92.8
3qhy_B282 Beta-lactamase inhibitory protein II; enyzme-inhib 90.17
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 90.12
3das_A 347 Putative oxidoreductase; aldose sugar dehydrogenas 89.27
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 89.2
3qhy_B282 Beta-lactamase inhibitory protein II; enyzme-inhib 88.09
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 86.98
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 86.51
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 86.08
3a9g_A 354 Putative uncharacterized protein; PQQ dependent de 85.91
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 83.87
3f7f_A 729 Nucleoporin NUP120; nuclear pore complex, macromol 83.47
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 83.24
3ott_A 758 Two-component system sensor histidine kinase; beta 83.15
3sbq_A 638 Nitrous-oxide reductase; beta-propeller, cupredoxi 81.81
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 81.72
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
Probab=100.00  E-value=3.1e-46  Score=296.09  Aligned_cols=225  Identities=60%  Similarity=1.115  Sum_probs=209.4

Q ss_pred             cchhhhhcccCCCceEEEEEccCCCeEEEEEecCeEEEEEcCCCCeEEEEEecCcCeEEEEEcCCCCEEEEEeCCCeEEE
Q psy4653           4 RLDIKRKLTARSDRVKCCDLHPTEPWMLASLYNGHVHVWNHETNQNVKSFEVCDLPVRAAKFVPRKNWIVTGSDDMQVCV   83 (229)
Q Consensus         4 ~~~~~~~~~~~~~~v~~~~~~p~~~~l~~~~~dg~v~~wd~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~sg~~d~~i~i   83 (229)
                      ++++.++|.+|+++|.+++|+|++++|++|+.||.|++||+++++.+..+..+..++.++.|+|++++|++|+.|+.|++
T Consensus         2 ~l~~~~~~~~h~~~V~~~~fsp~~~~l~s~~~dg~v~lWd~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~s~s~d~~i~v   81 (304)
T 2ynn_A            2 KLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVELWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRV   81 (304)
T ss_dssp             CCCCEEEEEEECSCEEEEEECSSSSEEEEEETTSEEEEEETTTTEEEEEEECCSSCEEEEEEEGGGTEEEEEETTSEEEE
T ss_pred             cceeEEeecCCCCceEEEEECCCCCEEEEEcCCCcEEEEECCCCceeEEeeccCCcEEEEEEeCCCCEEEEECCCCEEEE
Confidence            46778889999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EECCCcceEEEeccCCCceeEEEEcCCCCEEEEEeCCCcEEEEecCCceeeeeeeecceeeEEEEEEcCCCCCEEEEEEC
Q psy4653          84 FNYNTLERFHSFEAHSDYVRCVAVHPTQPFLLTSSDDMLIKLWNWEKAWACQQVFEGHTHYVMQIVINPKDNNTFASASL  163 (229)
Q Consensus        84 wd~~~~~~~~~~~~h~~~i~~v~~~~~~~~~~s~~~d~~v~lwd~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~l~s~~~  163 (229)
                      ||+++++.+..+.+|.+.|.+++|+|+++++++++.|++|++||++........+.+|...|.++.|+|.++.+|++|+.
T Consensus        82 wd~~~~~~~~~~~~h~~~v~~~~~~~~~~~l~sgs~D~~v~lWd~~~~~~~~~~~~~h~~~v~~v~~~p~~~~~l~sgs~  161 (304)
T 2ynn_A           82 FNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCL  161 (304)
T ss_dssp             EETTTCCEEEEEECCSSCEEEEEECSSSSEEEEEETTSCEEEEEGGGTTEEEEEECCCCSCEEEEEECTTCTTEEEEEET
T ss_pred             EECCCCcEEEEEeCCCCcEEEEEEcCCCCEEEEECCCCeEEEEECCCCcchhhhhcccCCcEEEEEECCCCCCEEEEEeC
Confidence            99999999999999999999999999999999999999999999987767778889999999999999977889999999


Q ss_pred             CCcEEEEeCCCCCceEEEe-cCCCceEEEEEEeCCCcCEEEEeeCCCeEEEEECCCCeEEEeeccC
Q psy4653         164 DRTVKVWQLGSASPNFTLE-GHEKGVNCVDYYHGGDKPYLISGADDRLVKIWDYQNKTCVQTLESG  228 (229)
Q Consensus       164 d~~i~~wd~~~~~~~~~~~-~h~~~v~~~~~~~~~~~~~l~s~s~d~~i~iwd~~~~~~~~~~~~~  228 (229)
                      |++|++||++...+...+. +|...+..++|.+.+++.+|++|+.|++|++||+++++++.++++|
T Consensus       162 D~~v~iwd~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~l~s~s~D~~i~iWd~~~~~~~~~~~~h  227 (304)
T 2ynn_A          162 DRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGH  227 (304)
T ss_dssp             TSEEEEEETTCSSCSEEEECCCTTCEEEEEECCSTTCCEEEEEETTSEEEEEETTTTEEEEEEECC
T ss_pred             CCeEEEEECCCCCccceeccCCcCcEEEEEEEEcCCCCEEEEEcCCCeEEEEeCCCCccceeeCCC
Confidence            9999999998887777665 4567899999987777789999999999999999999999999876



>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3qhy_B Beta-lactamase inhibitory protein II; enyzme-inhibitor complex, beta-propeller, protein:protein interaction; 2.06A {Streptomyces exfoliatus} PDB: 3qi0_A 1jtd_B Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3qhy_B Beta-lactamase inhibitory protein II; enyzme-inhibitor complex, beta-propeller, protein:protein interaction; 2.06A {Streptomyces exfoliatus} PDB: 3qi0_A 1jtd_B Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>3f7f_A Nucleoporin NUP120; nuclear pore complex, macromolecular assembly, membrane coat, nucleocytoplasmic transport, beta-propeller; 2.60A {Saccharomyces cerevisiae} PDB: 3h7n_A 3hxr_A Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 229
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 5e-26
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-18
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 5e-17
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-24
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 9e-24
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 6e-23
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-19
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-17
d1vyhc1 317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-08
d1vyhc1 317 b.69.4.1 (C:92-408) Platelet-activating factor ace 8e-07
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-22
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 4e-15
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-14
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 6e-08
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-04
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 4e-13
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-12
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 2e-12
d2ovrb2 342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-11
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 1e-12
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 1e-11
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 4e-10
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 1e-08
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 8e-08
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 2e-11
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 8e-06
d1k32a3 360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 2e-04
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 7e-11
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 1e-10
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 4e-06
d1p22a2 293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 5e-05
d1p22a2 293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 1e-04
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 4e-10
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-08
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-06
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 5e-06
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 5e-05
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-04
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 3e-04
d1sq9a_ 393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 6e-10
d1sq9a_ 393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 1e-08
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 3e-08
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 3e-07
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 1e-06
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 2e-06
d1sq9a_ 393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 8e-06
d1sq9a_ 393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 0.002
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 7e-10
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 3e-09
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 5e-09
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-06
d1gxra_ 337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 6e-05
d1gxra_ 337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 7e-04
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 2e-09
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 2e-06
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 0.003
d1qksa2 432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 6e-09
d1qksa2 432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 2e-05
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 9e-09
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 3e-07
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-06
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 3e-06
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-05
d1hzua2 426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 5e-08
d1hzua2 426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 5e-06
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 7e-08
d1pgua2 287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 8e-04
d1pgua2 287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 0.002
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-07
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-04
d1jmxb_ 346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 0.002
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 5e-07
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 3e-06
d1nr0a1 311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 2e-04
d1nr0a1 311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 8e-04
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 4e-06
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 4e-06
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 4e-05
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 1e-04
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 3e-04
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 5e-04
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 4e-06
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 1e-05
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 2e-04
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: beta1-subunit of the signal-transducing G protein heterotrimer
species: Cow (Bos taurus) [TaxId: 9913]
 Score =  101 bits (251), Expect = 5e-26
 Identities = 37/196 (18%), Positives = 67/196 (34%), Gaps = 2/196 (1%)

Query: 20  CCDLHPTEPWMLASLYNGHVHVWNHETNQNVKSFEVCDLPVRAAKFVPRKNWIVTGSDDM 79
            C     +  ++ S  +    +W+ ET Q   +F      V +    P     V+G+ D 
Sbjct: 147 SCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDA 206

Query: 80  QVCVFNYNTLERFHSFEAHSDYVRCVAVHPTQPFLLTSSDDMLIKLWNWEKAWACQQVFE 139
              +++        +F  H   +  +   P      T SDD   +L++            
Sbjct: 207 SAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSH 266

Query: 140 GHTHYVMQIVINPKDNNTFASASLDRTVKVWQLGSASPNFTLEGHEKGVNCVDYYHGGDK 199
            +    +  V   K      +   D    VW    A     L GH+  V+C+      D 
Sbjct: 267 DNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTD--DG 324

Query: 200 PYLISGADDRLVKIWD 215
             + +G+ D  +KIW+
Sbjct: 325 MAVATGSWDSFLKIWN 340


>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query229
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.98
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.98
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.98
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.97
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.97
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.97
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.97
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.96
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.96
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.96
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.95
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.94
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.92
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.92
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.89
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.88
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.88
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.87
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.87
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.86
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.82
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.78
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.78
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 99.77
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 99.77
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.73
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.73
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.62
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.6
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.54
d2bbkh_ 355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.5
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.37
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.34
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.28
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.16
d1mdah_ 368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.14
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.02
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.02
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.0
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.98
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.97
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.97
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.91
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.82
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.79
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.73
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.72
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.57
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.47
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.4
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.31
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.17
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.04
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.9
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 97.84
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.82
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.51
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 96.9
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 96.75
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 96.59
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 96.58
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 96.41
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 96.37
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 96.2
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 96.13
d1k32a2 281 Tricorn protease N-terminal domain {Archaeon Therm 96.06
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 96.04
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 95.97
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 95.58
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 95.51
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 95.43
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 95.0
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 94.68
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 94.58
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 94.58
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 94.34
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 92.72
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 91.85
d1fwxa2 459 Nitrous oxide reductase, N-terminal domain {Paraco 91.21
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 89.28
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 86.34
d2hu7a1 313 Acylamino-acid-releasing enzyme, N-terminal donain 85.08
d1xipa_ 381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 84.37
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 82.5
d1jtdb_273 beta-lactamase inhibitor protein-II, BLIP-II {Stre 82.28
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Actin interacting protein 1
species: Nematode (Caenorhabditis elegans) [TaxId: 6239]
Probab=100.00  E-value=1.2e-39  Score=257.32  Aligned_cols=219  Identities=20%  Similarity=0.340  Sum_probs=192.6

Q ss_pred             hhhhhcccCCCceEEEEEccCCCeEEEEEecCeEEEEEcCCCCeE--EEEEecCcCeEEEEEcCCCCEEEEEeCC--CeE
Q psy4653           6 DIKRKLTARSDRVKCCDLHPTEPWMLASLYNGHVHVWNHETNQNV--KSFEVCDLPVRAAKFVPRKNWIVTGSDD--MQV   81 (229)
Q Consensus         6 ~~~~~~~~~~~~v~~~~~~p~~~~l~~~~~dg~v~~wd~~~~~~~--~~~~~~~~~v~~~~~~~~~~~l~sg~~d--~~i   81 (229)
                      ...+.|.+|+.+|.+++|+|++++|++|+.||.|++||+.+++..  ..+..+..+|.++.|+|++++|++++.+  ..+
T Consensus        49 ~~~~~~~~H~~~v~~~~~sp~g~~latg~~dg~i~iwd~~~~~~~~~~~~~~~~~~v~~v~~s~d~~~l~~~~~~~~~~~  128 (311)
T d1nr0a1          49 TDTEIYTEHSHQTTVAKTSPSGYYCASGDVHGNVRIWDTTQTTHILKTTIPVFSGPVKDISWDSESKRIAAVGEGRERFG  128 (311)
T ss_dssp             SCCEEECCCSSCEEEEEECTTSSEEEEEETTSEEEEEESSSTTCCEEEEEECSSSCEEEEEECTTSCEEEEEECCSSCSE
T ss_pred             ceeEEEcCCCCCEEEEEEeCCCCeEeccccCceEeeeeeeccccccccccccccCccccccccccccccccccccccccc
Confidence            455668899999999999999999999999999999999987654  4466788899999999999999999865  458


Q ss_pred             EEEECCCcceEEEeccCCCceeEEEEcCCCCE-EEEEeCCCcEEEEecCCceeeeeeeecceeeEEEEEEcCCCCCEEEE
Q psy4653          82 CVFNYNTLERFHSFEAHSDYVRCVAVHPTQPF-LLTSSDDMLIKLWNWEKAWACQQVFEGHTHYVMQIVINPKDNNTFAS  160 (229)
Q Consensus        82 ~iwd~~~~~~~~~~~~h~~~i~~v~~~~~~~~-~~s~~~d~~v~lwd~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~l~s  160 (229)
                      ++|+.++++....+.+|.+.|.+++|+|++++ +++|+.|+.|++||++.. .....+.+|..+|.++.++| ++.++++
T Consensus       129 ~v~~~~~~~~~~~l~~h~~~v~~v~~~~~~~~~l~sgs~d~~i~i~d~~~~-~~~~~~~~~~~~i~~v~~~p-~~~~l~~  206 (311)
T d1nr0a1         129 HVFLFDTGTSNGNLTGQARAMNSVDFKPSRPFRIISGSDDNTVAIFEGPPF-KFKSTFGEHTKFVHSVRYNP-DGSLFAS  206 (311)
T ss_dssp             EEEETTTCCBCBCCCCCSSCEEEEEECSSSSCEEEEEETTSCEEEEETTTB-EEEEEECCCSSCEEEEEECT-TSSEEEE
T ss_pred             cccccccccccccccccccccccccccccceeeeccccccccccccccccc-ccccccccccccccccccCc-ccccccc
Confidence            99999999988899999999999999999985 788999999999999876 45666778999999999998 6889999


Q ss_pred             EECCCcEEEEeCCCCCceEEEe-------cCCCceEEEEEEeCCCcCEEEEeeCCCeEEEEECCCCeEEEeeccC
Q psy4653         161 ASLDRTVKVWQLGSASPNFTLE-------GHEKGVNCVDYYHGGDKPYLISGADDRLVKIWDYQNKTCVQTLESG  228 (229)
Q Consensus       161 ~~~d~~i~~wd~~~~~~~~~~~-------~h~~~v~~~~~~~~~~~~~l~s~s~d~~i~iwd~~~~~~~~~~~~~  228 (229)
                      ++.|+.|++||...+.....++       +|...|.+++|.  +++.+|++|+.||+|+|||+++++++++++.+
T Consensus       207 ~~~d~~v~~~d~~~~~~~~~~~~~~~~~~~h~~~V~~~~~s--~~~~~l~tgs~Dg~v~iwd~~t~~~~~~l~~~  279 (311)
T d1nr0a1         207 TGGDGTIVLYNGVDGTKTGVFEDDSLKNVAHSGSVFGLTWS--PDGTKIASASADKTIKIWNVATLKVEKTIPVG  279 (311)
T ss_dssp             EETTSCEEEEETTTCCEEEECBCTTSSSCSSSSCEEEEEEC--TTSSEEEEEETTSEEEEEETTTTEEEEEEECC
T ss_pred             ccccccccccccccccccccccccccccccccccccccccC--CCCCEEEEEeCCCeEEEEECCCCcEEEEEECC
Confidence            9999999999998877665543       578889999995  45679999999999999999999999998754



>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jtdb_ b.69.5.2 (B:) beta-lactamase inhibitor protein-II, BLIP-II {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure