Psyllid ID: psy4781


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80---
MGVKGSAFINSFLTLANLMVMGIVIVVGFYYGRLDNWINEGGGFLPYGISGVVAGAATCFYAYVGFDKCWKCLIRIGVRTTIT
cccHHHHHHHHHHHHHHHHHEEEEEEEEEEEEEcccccccccccccccHHHHHHcEEEEEEEEEcccEEcccccccEEEEEcc
ccccHHHHHHHHHHHHHHHHHHHHHHHHHEEccccccccccccccccccHHHHHcHHHHHHHHHcHHHHHHHHHHEccEEEcc
MGVKGSAFINSFLTLANLMVMGIVIVVGFYYgrldnwinegggflpygisgVVAGAATCFYAYVGFDKCWKCLIRigvrttit
MGVKGSAFINSFLTLANLMVMGIVIVVGFYYGRLDNWINEGGGFLPYGISGVVAGAATCFYAYVGFDKCWKCLIRIGVRTTIT
MGVKGSAFINSFLTLANLMVMGIVIVVGFYYGRLDNWINEGGGFLPYGISGVVAGAATCFYAYVGFDKCWKCLIRIGVRTTIT
******AFINSFLTLANLMVMGIVIVVGFYYGRLDNWINEGGGFLPYGISGVVAGAATCFYAYVGFDKCWKCLIRIGVRT***
MGVKGSAFINSFLTLANLMVMGIVIVVGFYYGRLDNWINEGGGFLPYGISGVVAGAATCFYAYVGFDKCWKCLIRIGVRTTIT
MGVKGSAFINSFLTLANLMVMGIVIVVGFYYGRLDNWINEGGGFLPYGISGVVAGAATCFYAYVGFDKCWKCLIRIGVRTTIT
***KGSAFINSFLTLANLMVMGIVIVVGFYYGRLDNWINEGGGFLPYGISGVVAGAATCFYAYVGFDKCWKCLIRIGVRTTIT
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
iiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
iiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGVKGSAFINSFLTLANLMVMGIVIVVGFYYGRLDNWINEGGGFLPYGISGVVAGAATCFYAYVGFDKCWKCLIRIGVRTTIT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query83 2.2.26 [Sep-21-2011]
Q8BLQ7 635 Cationic amino acid trans yes N/A 0.795 0.103 0.484 3e-12
P18581 657 Low affinity cationic ami no N/A 0.795 0.100 0.433 1e-11
B5D5N9 657 Low affinity cationic ami no N/A 0.795 0.100 0.433 1e-11
P52569 658 Low affinity cationic ami yes N/A 0.795 0.100 0.422 5e-11
P30825 629 High affinity cationic am no N/A 0.783 0.103 0.420 5e-11
O43246 635 Cationic amino acid trans no N/A 0.795 0.103 0.424 6e-11
B3TP03 654 Low affinity cationic ami no N/A 0.783 0.099 0.411 8e-11
P30823 624 High affinity cationic am no N/A 0.783 0.104 0.421 8e-11
Q09143 622 High affinity cationic am no N/A 0.783 0.104 0.432 9e-11
A8I499 657 Low affinity cationic ami no N/A 0.795 0.100 0.4 3e-10
>sp|Q8BLQ7|CTR4_MOUSE Cationic amino acid transporter 4 OS=Mus musculus GN=Slc7a4 PE=1 SV=1 Back     alignment and function desciption
 Score = 70.5 bits (171), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 32/66 (48%), Positives = 46/66 (69%)

Query: 2   GVKGSAFINSFLTLANLMVMGIVIVVGFYYGRLDNWINEGGGFLPYGISGVVAGAATCFY 61
           G + S+++N   +  +L+V+  +IV+GF   R  NW  E GGF P+G SG++AG ATCFY
Sbjct: 187 GARVSSWLNHTFSAISLIVILFIIVLGFILARPHNWSAEEGGFAPFGFSGILAGTATCFY 246

Query: 62  AYVGFD 67
           A+VGFD
Sbjct: 247 AFVGFD 252




Involved in the transport of the cationic amino acids (arginine, lysine and ornithine).
Mus musculus (taxid: 10090)
>sp|P18581|CTR2_MOUSE Low affinity cationic amino acid transporter 2 OS=Mus musculus GN=Slc7a2 PE=1 SV=3 Back     alignment and function description
>sp|B5D5N9|CTR2_RAT Low affinity cationic amino acid transporter 2 OS=Rattus norvegicus GN=Slc7a2 PE=2 SV=1 Back     alignment and function description
>sp|P52569|CTR2_HUMAN Low affinity cationic amino acid transporter 2 OS=Homo sapiens GN=SLC7A2 PE=1 SV=2 Back     alignment and function description
>sp|P30825|CTR1_HUMAN High affinity cationic amino acid transporter 1 OS=Homo sapiens GN=SLC7A1 PE=1 SV=1 Back     alignment and function description
>sp|O43246|CTR4_HUMAN Cationic amino acid transporter 4 OS=Homo sapiens GN=SLC7A4 PE=2 SV=3 Back     alignment and function description
>sp|B3TP03|CTR2_CHICK Low affinity cationic amino acid transporter 2 OS=Gallus gallus GN=SLC7A2 PE=2 SV=1 Back     alignment and function description
>sp|P30823|CTR1_RAT High affinity cationic amino acid transporter 1 OS=Rattus norvegicus GN=Slc7a1 PE=2 SV=1 Back     alignment and function description
>sp|Q09143|CTR1_MOUSE High affinity cationic amino acid transporter 1 OS=Mus musculus GN=Slc7a1 PE=2 SV=1 Back     alignment and function description
>sp|A8I499|CTR2_PIG Low affinity cationic amino acid transporter 2 OS=Sus scrofa GN=SLC7A2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query83
328776541 654 PREDICTED: cationic amino acid transport 0.819 0.103 0.691 2e-18
193599192 502 PREDICTED: cationic amino acid transport 0.807 0.133 0.632 5e-18
350426305 648 PREDICTED: cationic amino acid transport 0.819 0.104 0.676 7e-18
380022543 648 PREDICTED: cationic amino acid transport 0.819 0.104 0.676 9e-18
156545878 663 PREDICTED: cationic amino acid transport 0.819 0.102 0.676 2e-17
340723636 648 PREDICTED: cationic amino acid transport 0.819 0.104 0.661 2e-17
357625552 655 cationic amino acid transporter 4 [Danau 0.819 0.103 0.617 1e-16
332019280 727 Cationic amino acid transporter 4 [Acrom 0.819 0.093 0.588 1e-16
194749681 654 GF24139 [Drosophila ananassae] gi|190624 0.807 0.102 0.641 2e-16
195175164 667 GL11910 [Drosophila persimilis] gi|19411 0.819 0.101 0.617 3e-16
>gi|328776541|ref|XP_624184.3| PREDICTED: cationic amino acid transporter 4-like isoform 2 [Apis mellifera] Back     alignment and taxonomy information
 Score = 96.7 bits (239), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 54/68 (79%)

Query: 1   MGVKGSAFINSFLTLANLMVMGIVIVVGFYYGRLDNWINEGGGFLPYGISGVVAGAATCF 60
           +GVK SA +NS LTL NL VMG+VI +GF Y +L NW  E GGFLPYG +GV+AGAATCF
Sbjct: 195 LGVKSSATVNSLLTLVNLGVMGLVIGLGFAYAKLSNWSCEHGGFLPYGFTGVLAGAATCF 254

Query: 61  YAYVGFDK 68
           YAYVGFD 
Sbjct: 255 YAYVGFDS 262




Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|193599192|ref|XP_001945208.1| PREDICTED: cationic amino acid transporter 4-like, partial [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|350426305|ref|XP_003494398.1| PREDICTED: cationic amino acid transporter 4-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|380022543|ref|XP_003695102.1| PREDICTED: cationic amino acid transporter 4-like [Apis florea] Back     alignment and taxonomy information
>gi|156545878|ref|XP_001606549.1| PREDICTED: cationic amino acid transporter 4-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|340723636|ref|XP_003400195.1| PREDICTED: cationic amino acid transporter 4-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|357625552|gb|EHJ75954.1| cationic amino acid transporter 4 [Danaus plexippus] Back     alignment and taxonomy information
>gi|332019280|gb|EGI59789.1| Cationic amino acid transporter 4 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|194749681|ref|XP_001957267.1| GF24139 [Drosophila ananassae] gi|190624549|gb|EDV40073.1| GF24139 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195175164|ref|XP_002028330.1| GL11910 [Drosophila persimilis] gi|194117502|gb|EDW39545.1| GL11910 [Drosophila persimilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query83
FB|FBgn0036984 669 CG13248 [Drosophila melanogast 0.795 0.098 0.636 1.2e-17
UNIPROTKB|F1RSU0 429 SLC7A1 "Uncharacterized protei 0.313 0.060 0.769 1.5e-14
UNIPROTKB|F1N5P6 629 SLC7A1 "Uncharacterized protei 0.409 0.054 0.631 2.7e-14
UNIPROTKB|F1P388 624 SLC7A1 "Uncharacterized protei 0.313 0.041 0.769 3.4e-14
UNIPROTKB|P30825 629 SLC7A1 "High affinity cationic 0.409 0.054 0.631 3.4e-14
UNIPROTKB|E2QU34 629 SLC7A1 "Uncharacterized protei 0.313 0.041 0.769 3.5e-14
MGI|MGI:99828 657 Slc7a2 "solute carrier family 0.313 0.039 0.769 6.3e-14
RGD|68387 657 Slc7a2 "solute carrier family 0.313 0.039 0.769 6.3e-14
UNIPROTKB|F1MAM0 704 Slc7a2 "Low affinity cationic 0.313 0.036 0.769 7.5e-14
UNIPROTKB|F1NW41 609 SLC7A2 "Low affinity cationic 0.313 0.042 0.769 1.1e-13
FB|FBgn0036984 CG13248 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 225 (84.3 bits), Expect = 1.2e-17, P = 1.2e-17
 Identities = 42/66 (63%), Positives = 49/66 (74%)

Query:     2 GVKGSAFINSFLTLANLMVMGIVIVVGFYYGRLDNWINEGGGFLPYGISGVVAGAATCFY 61
             GVK +A  NS LTL N+ VM +VI VGF+Y    NW    GGFLPYG+ GV+AGAATCFY
Sbjct:   189 GVKATAVFNSLLTLVNIAVMVLVISVGFWYADGKNWSEAEGGFLPYGVGGVIAGAATCFY 248

Query:    62 AYVGFD 67
             A+VGFD
Sbjct:   249 AFVGFD 254




GO:0015326 "cationic amino acid transmembrane transporter activity" evidence=ISS
GO:0016020 "membrane" evidence=IEA
GO:0003333 "amino acid transmembrane transport" evidence=ISS
GO:0015171 "amino acid transmembrane transporter activity" evidence=ISS
UNIPROTKB|F1RSU0 SLC7A1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1N5P6 SLC7A1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1P388 SLC7A1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P30825 SLC7A1 "High affinity cationic amino acid transporter 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2QU34 SLC7A1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:99828 Slc7a2 "solute carrier family 7 (cationic amino acid transporter, y+ system), member 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|68387 Slc7a2 "solute carrier family 7 (cationic amino acid transporter, y+ system), member 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MAM0 Slc7a2 "Low affinity cationic amino acid transporter 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NW41 SLC7A2 "Low affinity cationic amino acid transporter 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query83
TIGR00906 557 TIGR00906, 2A0303, cationic amino acid transport p 1e-18
TIGR00909 429 TIGR00909, 2A0306, amino acid transporter 9e-07
>gnl|CDD|129984 TIGR00906, 2A0303, cationic amino acid transport permease Back     alignment and domain information
 Score = 77.9 bits (192), Expect = 1e-18
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 4/71 (5%)

Query: 1   MGVKGSAFINSFLTLANLMVMGIVIVVGFYYGRLDNW----INEGGGFLPYGISGVVAGA 56
            GVK SA++N   T  N++V+  VI+ GF    + NW        GGF+PYG +GV++GA
Sbjct: 178 FGVKESAWVNKIFTAINILVLLFVIIAGFTKADVANWSITEEKGAGGFMPYGFTGVLSGA 237

Query: 57  ATCFYAYVGFD 67
           ATCF+A++GFD
Sbjct: 238 ATCFFAFIGFD 248


[Transport and binding proteins, Amino acids, peptides and amines]. Length = 557

>gnl|CDD|129987 TIGR00909, 2A0306, amino acid transporter Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 83
TIGR00906 557 2A0303 cationic amino acid transport permease. 99.62
PRK10644 445 arginine:agmatin antiporter; Provisional 99.43
PRK11357 445 frlA putative fructoselysine transporter; Provisio 99.42
COG1113 462 AnsP Gamma-aminobutyrate permease and related perm 99.4
PRK10197 446 gamma-aminobutyrate transporter; Provisional 99.39
PRK10435 435 cadB lysine/cadaverine antiporter; Provisional 99.39
PRK10655 438 potE putrescine transporter; Provisional 99.39
PRK11049 469 D-alanine/D-serine/glycine permease; Provisional 99.39
TIGR00909 429 2A0306 amino acid transporter. 99.38
PRK10746 461 putative transport protein YifK; Provisional 99.36
TIGR00908 442 2A0305 ethanolamine permease. The three genes used 99.35
PRK10249 458 phenylalanine transporter; Provisional 99.34
PRK15049 499 L-asparagine permease; Provisional 99.33
PRK10836 489 lysine transporter; Provisional 99.31
TIGR01773 452 GABAperm gamma-aminobutyrate permease. GabP is hig 99.3
PRK11021 410 putative transporter; Provisional 99.3
KOG1286|consensus 554 99.3
PRK11387 471 S-methylmethionine transporter; Provisional 99.29
PRK10580 457 proY putative proline-specific permease; Provision 99.28
PRK10238 456 aromatic amino acid transporter; Provisional 99.27
TIGR00911 501 2A0308 L-type amino acid transporter. 99.25
TIGR03810 468 arg_ornith_anti arginine/ornithine antiporter. Mem 99.24
TIGR00913 478 2A0310 amino acid permease (yeast). 99.23
TIGR00905 473 2A0302 transporter, basic amino acid/polyamine ant 99.22
TIGR03428 475 ureacarb_perm permease, urea carboxylase system. A 99.18
PF00324 478 AA_permease: Amino acid permease; InterPro: IPR004 99.15
COG0531 466 PotE Amino acid transporters [Amino acid transport 99.13
TIGR00907 482 2A0304 amino acid permease (GABA permease). 99.09
PF13520 426 AA_permease_2: Amino acid permease; PDB: 3NCY_A 3G 99.09
KOG1287|consensus 479 99.0
TIGR00930 953 2a30 K-Cl cotransporter. 98.95
TIGR03813 474 put_Glu_GABA_T putative glutamate/gamma-aminobutyr 98.93
PRK15238 496 inner membrane transporter YjeM; Provisional 98.83
TIGR00910 507 2A0307_GadC glutamate:gamma-aminobutyrate antiport 98.71
COG0833 541 LysP Amino acid transporters [Amino acid transport 98.66
TIGR00912 359 2A0309 spore germination protein (amino acid perme 98.52
TIGR00837 381 araaP aromatic amino acid transport protein. aroma 98.39
TIGR00814 397 stp serine transporter. The HAAAP family includes 97.68
TIGR00796 378 livcs branched-chain amino acid uptake carrier. tr 97.29
PF03845 320 Spore_permease: Spore germination protein; InterPr 96.61
KOG1289|consensus 550 96.6
PF03222 394 Trp_Tyr_perm: Tryptophan/tyrosine permease family; 95.22
COG0814 415 SdaC Amino acid permeases [Amino acid transport an 94.31
PRK10483 414 tryptophan permease; Provisional 88.81
PRK09664 415 tryptophan permease TnaB; Provisional 87.18
PRK15132 403 tyrosine transporter TyrP; Provisional 86.31
PLN03074 473 auxin influx permease; Provisional 83.72
>TIGR00906 2A0303 cationic amino acid transport permease Back     alignment and domain information
Probab=99.62  E-value=1.8e-15  Score=112.08  Aligned_cols=80  Identities=41%  Similarity=0.806  Sum_probs=71.6

Q ss_pred             CchhHHHHHHHHHHHHHHHHHHHHHHhhhhhcccccccc----CCCCccCcCHHHHHHHHHHHHHhhccHHHHHhhhhhh
Q psy4781           1 MGVKGSAFINSFLTLANLMVMGIVIVVGFYYGRLDNWIN----EGGGFLPYGISGVVAGAATCFYAYVGFDKCWKCLIRI   76 (83)
Q Consensus         1 ~Gv~~~~~~q~~lt~~kl~~l~~~ii~g~~~~~~~~~~~----~~~~~~p~g~~g~~~a~~~~~fay~G~~~v~~~aeE~   76 (83)
                      +|+|.++|+|++++.+|+++++++++.|+.+.+.+|+..    ..+++.|+|+.+++.++..++|+|.|||.+++++||+
T Consensus       178 ~Gik~s~~v~~i~~~iki~~l~~~iv~g~~~~~~~~~~~~~~~~~~~f~p~g~~g~l~g~~~~~faf~Gfd~v~~~aeE~  257 (557)
T TIGR00906       178 FGVKESAWVNKIFTAINILVLLFVIIAGFTKADVANWSITEEKGAGGFMPYGFTGVLSGAATCFFAFIGFDAIATTGEEV  257 (557)
T ss_pred             hchhHHHHHHHHHHHHHHHHHHHhhhHHHhhCCchhccccccccCCCCCCcchHHHHHHHHHHHHHHhhHHHHHHhHHhc
Confidence            589999999999999999999999999998877777652    1235788899999999999999999999999999999


Q ss_pred             cCCC
Q psy4781          77 GVRT   80 (83)
Q Consensus        77 k~~~   80 (83)
                      |||.
T Consensus       258 knP~  261 (557)
T TIGR00906       258 KNPQ  261 (557)
T ss_pred             cCcc
Confidence            9998



>PRK10644 arginine:agmatin antiporter; Provisional Back     alignment and domain information
>PRK11357 frlA putative fructoselysine transporter; Provisional Back     alignment and domain information
>COG1113 AnsP Gamma-aminobutyrate permease and related permeases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10197 gamma-aminobutyrate transporter; Provisional Back     alignment and domain information
>PRK10435 cadB lysine/cadaverine antiporter; Provisional Back     alignment and domain information
>PRK10655 potE putrescine transporter; Provisional Back     alignment and domain information
>PRK11049 D-alanine/D-serine/glycine permease; Provisional Back     alignment and domain information
>TIGR00909 2A0306 amino acid transporter Back     alignment and domain information
>PRK10746 putative transport protein YifK; Provisional Back     alignment and domain information
>TIGR00908 2A0305 ethanolamine permease Back     alignment and domain information
>PRK10249 phenylalanine transporter; Provisional Back     alignment and domain information
>PRK15049 L-asparagine permease; Provisional Back     alignment and domain information
>PRK10836 lysine transporter; Provisional Back     alignment and domain information
>TIGR01773 GABAperm gamma-aminobutyrate permease Back     alignment and domain information
>PRK11021 putative transporter; Provisional Back     alignment and domain information
>KOG1286|consensus Back     alignment and domain information
>PRK11387 S-methylmethionine transporter; Provisional Back     alignment and domain information
>PRK10580 proY putative proline-specific permease; Provisional Back     alignment and domain information
>PRK10238 aromatic amino acid transporter; Provisional Back     alignment and domain information
>TIGR00911 2A0308 L-type amino acid transporter Back     alignment and domain information
>TIGR03810 arg_ornith_anti arginine/ornithine antiporter Back     alignment and domain information
>TIGR00913 2A0310 amino acid permease (yeast) Back     alignment and domain information
>TIGR00905 2A0302 transporter, basic amino acid/polyamine antiporter (APA) family Back     alignment and domain information
>TIGR03428 ureacarb_perm permease, urea carboxylase system Back     alignment and domain information
>PF00324 AA_permease: Amino acid permease; InterPro: IPR004841 Amino acid permeases are integral membrane proteins involved in the transport of amino acids into the cell Back     alignment and domain information
>COG0531 PotE Amino acid transporters [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00907 2A0304 amino acid permease (GABA permease) Back     alignment and domain information
>PF13520 AA_permease_2: Amino acid permease; PDB: 3NCY_A 3GI8_C 3GIA_A 3GI9_C 3OB6_A 3L1L_A 3LRC_D 3LRB_B 4DJK_A 4DJI_A Back     alignment and domain information
>KOG1287|consensus Back     alignment and domain information
>TIGR00930 2a30 K-Cl cotransporter Back     alignment and domain information
>TIGR03813 put_Glu_GABA_T putative glutamate/gamma-aminobutyrate antiporter Back     alignment and domain information
>PRK15238 inner membrane transporter YjeM; Provisional Back     alignment and domain information
>TIGR00910 2A0307_GadC glutamate:gamma-aminobutyrate antiporter Back     alignment and domain information
>COG0833 LysP Amino acid transporters [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00912 2A0309 spore germination protein (amino acid permease) Back     alignment and domain information
>TIGR00837 araaP aromatic amino acid transport protein Back     alignment and domain information
>TIGR00814 stp serine transporter Back     alignment and domain information
>TIGR00796 livcs branched-chain amino acid uptake carrier Back     alignment and domain information
>PF03845 Spore_permease: Spore germination protein; InterPro: IPR004761 Amino acid permeases are integral membrane proteins involved in the transport of amino acids into the cell Back     alignment and domain information
>KOG1289|consensus Back     alignment and domain information
>PF03222 Trp_Tyr_perm: Tryptophan/tyrosine permease family; InterPro: IPR018227 Amino acid permeases are integral membrane proteins involved in the transport of amino acids into the cell Back     alignment and domain information
>COG0814 SdaC Amino acid permeases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10483 tryptophan permease; Provisional Back     alignment and domain information
>PRK09664 tryptophan permease TnaB; Provisional Back     alignment and domain information
>PRK15132 tyrosine transporter TyrP; Provisional Back     alignment and domain information
>PLN03074 auxin influx permease; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query83
3gia_A 444 Uncharacterized protein MJ0609; membrane protein, 2e-13
3l1l_A 445 Arginine/agmatine antiporter; TCDB 2.A.3.2.5, ADIC 7e-09
4djk_A 511 Probable glutamate/gamma-aminobutyrate antiporter; 1e-04
>3gia_A Uncharacterized protein MJ0609; membrane protein, transporter, cell membrane, membrane, transmembrane, transport protein; HET: D10 BCN; 2.32A {Methanocaldococcus jannaschii} PDB: 3gi9_C* 3gi8_C Length = 444 Back     alignment and structure
 Score = 62.3 bits (152), Expect = 2e-13
 Identities = 17/67 (25%), Positives = 28/67 (41%), Gaps = 3/67 (4%)

Query: 1   MGVKGSAFINSFLTLANLMVMGIVIVVGFYYGRLDNWINEGGGFLPYGISGVVAGAATCF 60
            G K       F+ L  L+++G+ I  G         I       P  +SG++  +A  F
Sbjct: 142 FGSKAVGRAEFFIVLVKLLILGLFIFAGLITIHPSYVIP---DLAPSAVSGMIFASAIFF 198

Query: 61  YAYVGFD 67
            +Y+GF 
Sbjct: 199 LSYMGFG 205


>3l1l_A Arginine/agmatine antiporter; TCDB 2.A.3.2.5, ADIC, Arg-bound, amino-acid transport, cell inner membrane, cell membrane, membrane; HET: ARG BNG; 3.00A {Escherichia coli} PDB: 3h5m_A* 3h6b_A 3lrb_A 3lrc_A 3ob6_A* 3hqk_A 3ncy_A Length = 445 Back     alignment and structure
>4djk_A Probable glutamate/gamma-aminobutyrate antiporter; LEUT, glutamate-GABA antiporter, transport protein; 3.10A {Escherichia coli} PDB: 4dji_A Length = 511 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query83
3gia_A 444 Uncharacterized protein MJ0609; membrane protein, 99.38
3l1l_A 445 Arginine/agmatine antiporter; TCDB 2.A.3.2.5, ADIC 99.24
4djk_A 511 Probable glutamate/gamma-aminobutyrate antiporter; 98.87
>3gia_A Uncharacterized protein MJ0609; membrane protein, transporter, cell membrane, membrane, transmembrane, transport protein; HET: D10 BCN; 2.32A {Methanocaldococcus jannaschii} PDB: 3gi9_C* 3gi8_C Back     alignment and structure
Probab=99.38  E-value=5e-13  Score=93.67  Aligned_cols=77  Identities=23%  Similarity=0.396  Sum_probs=69.0

Q ss_pred             CchhHHHHHHHHHHHHHHHHHHHHHHhhhhhccccccccCCCCccCcCHHHHHHHHHHHHHhhccHHHHHhhhhhhcCCC
Q psy4781           1 MGVKGSAFINSFLTLANLMVMGIVIVVGFYYGRLDNWINEGGGFLPYGISGVVAGAATCFYAYVGFDKCWKCLIRIGVRT   80 (83)
Q Consensus         1 ~Gv~~~~~~q~~lt~~kl~~l~~~ii~g~~~~~~~~~~~~~~~~~p~g~~g~~~a~~~~~fay~G~~~v~~~aeE~k~~~   80 (83)
                      +|+|.++|+|++++.+|++.++++++.++...+.+++.|   .+.|.|+.+++.+....+|+|.|+|.+++.+||+|||.
T Consensus       142 ~g~~~~~~~~~~~~~~~i~~~~~~ii~~~~~~~~~~~~~---~~~~~g~~~~~~~~~~~~~a~~G~e~~~~~~~e~k~P~  218 (444)
T 3gia_A          142 FGSKAVGRAEFFIVLVKLLILGLFIFAGLITIHPSYVIP---DLAPSAVSGMIFASAIFFLSYMGFGVITNASEHIENPK  218 (444)
T ss_dssp             HTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCGGGTSC---CCSHHHHHHHHHHHHHGGGGGTHHHHHHTTGGGBSSHH
T ss_pred             HhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcChhhcCC---CCCCcchHHHHHHHHHHHHHHHhHHHHHHHHHHccCcc
Confidence            489999999999999999999999999998887777765   25567788899999999999999999999999999985



>3l1l_A Arginine/agmatine antiporter; TCDB 2.A.3.2.5, ADIC, Arg-bound, amino-acid transport, cell inner membrane, cell membrane, membrane; HET: ARG BNG; 3.00A {Escherichia coli} PDB: 3h5m_A* 3h6b_A 3lrb_A 3lrc_A 3ob6_A* 3hqk_A 3ncy_A Back     alignment and structure
>4djk_A Probable glutamate/gamma-aminobutyrate antiporter; LEUT, glutamate-GABA antiporter, transport protein; 3.10A {Escherichia coli} PDB: 4dji_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00