Psyllid ID: psy4805
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 159 | ||||||
| 312377903 | 1533 | hypothetical protein AND_10663 [Anophele | 1.0 | 0.103 | 0.761 | 3e-71 | |
| 158286526 | 497 | AGAP006966-PA [Anopheles gambiae str. PE | 0.993 | 0.317 | 0.784 | 2e-70 | |
| 193671580 | 494 | PREDICTED: 4-aminobutyrate aminotransfer | 1.0 | 0.321 | 0.754 | 8e-70 | |
| 170045586 | 387 | 4-aminobutyrate aminotransferase, mitoch | 0.993 | 0.408 | 0.779 | 2e-68 | |
| 195435710 | 474 | GK20289 [Drosophila willistoni] gi|19416 | 0.993 | 0.333 | 0.773 | 1e-66 | |
| 157132998 | 495 | 4-aminobutyrate aminotransferase [Aedes | 1.0 | 0.321 | 0.748 | 2e-66 | |
| 195129679 | 469 | GI13950 [Drosophila mojavensis] gi|19392 | 0.987 | 0.334 | 0.778 | 2e-66 | |
| 332027288 | 497 | 4-aminobutyrate aminotransferase, mitoch | 0.993 | 0.317 | 0.743 | 3e-66 | |
| 157107761 | 354 | 4-aminobutyrate aminotransferase [Aedes | 1.0 | 0.449 | 0.748 | 4e-66 | |
| 383858091 | 500 | PREDICTED: 4-aminobutyrate aminotransfer | 0.993 | 0.316 | 0.75 | 6e-66 |
| >gi|312377903|gb|EFR24619.1| hypothetical protein AND_10663 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
Score = 273 bits (697), Expect = 3e-71, Method: Composition-based stats.
Identities = 121/159 (76%), Positives = 137/159 (86%)
Query: 1 MMCGSCSNENAYKNIFIWYQNKQRGGASGFTKEEQESSMINQAPGAPNLSILSFKGAFHG 60
MMCGSCSNENA+KNIFIWYQ KQRG A+ F+++E +S M+NQ+PGAP LSILSF GAFHG
Sbjct: 1171 MMCGSCSNENAFKNIFIWYQKKQRGEATPFSEQEMQSCMVNQSPGAPKLSILSFHGAFHG 1230
Query: 61 RTLGCLSTTHSKYIHKIDIPAFDWPIASFPKYKYPLEENERENKAEDEKCLAEVEDLITK 120
RTLGCLSTTHSKYIHKID+P+FDWPIA FPKY+YPLEEN REN ED +CLAEVE LI
Sbjct: 1231 RTLGCLSTTHSKYIHKIDVPSFDWPIAPFPKYRYPLEENVRENAQEDARCLAEVERLIDL 1290
Query: 121 YNKKGTPVAGIVVEPIQSEGGDNHGSNYFFQQLQKIGKK 159
Y K+G PVAGI+VEPIQSEGGDN S FFQQLQ+I K+
Sbjct: 1291 YAKRGIPVAGIIVEPIQSEGGDNEASPEFFQQLQRIAKR 1329
|
Source: Anopheles darlingi Species: Anopheles darlingi Genus: Anopheles Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|158286526|ref|XP_308791.4| AGAP006966-PA [Anopheles gambiae str. PEST] gi|158286528|ref|XP_001688095.1| AGAP006966-PB [Anopheles gambiae str. PEST] gi|157020511|gb|EAA04779.4| AGAP006966-PA [Anopheles gambiae str. PEST] gi|157020512|gb|EDO64744.1| AGAP006966-PB [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|193671580|ref|XP_001951622.1| PREDICTED: 4-aminobutyrate aminotransferase, mitochondrial-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|170045586|ref|XP_001850384.1| 4-aminobutyrate aminotransferase, mitochondrial [Culex quinquefasciatus] gi|167868572|gb|EDS31955.1| 4-aminobutyrate aminotransferase, mitochondrial [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|195435710|ref|XP_002065822.1| GK20289 [Drosophila willistoni] gi|194161907|gb|EDW76808.1| GK20289 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|157132998|ref|XP_001656148.1| 4-aminobutyrate aminotransferase [Aedes aegypti] gi|108870984|gb|EAT35209.1| AAEL012609-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|195129679|ref|XP_002009283.1| GI13950 [Drosophila mojavensis] gi|193920892|gb|EDW19759.1| GI13950 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|332027288|gb|EGI67372.1| 4-aminobutyrate aminotransferase, mitochondrial [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|157107761|ref|XP_001649926.1| 4-aminobutyrate aminotransferase [Aedes aegypti] gi|108868649|gb|EAT32874.1| AAEL014886-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|383858091|ref|XP_003704536.1| PREDICTED: 4-aminobutyrate aminotransferase, mitochondrial-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 159 | ||||||
| UNIPROTKB|E2R776 | 500 | ABAT "Uncharacterized protein" | 0.993 | 0.316 | 0.672 | 1.8e-55 | |
| FB|FBgn0036927 | 486 | CG7433 [Drosophila melanogaste | 0.987 | 0.323 | 0.691 | 4.8e-55 | |
| UNIPROTKB|J9JIL9 | 477 | ABAT "4-aminobutyrate aminotra | 0.993 | 0.331 | 0.660 | 2.1e-54 | |
| UNIPROTKB|P80147 | 500 | ABAT "4-aminobutyrate aminotra | 0.993 | 0.316 | 0.660 | 2.1e-54 | |
| UNIPROTKB|F1MFB7 | 500 | ABAT "4-aminobutyrate aminotra | 0.993 | 0.316 | 0.654 | 2.6e-54 | |
| MGI|MGI:2443582 | 500 | Abat "4-aminobutyrate aminotra | 0.993 | 0.316 | 0.647 | 2.6e-54 | |
| RGD|620948 | 500 | Abat "4-aminobutyrate aminotra | 0.993 | 0.316 | 0.647 | 3.4e-54 | |
| UNIPROTKB|H3BNQ7 | 515 | ABAT "4-aminobutyrate aminotra | 0.993 | 0.306 | 0.654 | 1.1e-53 | |
| UNIPROTKB|H3BRN4 | 515 | ABAT "4-aminobutyrate aminotra | 0.993 | 0.306 | 0.654 | 1.1e-53 | |
| UNIPROTKB|P80404 | 500 | ABAT "4-aminobutyrate aminotra | 0.993 | 0.316 | 0.654 | 1.1e-53 |
| UNIPROTKB|E2R776 ABAT "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Score = 572 (206.4 bits), Expect = 1.8e-55, P = 1.8e-55
Identities = 107/159 (67%), Positives = 123/159 (77%)
Query: 1 MMCGSCSNENAYKNIFIWYQNKQRGGASGFTKEEQESSMINQAPGAPNLSILSFKGAFHG 60
M CGSCSNENA+K IFIWY+NK+RG +GF+KEE E+ MINQAPG P SILSF GAFHG
Sbjct: 161 MSCGSCSNENAFKTIFIWYRNKERG-QTGFSKEELETCMINQAPGCPEYSILSFMGAFHG 219
Query: 61 RTLGCLSTTHSKYIHKIDIPAFDWPIASFPKYKYPLXXXXXXXXXXXXXCLAEVEDLITK 120
RT+GCL+TTHSK IHKIDIP+FDWPIA FP+ KYPL CL EVEDLI K
Sbjct: 220 RTMGCLATTHSKAIHKIDIPSFDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVK 279
Query: 121 YNKKGTPVAGIVVEPIQSEGGDNHGSNYFFQQLQKIGKK 159
Y KK VAGI+VEPIQSEGGDNH S+ FF++L+ I +K
Sbjct: 280 YRKKKKTVAGIIVEPIQSEGGDNHASDDFFRKLRDISRK 318
|
|
| FB|FBgn0036927 CG7433 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9JIL9 ABAT "4-aminobutyrate aminotransferase, mitochondrial" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P80147 ABAT "4-aminobutyrate aminotransferase, mitochondrial" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MFB7 ABAT "4-aminobutyrate aminotransferase, mitochondrial" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2443582 Abat "4-aminobutyrate aminotransferase" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|620948 Abat "4-aminobutyrate aminotransferase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H3BNQ7 ABAT "4-aminobutyrate aminotransferase, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H3BRN4 ABAT "4-aminobutyrate aminotransferase, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P80404 ABAT "4-aminobutyrate aminotransferase, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 159 | |||
| TIGR00699 | 464 | TIGR00699, GABAtrns_euk, 4-aminobutyrate aminotran | 2e-89 | |
| pfam00202 | 338 | pfam00202, Aminotran_3, Aminotransferase class-III | 7e-30 | |
| cd00610 | 413 | cd00610, OAT_like, Acetyl ornithine aminotransfera | 6e-27 | |
| COG0160 | 447 | COG0160, GabT, 4-aminobutyrate aminotransferase an | 7e-27 | |
| TIGR03251 | 431 | TIGR03251, LAT_fam, L-lysine 6-transaminase | 4e-22 | |
| PRK08297 | 443 | PRK08297, PRK08297, L-lysine aminotransferase; Pro | 2e-20 | |
| PRK05769 | 441 | PRK05769, PRK05769, 4-aminobutyrate aminotransfera | 1e-13 | |
| PRK08117 | 433 | PRK08117, PRK08117, 4-aminobutyrate aminotransfera | 2e-11 | |
| PRK02627 | 396 | PRK02627, PRK02627, acetylornithine aminotransfera | 3e-11 | |
| TIGR00707 | 379 | TIGR00707, argD, transaminase, acetylornithine/suc | 3e-10 | |
| PRK01278 | 389 | PRK01278, argD, acetylornithine transaminase prote | 3e-10 | |
| COG4992 | 404 | COG4992, ArgD, Ornithine/acetylornithine aminotran | 2e-09 | |
| TIGR00508 | 417 | TIGR00508, bioA, adenosylmethionine-8-amino-7-oxon | 2e-08 | |
| PTZ00125 | 400 | PTZ00125, PTZ00125, ornithine aminotransferase-lik | 4e-07 | |
| PRK03715 | 395 | PRK03715, argD, acetylornithine transaminase prote | 6e-07 | |
| TIGR02407 | 412 | TIGR02407, ectoine_ectB, diaminobutyrate--2-oxoglu | 9e-07 | |
| TIGR00700 | 420 | TIGR00700, GABAtrnsam, 4-aminobutyrate aminotransf | 3e-06 | |
| PRK06777 | 421 | PRK06777, PRK06777, 4-aminobutyrate aminotransfera | 4e-06 | |
| TIGR00709 | 442 | TIGR00709, dat, 2,4-diaminobutyrate 4-transaminase | 1e-05 | |
| PRK06916 | 460 | PRK06916, PRK06916, adenosylmethionine--8-amino-7- | 3e-05 | |
| PRK09264 | 425 | PRK09264, PRK09264, diaminobutyrate--2-oxoglutarat | 4e-05 | |
| TIGR01885 | 401 | TIGR01885, Orn_aminotrans, ornithine aminotransfer | 4e-05 | |
| COG0161 | 449 | COG0161, BioA, Adenosylmethionine-8-amino-7-oxonon | 5e-05 | |
| PRK02936 | 377 | PRK02936, argD, acetylornithine aminotransferase; | 5e-05 | |
| PRK08088 | 425 | PRK08088, PRK08088, 4-aminobutyrate aminotransfera | 2e-04 | |
| PRK03244 | 398 | PRK03244, argD, acetylornithine aminotransferase; | 2e-04 | |
| TIGR03372 | 442 | TIGR03372, putres_am_tran, putrescine aminotransfe | 2e-04 | |
| PLN00144 | 382 | PLN00144, PLN00144, acetylornithine transaminase | 2e-04 | |
| PRK05964 | 423 | PRK05964, PRK05964, adenosylmethionine--8-amino-7- | 3e-04 | |
| PRK09792 | 421 | PRK09792, PRK09792, 4-aminobutyrate transaminase; | 3e-04 | |
| PRK06918 | 451 | PRK06918, PRK06918, 4-aminobutyrate aminotransfera | 4e-04 | |
| PRK06938 | 464 | PRK06938, PRK06938, diaminobutyrate--2-oxoglutarat | 4e-04 | |
| PRK04612 | 408 | PRK04612, argD, acetylornithine transaminase prote | 5e-04 | |
| PRK07495 | 425 | PRK07495, PRK07495, 4-aminobutyrate aminotransfera | 9e-04 | |
| PRK11522 | 459 | PRK11522, PRK11522, putrescine--2-oxoglutarate ami | 0.001 | |
| PRK06058 | 443 | PRK06058, PRK06058, 4-aminobutyrate aminotransfera | 0.001 | |
| PRK04013 | 364 | PRK04013, argD, acetylornithine/acetyl-lysine amin | 0.004 | |
| PRK05639 | 457 | PRK05639, PRK05639, 4-aminobutyrate aminotransfera | 0.004 |
| >gnl|CDD|129782 TIGR00699, GABAtrns_euk, 4-aminobutyrate aminotransferase, eukaryotic type | Back alignment and domain information |
|---|
Score = 267 bits (684), Expect = 2e-89
Identities = 101/159 (63%), Positives = 124/159 (77%), Gaps = 3/159 (1%)
Query: 1 MMCGSCSNENAYKNIFIWYQNKQRGGASGFTKEEQESSMINQAPGAPNLSILSFKGAFHG 60
M GS +NE A+K F++Y++KQRG + F++EE ES M NQAPG+P+LSILSFKGAFHG
Sbjct: 128 GMSGSDANELAFKAAFMYYRSKQRGYQADFSEEENESCMDNQAPGSPDLSILSFKGAFHG 187
Query: 61 RTLGCLSTTHSKYIHKIDIPAFDWPIASFPKYKYPLEENERENKAEDEKCLAEVEDLITK 120
R G LSTT SK IHK+DIPAFDWP A FP KYPLEE+ +EN E+++CL EVEDLI K
Sbjct: 188 RLFGSLSTTRSKPIHKLDIPAFDWPQAPFPSLKYPLEEHVKENAKEEQRCLEEVEDLIKK 247
Query: 121 YNKKGTPVAGIVVEPIQSEGGDNHGSNYFFQQLQKIGKK 159
++K PVA I+VEPIQSEGGDNH S FF++L+ I KK
Sbjct: 248 WHK---PVAAIIVEPIQSEGGDNHASPDFFRKLRDITKK 283
|
This enzyme is a class III pyridoxal-phosphate-dependent aminotransferase. This model describes known eukaryotic examples of the enzyme. The degree of sequence difference between this set and known bacterial examples is greater than the distance between either set the most similar enzyme with distinct function, and so separate models are built for prokaryotic and eukaryotic sets. Alternate names include GABA transaminase, gamma-amino-N-butyrate transaminase, and beta-alanine--oxoglutarate aminotransferase [Central intermediary metabolism, Other]. Length = 464 |
| >gnl|CDD|201078 pfam00202, Aminotran_3, Aminotransferase class-III | Back alignment and domain information |
|---|
| >gnl|CDD|99735 cd00610, OAT_like, Acetyl ornithine aminotransferase family | Back alignment and domain information |
|---|
| >gnl|CDD|223238 COG0160, GabT, 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|132295 TIGR03251, LAT_fam, L-lysine 6-transaminase | Back alignment and domain information |
|---|
| >gnl|CDD|236224 PRK08297, PRK08297, L-lysine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235599 PRK05769, PRK05769, 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181234 PRK08117, PRK08117, 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235056 PRK02627, PRK02627, acetylornithine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233098 TIGR00707, argD, transaminase, acetylornithine/succinylornithine family | Back alignment and domain information |
|---|
| >gnl|CDD|179270 PRK01278, argD, acetylornithine transaminase protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227325 COG4992, ArgD, Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233000 TIGR00508, bioA, adenosylmethionine-8-amino-7-oxononanoate transaminase | Back alignment and domain information |
|---|
| >gnl|CDD|240281 PTZ00125, PTZ00125, ornithine aminotransferase-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179636 PRK03715, argD, acetylornithine transaminase protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233853 TIGR02407, ectoine_ectB, diaminobutyrate--2-oxoglutarate aminotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|129783 TIGR00700, GABAtrnsam, 4-aminobutyrate aminotransferase, prokaryotic type | Back alignment and domain information |
|---|
| >gnl|CDD|180690 PRK06777, PRK06777, 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|129792 TIGR00709, dat, 2,4-diaminobutyrate 4-transaminases | Back alignment and domain information |
|---|
| >gnl|CDD|180746 PRK06916, PRK06916, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236437 PRK09264, PRK09264, diaminobutyrate--2-oxoglutarate aminotransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|130940 TIGR01885, Orn_aminotrans, ornithine aminotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|223239 COG0161, BioA, Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|179505 PRK02936, argD, acetylornithine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236149 PRK08088, PRK08088, 4-aminobutyrate aminotransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235112 PRK03244, argD, acetylornithine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132415 TIGR03372, putres_am_tran, putrescine aminotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|177748 PLN00144, PLN00144, acetylornithine transaminase | Back alignment and domain information |
|---|
| >gnl|CDD|235656 PRK05964, PRK05964, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182078 PRK09792, PRK09792, 4-aminobutyrate transaminase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235885 PRK06918, PRK06918, 4-aminobutyrate aminotransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235892 PRK06938, PRK06938, diaminobutyrate--2-oxoglutarate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179868 PRK04612, argD, acetylornithine transaminase protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236032 PRK07495, PRK07495, 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183175 PRK11522, PRK11522, putrescine--2-oxoglutarate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235685 PRK06058, PRK06058, 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|101376 PRK04013, argD, acetylornithine/acetyl-lysine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|168145 PRK05639, PRK05639, 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 159 | |||
| COG0160 | 447 | GabT 4-aminobutyrate aminotransferase and related | 100.0 | |
| COG4992 | 404 | ArgD Ornithine/acetylornithine aminotransferase [A | 100.0 | |
| COG0161 | 449 | BioA Adenosylmethionine-8-amino-7-oxononanoate ami | 99.98 | |
| KOG1405|consensus | 484 | 99.98 | ||
| TIGR00699 | 464 | GABAtrns_euk 4-aminobutyrate aminotransferase, euk | 99.98 | |
| PRK05965 | 459 | hypothetical protein; Provisional | 99.97 | |
| PRK07482 | 461 | hypothetical protein; Provisional | 99.97 | |
| PRK07678 | 451 | aminotransferase; Validated | 99.97 | |
| PRK08742 | 472 | adenosylmethionine--8-amino-7-oxononanoate transam | 99.97 | |
| PRK07481 | 449 | hypothetical protein; Provisional | 99.97 | |
| PRK06916 | 460 | adenosylmethionine--8-amino-7-oxononanoate transam | 99.97 | |
| PRK06943 | 453 | adenosylmethionine--8-amino-7-oxononanoate transam | 99.97 | |
| PRK07030 | 466 | adenosylmethionine--8-amino-7-oxononanoate transam | 99.96 | |
| PRK06938 | 464 | diaminobutyrate--2-oxoglutarate aminotransferase; | 99.96 | |
| PRK07483 | 443 | hypothetical protein; Provisional | 99.96 | |
| PRK06931 | 459 | diaminobutyrate--2-oxoglutarate aminotransferase; | 99.96 | |
| PRK07036 | 466 | hypothetical protein; Provisional | 99.96 | |
| KOG1401|consensus | 433 | 99.96 | ||
| TIGR03251 | 431 | LAT_fam L-lysine 6-transaminase. Characterized mem | 99.96 | |
| PRK08297 | 443 | L-lysine aminotransferase; Provisional | 99.96 | |
| PRK07480 | 456 | putative aminotransferase; Validated | 99.96 | |
| PRK06917 | 447 | hypothetical protein; Provisional | 99.96 | |
| PRK06173 | 429 | adenosylmethionine--8-amino-7-oxononanoate transam | 99.96 | |
| PRK05639 | 457 | 4-aminobutyrate aminotransferase; Provisional | 99.96 | |
| PRK06105 | 460 | aminotransferase; Provisional | 99.96 | |
| KOG1404|consensus | 442 | 99.96 | ||
| PRK13360 | 442 | omega amino acid--pyruvate transaminase; Provision | 99.95 | |
| PRK06541 | 460 | hypothetical protein; Provisional | 99.95 | |
| PRK09221 | 445 | beta alanine--pyruvate transaminase; Provisional | 99.95 | |
| PRK06062 | 451 | hypothetical protein; Provisional | 99.95 | |
| PRK09264 | 425 | diaminobutyrate--2-oxoglutarate aminotransferase; | 99.95 | |
| TIGR03372 | 442 | putres_am_tran putrescine aminotransferase. Member | 99.95 | |
| PF00202 | 339 | Aminotran_3: Aminotransferase class-III; InterPro: | 99.95 | |
| TIGR02407 | 412 | ectoine_ectB diaminobutyrate--2-oxoglutarate amino | 99.95 | |
| PLN02760 | 504 | 4-aminobutyrate:pyruvate transaminase | 99.95 | |
| PRK11522 | 459 | putrescine--2-oxoglutarate aminotransferase; Provi | 99.95 | |
| PRK06918 | 451 | 4-aminobutyrate aminotransferase; Reviewed | 99.95 | |
| TIGR00709 | 442 | dat 2,4-diaminobutyrate 4-transaminases. This fami | 99.95 | |
| PRK05630 | 422 | adenosylmethionine--8-amino-7-oxononanoate transam | 99.95 | |
| PRK08593 | 445 | 4-aminobutyrate aminotransferase; Provisional | 99.95 | |
| KOG1402|consensus | 427 | 99.95 | ||
| TIGR00700 | 420 | GABAtrnsam 4-aminobutyrate aminotransferase, proka | 99.94 | |
| PRK12403 | 460 | putative aminotransferase; Provisional | 99.94 | |
| PRK05964 | 423 | adenosylmethionine--8-amino-7-oxononanoate transam | 99.94 | |
| PRK06082 | 459 | 4-aminobutyrate aminotransferase; Provisional | 99.94 | |
| PRK07986 | 428 | adenosylmethionine--8-amino-7-oxononanoate transam | 99.94 | |
| PLN02974 | 817 | adenosylmethionine-8-amino-7-oxononanoate transami | 99.94 | |
| PRK05769 | 441 | 4-aminobutyrate aminotransferase; Provisional | 99.94 | |
| PRK06148 | 1013 | hypothetical protein; Provisional | 99.94 | |
| PRK08117 | 433 | 4-aminobutyrate aminotransferase; Provisional | 99.93 | |
| PRK06777 | 421 | 4-aminobutyrate aminotransferase; Provisional | 99.93 | |
| PRK07495 | 425 | 4-aminobutyrate aminotransferase; Provisional | 99.93 | |
| PRK04612 | 408 | argD acetylornithine transaminase protein; Provisi | 99.93 | |
| PRK12389 | 428 | glutamate-1-semialdehyde aminotransferase; Provisi | 99.93 | |
| PRK06058 | 443 | 4-aminobutyrate aminotransferase; Provisional | 99.93 | |
| PRK08360 | 443 | 4-aminobutyrate aminotransferase; Provisional | 99.93 | |
| PRK09792 | 421 | 4-aminobutyrate transaminase; Provisional | 99.93 | |
| COG0001 | 432 | HemL Glutamate-1-semialdehyde aminotransferase [Co | 99.92 | |
| PRK04013 | 364 | argD acetylornithine/acetyl-lysine aminotransferas | 99.92 | |
| PLN00144 | 382 | acetylornithine transaminase | 99.92 | |
| TIGR00508 | 427 | bioA adenosylmethionine-8-amino-7-oxononanoate tra | 99.92 | |
| PRK06149 | 972 | hypothetical protein; Provisional | 99.91 | |
| PLN02482 | 474 | glutamate-1-semialdehyde 2,1-aminomutase | 99.91 | |
| PRK07046 | 453 | aminotransferase; Validated | 99.9 | |
| PLN02624 | 474 | ornithine-delta-aminotransferase | 99.9 | |
| PRK00615 | 433 | glutamate-1-semialdehyde aminotransferase; Provisi | 99.9 | |
| TIGR03246 | 397 | arg_catab_astC succinylornithine transaminase fami | 99.9 | |
| PRK12381 | 406 | bifunctional succinylornithine transaminase/acetyl | 99.9 | |
| PRK03715 | 395 | argD acetylornithine transaminase protein; Provisi | 99.89 | |
| PRK08088 | 425 | 4-aminobutyrate aminotransferase; Validated | 99.86 | |
| PRK05093 | 403 | argD bifunctional N-succinyldiaminopimelate-aminot | 99.84 | |
| PRK04073 | 396 | rocD ornithine--oxo-acid transaminase; Provisional | 99.84 | |
| TIGR01885 | 401 | Orn_aminotrans ornithine aminotransferase. This mo | 99.84 | |
| PRK00062 | 426 | glutamate-1-semialdehyde aminotransferase; Provisi | 99.84 | |
| TIGR00713 | 423 | hemL glutamate-1-semialdehyde-2,1-aminomutase. Thi | 99.83 | |
| PRK01278 | 389 | argD acetylornithine transaminase protein; Provisi | 99.81 | |
| PRK02936 | 377 | argD acetylornithine aminotransferase; Provisional | 99.78 | |
| KOG1403|consensus | 452 | 99.78 | ||
| PRK00854 | 401 | rocD ornithine--oxo-acid transaminase; Reviewed | 99.78 | |
| PRK04260 | 375 | acetylornithine aminotransferase; Provisional | 99.75 | |
| PTZ00125 | 400 | ornithine aminotransferase-like protein; Provision | 99.74 | |
| PRK03244 | 398 | argD acetylornithine aminotransferase; Provisional | 99.7 | |
| PRK06209 | 431 | glutamate-1-semialdehyde 2,1-aminomutase; Provisio | 99.7 | |
| cd00610 | 413 | OAT_like Acetyl ornithine aminotransferase family. | 99.62 | |
| PRK02627 | 396 | acetylornithine aminotransferase; Provisional | 99.62 | |
| TIGR00707 | 379 | argD acetylornithine and succinylornithine aminotr | 99.19 | |
| PRK07505 | 402 | hypothetical protein; Provisional | 98.78 | |
| PRK13393 | 406 | 5-aminolevulinate synthase; Provisional | 98.52 | |
| TIGR01821 | 402 | 5aminolev_synth 5-aminolevulinic acid synthase. Th | 98.07 | |
| PRK09064 | 407 | 5-aminolevulinate synthase; Validated | 97.72 | |
| cd00613 | 398 | GDC-P Glycine cleavage system P-protein, alpha- an | 97.61 | |
| PLN02822 | 481 | serine palmitoyltransferase | 97.54 | |
| PRK13392 | 410 | 5-aminolevulinate synthase; Provisional | 96.99 | |
| PRK05937 | 370 | 8-amino-7-oxononanoate synthase; Provisional | 96.69 | |
| PRK05958 | 385 | 8-amino-7-oxononanoate synthase; Reviewed | 96.68 | |
| PRK07179 | 407 | hypothetical protein; Provisional | 96.56 | |
| TIGR01825 | 385 | gly_Cac_T_rel pyridoxal phosphate-dependent acyltr | 96.46 | |
| cd01494 | 170 | AAT_I Aspartate aminotransferase (AAT) superfamily | 95.71 | |
| PLN02721 | 353 | threonine aldolase | 95.27 | |
| cd00609 | 350 | AAT_like Aspartate aminotransferase family. This f | 94.49 | |
| cd06454 | 349 | KBL_like KBL_like; this family belongs to the pyri | 93.82 | |
| TIGR00858 | 360 | bioF 8-amino-7-oxononanoate synthase. This model r | 93.65 | |
| PLN02880 | 490 | tyrosine decarboxylase | 92.69 | |
| PRK13520 | 371 | L-tyrosine decarboxylase; Provisional | 92.29 | |
| PRK06084 | 425 | O-acetylhomoserine aminocarboxypropyltransferase; | 92.23 | |
| PRK06939 | 397 | 2-amino-3-ketobutyrate coenzyme A ligase; Provisio | 92.07 | |
| TIGR01326 | 418 | OAH_OAS_sulfhy OAH/OAS sulfhydrylase. This model d | 91.6 | |
| TIGR00461 | 939 | gcvP glycine dehydrogenase (decarboxylating). This | 91.45 | |
| PRK05994 | 427 | O-acetylhomoserine aminocarboxypropyltransferase; | 91.45 | |
| cd00614 | 369 | CGS_like CGS_like: Cystathionine gamma-synthase is | 91.34 | |
| PF01212 | 290 | Beta_elim_lyase: Beta-eliminating lyase; InterPro: | 91.0 | |
| TIGR03402 | 379 | FeS_nifS cysteine desulfurase NifS. Members of thi | 90.05 | |
| PLN03227 | 392 | serine palmitoyltransferase-like protein; Provisio | 89.94 | |
| PRK12566 | 954 | glycine dehydrogenase; Provisional | 89.34 | |
| PLN02955 | 476 | 8-amino-7-oxononanoate synthase | 89.32 | |
| PRK15407 | 438 | lipopolysaccharide biosynthesis protein RfbH; Prov | 89.2 | |
| cd06450 | 345 | DOPA_deC_like DOPA decarboxylase family. This fami | 88.73 | |
| PLN03032 | 374 | serine decarboxylase; Provisional | 87.91 | |
| PLN02651 | 364 | cysteine desulfurase | 86.96 | |
| PLN02590 | 539 | probable tyrosine decarboxylase | 86.85 | |
| PLN02263 | 470 | serine decarboxylase | 86.68 | |
| PRK14012 | 404 | cysteine desulfurase; Provisional | 86.17 | |
| TIGR01325 | 380 | O_suc_HS_sulf O-succinylhomoserine sulfhydrylase. | 86.04 | |
| TIGR02006 | 402 | IscS cysteine desulfurase IscS. This model represe | 85.15 | |
| TIGR03301 | 355 | PhnW-AepZ 2-aminoethylphosphonate aminotransferase | 85.04 | |
| cd00616 | 352 | AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa | 84.84 | |
| cd06502 | 338 | TA_like Low-specificity threonine aldolase (TA). T | 84.82 | |
| TIGR03799 | 522 | NOD_PanD_pyr putative pyridoxal-dependent aspartat | 84.34 | |
| PRK05367 | 954 | glycine dehydrogenase; Provisional | 84.2 | |
| PLN02414 | 993 | glycine dehydrogenase (decarboxylating) | 83.29 | |
| PRK07777 | 387 | aminotransferase; Validated | 82.91 | |
| PRK02769 | 380 | histidine decarboxylase; Provisional | 81.54 | |
| COG1003 | 496 | GcvP Glycine cleavage system protein P (pyridoxal- | 80.6 | |
| KOG1549|consensus | 428 | 80.56 | ||
| PRK13238 | 460 | tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d | 80.23 |
| >COG0160 GabT 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.9e-33 Score=233.95 Aligned_cols=129 Identities=30% Similarity=0.390 Sum_probs=108.5
Q ss_pred CCCcchHHHHHHHHHHHHHHhhcCCCCCCCchhhhhhhhhccCCCCCCceEEEEcCCCCccchhhhhcCCCcccc-ccCC
Q psy4805 1 MMCGSCSNENAYKNIFIWYQNKQRGGASGFTKEEQESSMINQAPGAPNLSILSFKGAFHGRTLGCLSTTHSKYIH-KIDI 79 (159)
Q Consensus 1 ~~sGseA~e~AlklA~~~~~~~~~g~~~~~~~~~~~~~~~~~~~g~~r~~Ii~~~~sYHG~T~ga~s~s~~~~~~-~~~~ 79 (159)
+||||||||+||||||.|+ | |..||+|.++|||+|.++||+|++...+ ..+.
T Consensus 123 ~~sGaeA~E~AiKiAr~~T-------------------------g--r~~viaf~~afHG~T~galslT~~~~~~~~~~~ 175 (447)
T COG0160 123 GNSGAEAVEAAIKIARAYT-------------------------G--RPGVIAFDGAFHGRTLGALSLTGSKPPYKAGFG 175 (447)
T ss_pred cCCcHHHHHHHHHHHHHHh-------------------------C--CCcEEEECCcccccchhhHHhccCccccccCCC
Confidence 4899999999999999995 5 8899999999999999999999986544 3455
Q ss_pred CCC-CCCcccCCC-CCCCCccchhhhhHHHHHHHHHHHHHHHHhccCCCCeEEEEEcccccCCCCccCCHHHHHHHHHHh
Q psy4805 80 PAF-DWPIASFPK-YKYPLEENERENKAEDEKCLAEVEDLITKYNKKGTPVAGIVVEPIQSEGGDNHGSNYFFQQLQKIG 157 (159)
Q Consensus 80 ~~~-~~~~~p~p~-~~~~~~~~~~~~~~~~~~~~~~le~~i~~~~~~~~~vAAvI~EPiqG~gGv~~pp~~fl~~lr~lc 157 (159)
+.. ++.++|+|+ |++|+... .+++...+++++++.+.....++.++||||+|||||+||+++||++||++||++|
T Consensus 176 ~~~~~v~~~Pyp~~yr~p~~~~---~~~~~~~~~~~~e~~i~~~~~~~~~vAaiI~EpIQgegG~~v~p~~fl~~l~~~~ 252 (447)
T COG0160 176 PLPPGVYHVPYPNPYRCPFGIG---GEECGDDALEYIERALFDLEVGPEEVAAIIIEPIQGEGGIIVPPKGFLKALRKLC 252 (447)
T ss_pred CCCCCeEEecCCccccCcccCc---hhhhhHHHHHHHHHHHHhhcCCCCceeEEEEecccCCCCCcCCCHHHHHHHHHHH
Confidence 554 478899997 78876432 2456667788888877766566789999999999999999999999999999999
Q ss_pred cC
Q psy4805 158 KK 159 (159)
Q Consensus 158 ~~ 159 (159)
||
T Consensus 253 ~~ 254 (447)
T COG0160 253 RE 254 (447)
T ss_pred HH
Confidence 86
|
|
| >COG4992 ArgD Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0161 BioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG1405|consensus | Back alignment and domain information |
|---|
| >TIGR00699 GABAtrns_euk 4-aminobutyrate aminotransferase, eukaryotic type | Back alignment and domain information |
|---|
| >PRK05965 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07482 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07678 aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK08742 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK07481 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06916 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK06943 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK07030 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK06938 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07483 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06931 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07036 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1401|consensus | Back alignment and domain information |
|---|
| >TIGR03251 LAT_fam L-lysine 6-transaminase | Back alignment and domain information |
|---|
| >PRK08297 L-lysine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07480 putative aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK06917 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06173 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK05639 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06105 aminotransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1404|consensus | Back alignment and domain information |
|---|
| >PRK13360 omega amino acid--pyruvate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK06541 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09221 beta alanine--pyruvate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK06062 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09264 diaminobutyrate--2-oxoglutarate aminotransferase; Validated | Back alignment and domain information |
|---|
| >TIGR03372 putres_am_tran putrescine aminotransferase | Back alignment and domain information |
|---|
| >PF00202 Aminotran_3: Aminotransferase class-III; InterPro: IPR005814 Aminotransferases share certain mechanistic features with other pyridoxalphosphate-dependent enzymes, such as the covalent binding of the pyridoxalphosphate group to a lysine residue | Back alignment and domain information |
|---|
| >TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase | Back alignment and domain information |
|---|
| >PLN02760 4-aminobutyrate:pyruvate transaminase | Back alignment and domain information |
|---|
| >PRK11522 putrescine--2-oxoglutarate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06918 4-aminobutyrate aminotransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00709 dat 2,4-diaminobutyrate 4-transaminases | Back alignment and domain information |
|---|
| >PRK05630 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK08593 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1402|consensus | Back alignment and domain information |
|---|
| >TIGR00700 GABAtrnsam 4-aminobutyrate aminotransferase, prokaryotic type | Back alignment and domain information |
|---|
| >PRK12403 putative aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05964 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK06082 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07986 adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated | Back alignment and domain information |
|---|
| >PLN02974 adenosylmethionine-8-amino-7-oxononanoate transaminase | Back alignment and domain information |
|---|
| >PRK05769 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08117 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06777 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07495 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK04612 argD acetylornithine transaminase protein; Provisional | Back alignment and domain information |
|---|
| >PRK12389 glutamate-1-semialdehyde aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06058 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08360 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09792 4-aminobutyrate transaminase; Provisional | Back alignment and domain information |
|---|
| >COG0001 HemL Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK04013 argD acetylornithine/acetyl-lysine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PLN00144 acetylornithine transaminase | Back alignment and domain information |
|---|
| >TIGR00508 bioA adenosylmethionine-8-amino-7-oxononanoate transaminase | Back alignment and domain information |
|---|
| >PRK06149 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02482 glutamate-1-semialdehyde 2,1-aminomutase | Back alignment and domain information |
|---|
| >PRK07046 aminotransferase; Validated | Back alignment and domain information |
|---|
| >PLN02624 ornithine-delta-aminotransferase | Back alignment and domain information |
|---|
| >PRK00615 glutamate-1-semialdehyde aminotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03246 arg_catab_astC succinylornithine transaminase family | Back alignment and domain information |
|---|
| >PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK03715 argD acetylornithine transaminase protein; Provisional | Back alignment and domain information |
|---|
| >PRK08088 4-aminobutyrate aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed | Back alignment and domain information |
|---|
| >PRK04073 rocD ornithine--oxo-acid transaminase; Provisional | Back alignment and domain information |
|---|
| >TIGR01885 Orn_aminotrans ornithine aminotransferase | Back alignment and domain information |
|---|
| >PRK00062 glutamate-1-semialdehyde aminotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00713 hemL glutamate-1-semialdehyde-2,1-aminomutase | Back alignment and domain information |
|---|
| >PRK01278 argD acetylornithine transaminase protein; Provisional | Back alignment and domain information |
|---|
| >PRK02936 argD acetylornithine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1403|consensus | Back alignment and domain information |
|---|
| >PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed | Back alignment and domain information |
|---|
| >PRK04260 acetylornithine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PTZ00125 ornithine aminotransferase-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK03244 argD acetylornithine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06209 glutamate-1-semialdehyde 2,1-aminomutase; Provisional | Back alignment and domain information |
|---|
| >cd00610 OAT_like Acetyl ornithine aminotransferase family | Back alignment and domain information |
|---|
| >PRK02627 acetylornithine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00707 argD acetylornithine and succinylornithine aminotransferases | Back alignment and domain information |
|---|
| >PRK07505 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13393 5-aminolevulinate synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase | Back alignment and domain information |
|---|
| >PRK09064 5-aminolevulinate synthase; Validated | Back alignment and domain information |
|---|
| >cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits | Back alignment and domain information |
|---|
| >PLN02822 serine palmitoyltransferase | Back alignment and domain information |
|---|
| >PRK13392 5-aminolevulinate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK05937 8-amino-7-oxononanoate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK05958 8-amino-7-oxononanoate synthase; Reviewed | Back alignment and domain information |
|---|
| >PRK07179 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative | Back alignment and domain information |
|---|
| >cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes | Back alignment and domain information |
|---|
| >PLN02721 threonine aldolase | Back alignment and domain information |
|---|
| >cd00609 AAT_like Aspartate aminotransferase family | Back alignment and domain information |
|---|
| >cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) | Back alignment and domain information |
|---|
| >TIGR00858 bioF 8-amino-7-oxononanoate synthase | Back alignment and domain information |
|---|
| >PLN02880 tyrosine decarboxylase | Back alignment and domain information |
|---|
| >PRK13520 L-tyrosine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK06084 O-acetylhomoserine aminocarboxypropyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional | Back alignment and domain information |
|---|
| >TIGR01326 OAH_OAS_sulfhy OAH/OAS sulfhydrylase | Back alignment and domain information |
|---|
| >TIGR00461 gcvP glycine dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >PRK05994 O-acetylhomoserine aminocarboxypropyltransferase; Validated | Back alignment and domain information |
|---|
| >cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis | Back alignment and domain information |
|---|
| >PF01212 Beta_elim_lyase: Beta-eliminating lyase; InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases | Back alignment and domain information |
|---|
| >TIGR03402 FeS_nifS cysteine desulfurase NifS | Back alignment and domain information |
|---|
| >PLN03227 serine palmitoyltransferase-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK12566 glycine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02955 8-amino-7-oxononanoate synthase | Back alignment and domain information |
|---|
| >PRK15407 lipopolysaccharide biosynthesis protein RfbH; Provisional | Back alignment and domain information |
|---|
| >cd06450 DOPA_deC_like DOPA decarboxylase family | Back alignment and domain information |
|---|
| >PLN03032 serine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PLN02651 cysteine desulfurase | Back alignment and domain information |
|---|
| >PLN02590 probable tyrosine decarboxylase | Back alignment and domain information |
|---|
| >PLN02263 serine decarboxylase | Back alignment and domain information |
|---|
| >PRK14012 cysteine desulfurase; Provisional | Back alignment and domain information |
|---|
| >TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase | Back alignment and domain information |
|---|
| >TIGR02006 IscS cysteine desulfurase IscS | Back alignment and domain information |
|---|
| >TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase | Back alignment and domain information |
|---|
| >cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) | Back alignment and domain information |
|---|
| >cd06502 TA_like Low-specificity threonine aldolase (TA) | Back alignment and domain information |
|---|
| >TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase | Back alignment and domain information |
|---|
| >PRK05367 glycine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02414 glycine dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >PRK07777 aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK02769 histidine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >COG1003 GcvP Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1549|consensus | Back alignment and domain information |
|---|
| >PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 159 | ||||
| 1ohv_A | 472 | 4-aminobutyrate-aminotransferase From Pig Length = | 4e-60 | ||
| 2cin_A | 449 | Lysine Aminotransferase From M. Tuberculosis In The | 9e-09 | ||
| 2jjf_A | 449 | N328a Mutant Of M. Tuberculosis Rv3290c Length = 44 | 1e-08 | ||
| 2jje_A | 449 | Crystal Structure Of T330s Mutant Of Rv3290c From M | 1e-08 | ||
| 2jjh_A | 449 | E243 Mutant Of M. Tuberculosis Rv3290c Length = 449 | 5e-08 | ||
| 2eo5_A | 419 | Crystal Structure Of 4-Aminobutyrate Aminotransfera | 2e-07 | ||
| 2eh6_A | 375 | Crystal Structure Of Acetylornithine Aminotransfera | 1e-06 | ||
| 3nx3_A | 395 | Crystal Structure Of Acetylornithine Aminotransfera | 5e-04 |
| >pdb|1OHV|A Chain A, 4-aminobutyrate-aminotransferase From Pig Length = 472 | Back alignment and structure |
|
| >pdb|2CIN|A Chain A, Lysine Aminotransferase From M. Tuberculosis In The Internal Aldimine Form Length = 449 | Back alignment and structure |
| >pdb|2JJF|A Chain A, N328a Mutant Of M. Tuberculosis Rv3290c Length = 449 | Back alignment and structure |
| >pdb|2JJE|A Chain A, Crystal Structure Of T330s Mutant Of Rv3290c From M. Tuberculosis Length = 449 | Back alignment and structure |
| >pdb|2JJH|A Chain A, E243 Mutant Of M. Tuberculosis Rv3290c Length = 449 | Back alignment and structure |
| >pdb|2EO5|A Chain A, Crystal Structure Of 4-Aminobutyrate Aminotransferase From Sulfolobus Tokodaii Strain7 Length = 419 | Back alignment and structure |
| >pdb|2EH6|A Chain A, Crystal Structure Of Acetylornithine Aminotransferase From Aquifex Aeolicus Vf5 Length = 375 | Back alignment and structure |
| >pdb|3NX3|A Chain A, Crystal Structure Of Acetylornithine Aminotransferase (Argd) From Campylobacter Jejuni Length = 395 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 159 | |||
| 1ohv_A | 472 | 4-aminobutyrate aminotransferase; PLP-dependent en | 1e-79 | |
| 2cjg_A | 449 | L-lysine-epsilon aminotransferase; internal aldimi | 9e-59 | |
| 1sff_A | 426 | 4-aminobutyrate aminotransferase; enzyme complexes | 3e-18 | |
| 3oks_A | 451 | 4-aminobutyrate transaminase; ssgcid, transferase, | 9e-18 | |
| 2eo5_A | 419 | 419AA long hypothetical aminotransferase; PLP enzy | 3e-17 | |
| 4ffc_A | 453 | 4-aminobutyrate aminotransferase (GABT); structura | 9e-16 | |
| 1zod_A | 433 | DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, | 2e-15 | |
| 3dxv_A | 439 | Alpha-amino-epsilon-caprolactam racemase; fold-TYP | 4e-14 | |
| 2ord_A | 397 | Acoat, acetylornithine aminotransferase; TM1785, a | 6e-12 | |
| 3nx3_A | 395 | Acoat, acetylornithine aminotransferase; csgid, st | 6e-12 | |
| 2pb2_A | 420 | Acetylornithine/succinyldiaminopimelate aminotran; | 6e-12 | |
| 2eh6_A | 375 | Acoat, acetylornithine aminotransferase; ARGD, str | 9e-12 | |
| 1vef_A | 395 | Acetylornithine/acetyl-lysine aminotransferase; PL | 5e-10 | |
| 3n5m_A | 452 | Adenosylmethionine-8-amino-7-oxononanoate aminotr; | 1e-09 | |
| 1z7d_A | 433 | Ornithine aminotransferase; structural genomics co | 3e-08 | |
| 2oat_A | 439 | Ornithine aminotransferase; 5-fluoromethylornithin | 6e-08 | |
| 3gju_A | 460 | Putative aminotransferase; pyridoxal phosphate, PL | 8e-08 | |
| 3ruy_A | 392 | Ornithine aminotransferase; structural genomics, c | 1e-07 | |
| 3dod_A | 448 | Adenosylmethionine-8-amino-7-oxononanoate aminotr; | 3e-07 | |
| 4a6r_A | 459 | Omega transaminase; transferase, PLP-binding enzym | 5e-07 | |
| 3a8u_X | 449 | Omega-amino acid--pyruvate aminotransferase; large | 7e-07 | |
| 3nui_A | 478 | Pyruvate transaminase; amino transferase, transfer | 1e-06 | |
| 3i5t_A | 476 | Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N | 2e-06 | |
| 1s0a_A | 429 | Adenosylmethionine-8-amino-7-oxononanoate aminotra | 4e-06 | |
| 3tfu_A | 457 | Adenosylmethionine-8-amino-7-oxononanoate aminotr; | 6e-06 | |
| 3hmu_A | 472 | Aminotransferase, class III; structural genomics, | 1e-05 | |
| 4a0g_A | 831 | Adenosylmethionine-8-amino-7-oxononanoate aminotra | 6e-04 |
| >1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Length = 472 | Back alignment and structure |
|---|
Score = 242 bits (619), Expect = 1e-79
Identities = 109/159 (68%), Positives = 132/159 (83%), Gaps = 1/159 (0%)
Query: 1 MMCGSCSNENAYKNIFIWYQNKQRGGASGFTKEEQESSMINQAPGAPNLSILSFKGAFHG 60
M CGSCSNENA+K IF+WY++K+RG + F+KEE E+ MINQAPG P+ SILSF GAFHG
Sbjct: 133 MACGSCSNENAFKTIFMWYRSKERGQS-AFSKEELETCMINQAPGCPDYSILSFMGAFHG 191
Query: 61 RTLGCLSTTHSKYIHKIDIPAFDWPIASFPKYKYPLEENERENKAEDEKCLAEVEDLITK 120
RT+GCL+TTHSK IHKIDIP+FDWPIA FP+ KYPLEE +EN+ E+ +CL EVEDLI K
Sbjct: 192 RTMGCLATTHSKAIHKIDIPSFDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVK 251
Query: 121 YNKKGTPVAGIVVEPIQSEGGDNHGSNYFFQQLQKIGKK 159
Y KK VAGI+VEPIQSEGGDNH S+ FF++L+ I +K
Sbjct: 252 YRKKKKTVAGIIVEPIQSEGGDNHASDDFFRKLRDISRK 290
|
| >2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Length = 449 | Back alignment and structure |
|---|
| >1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Length = 426 | Back alignment and structure |
|---|
| >3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Length = 451 | Back alignment and structure |
|---|
| >2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Length = 419 | Back alignment and structure |
|---|
| >4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Length = 453 | Back alignment and structure |
|---|
| >1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Length = 433 | Back alignment and structure |
|---|
| >3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Length = 439 | Back alignment and structure |
|---|
| >2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Length = 397 | Back alignment and structure |
|---|
| >3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Length = 395 | Back alignment and structure |
|---|
| >2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Length = 420 | Back alignment and structure |
|---|
| >2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Length = 375 | Back alignment and structure |
|---|
| >1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Length = 395 | Back alignment and structure |
|---|
| >3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Length = 452 | Back alignment and structure |
|---|
| >1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Length = 433 | Back alignment and structure |
|---|
| >2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Length = 439 | Back alignment and structure |
|---|
| >3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Length = 460 | Back alignment and structure |
|---|
| >3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} Length = 392 | Back alignment and structure |
|---|
| >3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} PDB: 3drd_A 3du4_A* Length = 448 | Back alignment and structure |
|---|
| >4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Length = 459 | Back alignment and structure |
|---|
| >3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Length = 449 | Back alignment and structure |
|---|
| >3nui_A Pyruvate transaminase; amino transferase, transferase; 2.00A {Vibrio fluvialis} Length = 478 | Back alignment and structure |
|---|
| >3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Length = 476 | Back alignment and structure |
|---|
| >1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Length = 429 | Back alignment and structure |
|---|
| >3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Length = 457 | Back alignment and structure |
|---|
| >3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Length = 472 | Back alignment and structure |
|---|
| >4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* Length = 831 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 159 | |||
| 4e3q_A | 473 | Pyruvate transaminase; aminotransferase, transfera | 99.97 | |
| 4atq_A | 456 | 4-aminobutyrate transaminase; transferase; HET: PL | 99.95 | |
| 4ao9_A | 454 | Beta-phenylalanine aminotransferase; HET: PLP; 1.5 | 99.93 | |
| 4a0g_A | 831 | Adenosylmethionine-8-amino-7-oxononanoate aminotra | 99.92 | |
| 1ohv_A | 472 | 4-aminobutyrate aminotransferase; PLP-dependent en | 99.9 | |
| 3i5t_A | 476 | Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N | 99.88 | |
| 3hmu_A | 472 | Aminotransferase, class III; structural genomics, | 99.87 | |
| 3gju_A | 460 | Putative aminotransferase; pyridoxal phosphate, PL | 99.84 | |
| 4ffc_A | 453 | 4-aminobutyrate aminotransferase (GABT); structura | 99.83 | |
| 3tfu_A | 457 | Adenosylmethionine-8-amino-7-oxononanoate aminotr; | 99.82 | |
| 3oks_A | 451 | 4-aminobutyrate transaminase; ssgcid, transferase, | 99.82 | |
| 4a6r_A | 459 | Omega transaminase; transferase, PLP-binding enzym | 99.81 | |
| 3n5m_A | 452 | Adenosylmethionine-8-amino-7-oxononanoate aminotr; | 99.8 | |
| 3dod_A | 448 | Adenosylmethionine-8-amino-7-oxononanoate aminotr; | 99.8 | |
| 2cjg_A | 449 | L-lysine-epsilon aminotransferase; internal aldimi | 99.71 | |
| 2yky_A | 465 | Beta-transaminase; transferase; HET: PLP SFE; 1.69 | 99.53 | |
| 4e77_A | 429 | Glutamate-1-semialdehyde 2,1-aminomutase; structur | 99.69 | |
| 3l44_A | 434 | Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha | 99.68 | |
| 2oat_A | 439 | Ornithine aminotransferase; 5-fluoromethylornithin | 99.67 | |
| 1z7d_A | 433 | Ornithine aminotransferase; structural genomics co | 99.67 | |
| 3k28_A | 429 | Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn | 99.66 | |
| 3fq8_A | 427 | Glutamate-1-semialdehyde 2,1-aminomutase; drug res | 99.63 | |
| 3a8u_X | 449 | Omega-amino acid--pyruvate aminotransferase; large | 99.63 | |
| 3i4j_A | 430 | Aminotransferase, class III; structural GENOMICS,N | 99.63 | |
| 1zod_A | 433 | DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, | 99.61 | |
| 2epj_A | 434 | Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy | 99.61 | |
| 2pb2_A | 420 | Acetylornithine/succinyldiaminopimelate aminotran; | 99.59 | |
| 3dxv_A | 439 | Alpha-amino-epsilon-caprolactam racemase; fold-TYP | 99.59 | |
| 3nx3_A | 395 | Acoat, acetylornithine aminotransferase; csgid, st | 99.56 | |
| 2e7u_A | 424 | Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy | 99.54 | |
| 2cy8_A | 453 | D-phgat, D-phenylglycine aminotransferase; structu | 99.49 | |
| 1s0a_A | 429 | Adenosylmethionine-8-amino-7-oxononanoate aminotra | 99.45 | |
| 2eo5_A | 419 | 419AA long hypothetical aminotransferase; PLP enzy | 99.44 | |
| 3ruy_A | 392 | Ornithine aminotransferase; structural genomics, c | 99.37 | |
| 4adb_A | 406 | Succinylornithine transaminase; transferase, PLP e | 99.32 | |
| 1sff_A | 426 | 4-aminobutyrate aminotransferase; enzyme complexes | 99.22 | |
| 2ord_A | 397 | Acoat, acetylornithine aminotransferase; TM1785, a | 99.03 | |
| 1vef_A | 395 | Acetylornithine/acetyl-lysine aminotransferase; PL | 98.98 | |
| 2eh6_A | 375 | Acoat, acetylornithine aminotransferase; ARGD, str | 98.94 | |
| 2oqx_A | 467 | Tryptophanase; lyase, pyridoxal phosphate, tryptop | 98.44 | |
| 3l8a_A | 421 | METC, putative aminotransferase, probable beta-cys | 98.41 | |
| 1ax4_A | 467 | Tryptophanase; tryptophan biosynthesis, tryptophan | 98.36 | |
| 2w8t_A | 427 | SPT, serine palmitoyltransferase; HET: LLP; 1.25A | 97.93 | |
| 3kki_A | 409 | CAI-1 autoinducer synthase; quorum sensing, CQSA, | 97.81 | |
| 2ez2_A | 456 | Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend | 97.65 | |
| 1bs0_A | 384 | Protein (8-amino-7-oxonanoate synthase); PLP-depen | 97.64 | |
| 1svv_A | 359 | Threonine aldolase; structural genomics, structura | 97.61 | |
| 3tqx_A | 399 | 2-amino-3-ketobutyrate coenzyme A ligase; energy m | 97.53 | |
| 3lvm_A | 423 | Cysteine desulfurase; structural genomics, montrea | 97.52 | |
| 1kmj_A | 406 | Selenocysteine lyase; persulfide perselenide NIFS | 97.52 | |
| 3qhx_A | 392 | Cystathionine gamma-synthase METB (CGS); structura | 97.52 | |
| 1yiz_A | 429 | Kynurenine aminotransferase; glutamine transaminas | 97.45 | |
| 3mad_A | 514 | Sphingosine-1-phosphate lyase; carboxy-lyase activ | 97.42 | |
| 3nmy_A | 400 | Xometc, cystathionine gamma-lyase-like protein; Cy | 97.41 | |
| 2ay1_A | 394 | Aroat, aromatic amino acid aminotransferase; HET: | 97.34 | |
| 2ctz_A | 421 | O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac | 97.33 | |
| 1wyu_B | 474 | Glycine dehydrogenase subunit 2 (P-protein); alpha | 97.31 | |
| 3ke3_A | 379 | Putative serine-pyruvate aminotransferase; structu | 97.3 | |
| 1fc4_A | 401 | 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino | 97.28 | |
| 3a2b_A | 398 | Serine palmitoyltransferase; vitamin B6-dependent | 97.27 | |
| 3kgw_A | 393 | Alanine-glyoxylate aminotransferase; AAH25799.1, p | 97.27 | |
| 1ajs_A | 412 | Aspartate aminotransferase; PIG, in the presence o | 97.27 | |
| 3zrp_A | 384 | Serine-pyruvate aminotransferase (AGXT); HET: PLP; | 97.22 | |
| 1cs1_A | 386 | CGS, protein (cystathionine gamma-synthase); lyase | 97.22 | |
| 3piu_A | 435 | 1-aminocyclopropane-1-carboxylate synthase; fruit | 97.22 | |
| 2q7w_A | 396 | Aspartate aminotransferase; mechanism-based inhibi | 97.21 | |
| 1t3i_A | 420 | Probable cysteine desulfurase; PLP-binding enzyme, | 97.18 | |
| 1iay_A | 428 | ACC synthase 2, 1-aminocyclopropane-1-carboxylate | 97.13 | |
| 3op7_A | 375 | Aminotransferase class I and II; PLP-dependent tra | 97.13 | |
| 3f0h_A | 376 | Aminotransferase; RER070207000802, structural geno | 97.08 | |
| 3nnk_A | 411 | Ureidoglycine-glyoxylate aminotransferase; PLP-dep | 97.08 | |
| 2e7j_A | 371 | SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st | 97.08 | |
| 3f9t_A | 397 | TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L | 97.06 | |
| 1gc0_A | 398 | Methionine gamma-lyase; pyridoxal-5'-phosphate; HE | 97.04 | |
| 1v72_A | 356 | Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 | 96.97 | |
| 1u08_A | 386 | Hypothetical aminotransferase YBDL; alpha beta pro | 96.97 | |
| 2dr1_A | 386 | PH1308 protein, 386AA long hypothetical serine ami | 96.94 | |
| 3euc_A | 367 | Histidinol-phosphate aminotransferase 2; YP_297314 | 96.94 | |
| 3dzz_A | 391 | Putative pyridoxal 5'-phosphate-dependent C-S LYA; | 96.94 | |
| 3fdb_A | 377 | Beta C-S lyase, putative PLP-dependent beta-cystat | 96.91 | |
| 1c7n_A | 399 | Cystalysin; transferase, aminotransferase, pyridox | 96.9 | |
| 1v2d_A | 381 | Glutamine aminotransferase; PLP, riken structural | 96.89 | |
| 2bwn_A | 401 | 5-aminolevulinate synthase; tetrapyrrole biosynthe | 96.88 | |
| 3ndn_A | 414 | O-succinylhomoserine sulfhydrylase; seattle struct | 96.86 | |
| 2rfv_A | 398 | Methionine gamma-lyase; pyridoxal-5'-phosphate, PL | 96.84 | |
| 3acz_A | 389 | Methionine gamma-lyase; L-methionine; HET: LLP; 1. | 96.8 | |
| 3kax_A | 383 | Aminotransferase, classes I and II; PLP, C-S lyase | 96.74 | |
| 1j32_A | 388 | Aspartate aminotransferase; HET: PLP; 2.10A {Phorm | 96.74 | |
| 2o0r_A | 411 | RV0858C (N-succinyldiaminopimelate aminotransfera; | 96.73 | |
| 1eg5_A | 384 | Aminotransferase; PLP-dependent enzymes, iron-sulf | 96.73 | |
| 1d2f_A | 390 | MALY protein; aminotransferase fold, large PLP-bin | 96.71 | |
| 3fvs_A | 422 | Kynurenine--oxoglutarate transaminase 1; alpha bet | 96.68 | |
| 1gd9_A | 389 | Aspartate aminotransferase; pyridoxal enzyme, temp | 96.6 | |
| 2zc0_A | 407 | Alanine glyoxylate transaminase; alanine:glyoxylat | 96.6 | |
| 4dq6_A | 391 | Putative pyridoxal phosphate-dependent transferas; | 96.6 | |
| 3b46_A | 447 | Aminotransferase BNA3; kynurenine aminotransferase | 96.59 | |
| 3pj0_A | 359 | LMO0305 protein; structural genomics, joint center | 96.58 | |
| 2o1b_A | 404 | Aminotransferase, class I; aminotrasferase; HET: P | 96.56 | |
| 4f4e_A | 420 | Aromatic-amino-acid aminotransferase; ssgcid, stru | 96.54 | |
| 4eb5_A | 382 | Probable cysteine desulfurase 2; scaffold, transfe | 96.52 | |
| 2dou_A | 376 | Probable N-succinyldiaminopimelate aminotransfera; | 96.5 | |
| 3ecd_A | 425 | Serine hydroxymethyltransferase 2; ssgcid, decode, | 96.49 | |
| 3b1d_A | 392 | Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ | 95.5 | |
| 1vjo_A | 393 | Alanine--glyoxylate aminotransferase; 17130350, AL | 96.48 | |
| 3cq5_A | 369 | Histidinol-phosphate aminotransferase; PLP, PMP, a | 96.46 | |
| 1xi9_A | 406 | Putative transaminase; alanine aminotransferase, s | 96.46 | |
| 2cb1_A | 412 | O-acetyl homoserine sulfhydrylase; PLP enzyme, lya | 96.38 | |
| 3fsl_A | 397 | Aromatic-amino-acid aminotransferase; tyrosine ami | 96.38 | |
| 3isl_A | 416 | Purine catabolism protein PUCG; pyridoxalphosphate | 96.36 | |
| 1qz9_A | 416 | Kynureninase; kynurenine, tryptophan, PLP, vitamin | 96.35 | |
| 2z9v_A | 392 | Aspartate aminotransferase; pyridoxamine, pyruvate | 96.34 | |
| 3ht4_A | 431 | Aluminum resistance protein; lyase, putative cysta | 96.33 | |
| 3ele_A | 398 | Amino transferase; RER070207001803, structural gen | 96.31 | |
| 3e2y_A | 410 | Kynurenine-oxoglutarate transaminase 3; alpha beta | 96.29 | |
| 1elu_A | 390 | L-cysteine/L-cystine C-S lyase; FES cluster biosyn | 96.28 | |
| 4hvk_A | 382 | Probable cysteine desulfurase 2; transferase and I | 96.28 | |
| 3e9k_A | 465 | Kynureninase; kynurenine-L-hydrolase, kynurenine h | 96.27 | |
| 3vax_A | 400 | Putative uncharacterized protein DNDA; desulfurase | 96.26 | |
| 3jtx_A | 396 | Aminotransferase; NP_283882.1, structural genomics | 96.26 | |
| 2bkw_A | 385 | Alanine-glyoxylate aminotransferase 1; analine-gly | 96.25 | |
| 1o4s_A | 389 | Aspartate aminotransferase; TM1255, structural gen | 96.24 | |
| 2gb3_A | 409 | Aspartate aminotransferase; TM1698, structural gen | 96.22 | |
| 3n0l_A | 417 | Serine hydroxymethyltransferase; alpha beta class, | 96.2 | |
| 2z61_A | 370 | Probable aspartate aminotransferase 2; amino acid | 96.19 | |
| 2x5f_A | 430 | Aspartate_tyrosine_phenylalanine pyridoxal-5' phos | 96.13 | |
| 2jis_A | 515 | Cysteine sulfinic acid decarboxylase; pyridoxal ph | 96.12 | |
| 1m32_A | 366 | 2-aminoethylphosphonate-pyruvate aminotransferase; | 96.09 | |
| 3nra_A | 407 | Aspartate aminotransferase; structural genomics, j | 96.08 | |
| 1pff_A | 331 | Methionine gamma-lyase; homocysteine; 2.50A {Trich | 96.01 | |
| 3aow_A | 448 | Putative uncharacterized protein PH0207; protein-P | 95.97 | |
| 2dkj_A | 407 | Serine hydroxymethyltransferase; PLP dependent enz | 95.95 | |
| 3mc6_A | 497 | Sphingosine-1-phosphate lyase; carboxy-lyase activ | 95.94 | |
| 3dyd_A | 427 | Tyrosine aminotransferase; PLP, SGC, structural ge | 95.85 | |
| 2x5d_A | 412 | Probable aminotransferase; HET: LLP PLP; 2.25A {Ps | 95.8 | |
| 2huf_A | 393 | Alanine glyoxylate aminotransferase; alpha and bet | 95.79 | |
| 2zyj_A | 397 | Alpha-aminodipate aminotransferase; alpha-aminoadi | 95.74 | |
| 1qgn_A | 445 | Protein (cystathionine gamma-synthase); methionine | 95.74 | |
| 3ffh_A | 363 | Histidinol-phosphate aminotransferase; APC88260, l | 95.45 | |
| 3g0t_A | 437 | Putative aminotransferase; NP_905498.1, putative a | 95.41 | |
| 2ch1_A | 396 | 3-hydroxykynurenine transaminase; PLP-enzyme, kynu | 95.41 | |
| 2qma_A | 497 | Diaminobutyrate-pyruvate transaminase and L-2,4- d | 95.41 | |
| 3ly1_A | 354 | Putative histidinol-phosphate aminotransferase; st | 95.36 | |
| 3lws_A | 357 | Aromatic amino acid beta-eliminating lyase/threoni | 95.32 | |
| 1vp4_A | 425 | Aminotransferase, putative; structural genomics, j | 95.24 | |
| 1yaa_A | 412 | Aspartate aminotransferase; HET: PLP; 2.05A {Sacch | 95.23 | |
| 1bw0_A | 416 | TAT, protein (tyrosine aminotransferase); tyrosine | 95.19 | |
| 1n8p_A | 393 | Cystathionine gamma-lyase; three open alpha/beta s | 95.18 | |
| 3ri6_A | 430 | O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate | 95.07 | |
| 3cai_A | 406 | Possible aminotransferase; RV3778C; 1.80A {Mycobac | 95.05 | |
| 3a9z_A | 432 | Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph | 95.04 | |
| 3ezs_A | 376 | Aminotransferase ASPB; NP_207418.1, structural gen | 94.99 | |
| 1lc5_A | 364 | COBD, L-threonine-O-3-phosphate decarboxylase; PLP | 94.98 | |
| 3h7f_A | 447 | Serine hydroxymethyltransferase 1; cytoplasm, one- | 94.88 | |
| 3cog_A | 403 | Cystathionine gamma-lyase; CTH, PLP, propargylglyc | 94.77 | |
| 1o69_A | 394 | Aminotransferase; structural genomics, unknown fun | 94.76 | |
| 3h14_A | 391 | Aminotransferase, classes I and II; YP_167802.1, S | 94.62 | |
| 2aeu_A | 374 | Hypothetical protein MJ0158; selenocysteine syntha | 94.52 | |
| 2okj_A | 504 | Glutamate decarboxylase 1; PLP-dependent decarboxy | 94.52 | |
| 2yrr_A | 353 | Aminotransferase, class V; structural genomics, NP | 94.48 | |
| 1ibj_A | 464 | CBL, cystathionine beta-lyase; PLP-dependent enzym | 94.36 | |
| 3t18_A | 413 | Aminotransferase class I and II; PSI-biology, MCSG | 94.29 | |
| 3ftb_A | 361 | Histidinol-phosphate aminotransferase; structural | 94.18 | |
| 1fg7_A | 356 | Histidinol phosphate aminotransferase; HISC, histi | 94.17 | |
| 3rq1_A | 418 | Aminotransferase class I and II; structural genomi | 94.13 | |
| 2r2n_A | 425 | Kynurenine/alpha-aminoadipate aminotransferase mit | 94.07 | |
| 3meb_A | 448 | Aspartate aminotransferase; pyridoxal PHOS transfe | 93.8 | |
| 3nyt_A | 367 | Aminotransferase WBPE; PLP binding, nucleotide-sug | 93.77 | |
| 2oga_A | 399 | Transaminase; PLP-dependent enzyme, desosamine, de | 93.61 | |
| 3ez1_A | 423 | Aminotransferase MOCR family; YP_604413.1, struct | 93.4 | |
| 3get_A | 365 | Histidinol-phosphate aminotransferase; NP_281508.1 | 92.92 | |
| 3gbx_A | 420 | Serine hydroxymethyltransferase; structural genomi | 92.65 | |
| 3if2_A | 444 | Aminotransferase; YP_265399.1, structura genomics, | 92.46 | |
| 1e5e_A | 404 | MGL, methionine gamma-lyase; methionine biosynthes | 92.24 | |
| 3b8x_A | 390 | WBDK, pyridoxamine 5-phosphate-dependent dehydrase | 91.35 | |
| 1mdo_A | 393 | ARNB aminotransferase; type 1 aminotransferase fol | 91.19 | |
| 4eu1_A | 409 | Mitochondrial aspartate aminotransferase; ssgcid, | 90.78 | |
| 4e1o_A | 481 | HDC, histidine decarboxylase; lyase; HET: PLP PVH; | 90.65 | |
| 1iug_A | 352 | Putative aspartate aminotransferase; wild type, py | 90.58 | |
| 2fnu_A | 375 | Aminotransferase; protein-product complex, structu | 90.28 | |
| 7aat_A | 401 | Aspartate aminotransferase; transferase(aminotrans | 90.05 | |
| 3vp6_A | 511 | Glutamate decarboxylase 1; catalytic loop SWAP, ly | 89.53 | |
| 3dr4_A | 391 | Putative perosamine synthetase; deoxysugar, pyrido | 88.66 | |
| 1b9h_A | 388 | AHBA synthase, protein (3-amino-5-hydroxybenzoic a | 87.84 | |
| 2vi8_A | 405 | Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, | 87.57 | |
| 3uwc_A | 374 | Nucleotide-sugar aminotransferase; lipopolysacchar | 86.61 | |
| 3tcm_A | 500 | Alanine aminotransferase 2; pyridoxal phosphate (P | 86.06 | |
| 3ppl_A | 427 | Aspartate aminotransferase; dimer, PLP-dependent t | 84.96 | |
| 3jzl_A | 409 | Putative cystathionine beta-lyase involved in ALU | 84.28 | |
| 2c81_A | 418 | Glutamine-2-deoxy-scyllo-inosose aminotransferase; | 83.72 | |
| 2fq6_A | 415 | Cystathionine beta-lyase; protein-inhibitor comple | 83.66 | |
| 3k40_A | 475 | Aromatic-L-amino-acid decarboxylase; PLP dependent | 83.62 | |
| 3ei9_A | 432 | LL-diaminopimelate aminotransferase; lysine biosyn | 81.95 | |
| 2po3_A | 424 | 4-dehydrase; external aldimine, PLP, aminotransfer | 81.5 | |
| 2dgk_A | 452 | GAD-beta, GADB, glutamate decarboxylase beta; gadb | 81.28 | |
| 1b5p_A | 385 | Protein (aspartate aminotransferase); pyridoxal en | 80.33 |
| >4e3q_A Pyruvate transaminase; aminotransferase, transferase; HET: PMP; 1.90A {Vibrio fluvialis} PDB: 4e3r_A* 3nui_A | Back alignment and structure |
|---|
Probab=99.97 E-value=1.9e-31 Score=224.51 Aligned_cols=134 Identities=24% Similarity=0.343 Sum_probs=103.7
Q ss_pred CCCcchHHHHHHHHHHHHHHhhcCCCCCCCchhhhhhhhhccCCCCCCceEEEEcCCCCccchhhhhcCCCccccccCCC
Q psy4805 1 MMCGSCSNENAYKNIFIWYQNKQRGGASGFTKEEQESSMINQAPGAPNLSILSFKGAFHGRTLGCLSTTHSKYIHKIDIP 80 (159)
Q Consensus 1 ~~sGseA~e~AlklA~~~~~~~~~g~~~~~~~~~~~~~~~~~~~g~~r~~Ii~~~~sYHG~T~ga~s~s~~~~~~~~~~~ 80 (159)
+||||||||+||||||+|+..+ |. |+ |.+||+|+++|||+|++++++|+....+....+
T Consensus 134 ~~sGsEA~e~AiKlAr~~~~~~--g~-----------------~~--r~~ii~~~~~yHG~t~~a~s~tg~~~~~~~~~~ 192 (473)
T 4e3q_A 134 TNSGSEANDTMVKMLWFLHAAE--GK-----------------PQ--KRKILTRWNAYHGVTAVSASMTGKPYNSVFGLP 192 (473)
T ss_dssp ESSHHHHHHHHHHHHHHHHHHT--TC-----------------TT--CCEEEEETTCCCCSSHHHHHHSCCGGGGGGTCS
T ss_pred eCchHHHHHHHHHHHHHHHHhc--CC-----------------CC--cceEEEeeceECCCccccccccccccccccCCC
Confidence 5899999999999999998776 43 45 899999999999999999999997543333334
Q ss_pred CCCCCcccCCC-CCCCCccchhhhhHHHHHHHHHHHHHHHHhccCCCCeEEEEEcccccCCCCccCCHHHHHHHHHHhcC
Q psy4805 81 AFDWPIASFPK-YKYPLEENERENKAEDEKCLAEVEDLITKYNKKGTPVAGIVVEPIQSEGGDNHGSNYFFQQLQKIGKK 159 (159)
Q Consensus 81 ~~~~~~~p~p~-~~~~~~~~~~~~~~~~~~~~~~le~~i~~~~~~~~~vAAvI~EPiqG~gGv~~pp~~fl~~lr~lc~~ 159 (159)
..++.++|.|. ++++.. ....+.+...+.+++++.|.+.. +++|||||+|||||+||+++||++||++||++|+|
T Consensus 193 ~~~~~~~~~p~~~~~~~~--~~~~~~~~~~~~~~l~~~i~~~~--~~~iAavi~EPiqg~gG~~~p~~~fl~~lr~lc~~ 268 (473)
T 4e3q_A 193 LPGFVHLTCPHYWRYGEE--GETEEQFVARLARELEETIQREG--ADTIAGFFAEPVMGAGGVIPPAKGYFQAILPILRK 268 (473)
T ss_dssp CTTEEEECCCCHHHHSCT--TCCHHHHHHHHHHHHHHHHHHHC--GGGEEEEEECSSBSTTTSBCCCTTHHHHHHHHHHH
T ss_pred CCcccccCCCcccccccc--cchhhHHHHHHHHHHHHHHHhhC--CCceEEEEeCCccCCCCceeCCHHHHHHHHHHhcc
Confidence 44556667664 222111 01123455667788888887763 57899999999999999999999999999999985
|
| >4atq_A 4-aminobutyrate transaminase; transferase; HET: PLP; 2.75A {Arthrobacter aurescens} PDB: 4atp_A* | Back alignment and structure |
|---|
| >4ao9_A Beta-phenylalanine aminotransferase; HET: PLP; 1.50A {Variovorax paradoxus} PDB: 4aoa_A* | Back alignment and structure |
|---|
| >4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* | Back alignment and structure |
|---|
| >1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* | Back alignment and structure |
|---|
| >3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* | Back alignment and structure |
|---|
| >4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* | Back alignment and structure |
|---|
| >3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A | Back alignment and structure |
|---|
| >4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* | Back alignment and structure |
|---|
| >3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* | Back alignment and structure |
|---|
| >2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A | Back alignment and structure |
|---|
| >2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* | Back alignment and structure |
|---|
| >4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} | Back alignment and structure |
|---|
| >3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* | Back alignment and structure |
|---|
| >1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A | Back alignment and structure |
|---|
| >3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* | Back alignment and structure |
|---|
| >3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* | Back alignment and structure |
|---|
| >3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* | Back alignment and structure |
|---|
| >2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* | Back alignment and structure |
|---|
| >2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* | Back alignment and structure |
|---|
| >3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* | Back alignment and structure |
|---|
| >3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} | Back alignment and structure |
|---|
| >1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* | Back alignment and structure |
|---|
| >2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A | Back alignment and structure |
|---|
| >1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* | Back alignment and structure |
|---|
| >2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* | Back alignment and structure |
|---|
| >1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* | Back alignment and structure |
|---|
| >2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* | Back alignment and structure |
|---|
| >3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 | Back alignment and structure |
|---|
| >2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* | Back alignment and structure |
|---|
| >3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A | Back alignment and structure |
|---|
| >2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* | Back alignment and structure |
|---|
| >1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* | Back alignment and structure |
|---|
| >1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* | Back alignment and structure |
|---|
| >1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* | Back alignment and structure |
|---|
| >3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* | Back alignment and structure |
|---|
| >1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* | Back alignment and structure |
|---|
| >3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* | Back alignment and structure |
|---|
| >3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* | Back alignment and structure |
|---|
| >2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* | Back alignment and structure |
|---|
| >2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* | Back alignment and structure |
|---|
| >3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} | Back alignment and structure |
|---|
| >1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 | Back alignment and structure |
|---|
| >3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} | Back alignment and structure |
|---|
| >3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* | Back alignment and structure |
|---|
| >1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* | Back alignment and structure |
|---|
| >3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* | Back alignment and structure |
|---|
| >1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* | Back alignment and structure |
|---|
| >2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... | Back alignment and structure |
|---|
| >1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* | Back alignment and structure |
|---|
| >3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* | Back alignment and structure |
|---|
| >3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} | Back alignment and structure |
|---|
| >3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* | Back alignment and structure |
|---|
| >3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* | Back alignment and structure |
|---|
| >1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* | Back alignment and structure |
|---|
| >1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* | Back alignment and structure |
|---|
| >2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* | Back alignment and structure |
|---|
| >3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* | Back alignment and structure |
|---|
| >3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* | Back alignment and structure |
|---|
| >1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* | Back alignment and structure |
|---|
| >1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* | Back alignment and structure |
|---|
| >1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* | Back alignment and structure |
|---|
| >2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} | Back alignment and structure |
|---|
| >4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* | Back alignment and structure |
|---|
| >3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* | Back alignment and structure |
|---|
| >4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* | Back alignment and structure |
|---|
| >2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* | Back alignment and structure |
|---|
| >1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A | Back alignment and structure |
|---|
| >1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* | Back alignment and structure |
|---|
| >3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* | Back alignment and structure |
|---|
| >3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} | Back alignment and structure |
|---|
| >3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* | Back alignment and structure |
|---|
| >1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* | Back alignment and structure |
|---|
| >4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* | Back alignment and structure |
|---|
| >3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* | Back alignment and structure |
|---|
| >3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} | Back alignment and structure |
|---|
| >3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} | Back alignment and structure |
|---|
| >2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} | Back alignment and structure |
|---|
| >2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} | Back alignment and structure |
|---|
| >1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* | Back alignment and structure |
|---|
| >2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* | Back alignment and structure |
|---|
| >2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* | Back alignment and structure |
|---|
| >2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* | Back alignment and structure |
|---|
| >1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* | Back alignment and structure |
|---|
| >3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* | Back alignment and structure |
|---|
| >2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} | Back alignment and structure |
|---|
| >3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} | Back alignment and structure |
|---|
| >3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* | Back alignment and structure |
|---|
| >3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* | Back alignment and structure |
|---|
| >3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B | Back alignment and structure |
|---|
| >1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* | Back alignment and structure |
|---|
| >3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* | Back alignment and structure |
|---|
| >2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* | Back alignment and structure |
|---|
| >2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* | Back alignment and structure |
|---|
| >1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* | Back alignment and structure |
|---|
| >3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} | Back alignment and structure |
|---|
| >2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* | Back alignment and structure |
|---|
| >3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} | Back alignment and structure |
|---|
| >3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* | Back alignment and structure |
|---|
| >2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* | Back alignment and structure |
|---|
| >3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} | Back alignment and structure |
|---|
| >3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* | Back alignment and structure |
|---|
| >3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} | Back alignment and structure |
|---|
| >1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* | Back alignment and structure |
|---|
| >3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* | Back alignment and structure |
|---|
| >1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* | Back alignment and structure |
|---|
| >4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* | Back alignment and structure |
|---|
| >7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* | Back alignment and structure |
|---|
| >3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* | Back alignment and structure |
|---|
| >3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* | Back alignment and structure |
|---|
| >1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* | Back alignment and structure |
|---|
| >2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... | Back alignment and structure |
|---|
| >3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} | Back alignment and structure |
|---|
| >3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* | Back alignment and structure |
|---|
| >2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* | Back alignment and structure |
|---|
| >2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* | Back alignment and structure |
|---|
| >3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 | Back alignment and structure |
|---|
| >3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* | Back alignment and structure |
|---|
| >2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* | Back alignment and structure |
|---|
| >1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 159 | ||||
| d2gsaa_ | 427 | c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase | 2e-11 | |
| d1vefa1 | 387 | c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine a | 8e-07 | |
| d2byla1 | 404 | c.67.1.4 (A:36-439) Ornithine aminotransferase {Hu | 2e-05 | |
| d1z7da1 | 404 | c.67.1.4 (A:7-410) Ornithine aminotransferase {Pla | 1e-04 |
| >d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Length = 427 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: PLP-dependent transferase-like superfamily: PLP-dependent transferases family: GABA-aminotransferase-like domain: Glutamate-1-semialdehyde aminomutase (aminotransferase) species: Synechococcus sp., strain GR6 [TaxId: 1131]
Score = 58.7 bits (141), Expect = 2e-11
Identities = 21/109 (19%), Positives = 39/109 (35%), Gaps = 14/109 (12%)
Query: 51 ILSFKGAFHGRTLGCLSTTHSKYIHKIDIPAFDWPIASFPKYKYPLEENERENKAEDEKC 110
I+ F+G +HG L S + + +P+ N
Sbjct: 137 IIKFEGCYHGHADMFLVKAGSG-VATLGLPSSPGVPKKTTANTLTTPYN----------D 185
Query: 111 LAEVEDLITKYNKKGTPVAGIVVEPIQSEGGDNHGSNYFFQQLQKIGKK 159
L V+ L + + +AG+++EPI G F + L++I +
Sbjct: 186 LEAVKALFAENPGE---IAGVILEPIVGNSGFIVPDAGFLEGLREITLE 231
|
| >d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Length = 387 | Back information, alignment and structure |
|---|
| >d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 404 | Back information, alignment and structure |
|---|
| >d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Length = 404 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 159 | |||
| d1ohwa_ | 461 | 4-aminobutyrate aminotransferase, GABA-aminotransf | 99.97 | |
| d1zoda1 | 431 | Dialkylglycine decarboxylase {Pseudomonas cepacia | 99.95 | |
| d1vefa1 | 387 | Acetylornithine/acetyl-lysine aminotransferase Arg | 99.94 | |
| d2gsaa_ | 427 | Glutamate-1-semialdehyde aminomutase (aminotransfe | 99.94 | |
| d1s0aa_ | 429 | Adenosylmethionine-8-amino-7-oxononanoate aminotra | 99.93 | |
| d1sffa_ | 425 | 4-aminobutyrate aminotransferase, GABA-aminotransf | 99.93 | |
| d2byla1 | 404 | Ornithine aminotransferase {Human (Homo sapiens) [ | 99.92 | |
| d1z7da1 | 404 | Ornithine aminotransferase {Plasmodium yoelii yoel | 99.85 | |
| d1ax4a_ | 465 | Tryptophan indol-lyase (tryptophanase) {Proteus vu | 99.1 | |
| d2v1pa1 | 467 | Tryptophan indol-lyase (tryptophanase) {Escherichi | 99.05 | |
| d1fc4a_ | 401 | 2-amino-3-ketobutyrate CoA ligase {Escherichia col | 96.79 | |
| d1m6sa_ | 343 | Low-specificity threonine aldolase {Thermotoga mar | 96.76 | |
| d1v72a1 | 345 | Phenylserine aldolase PSALD {Pseudomonas putida [T | 96.32 | |
| d1c7ga_ | 456 | Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 | 95.38 | |
| d1bs0a_ | 383 | PLP-dependent acyl-CoA synthase (8-amino-7-oxonano | 93.97 | |
| d3bc8a1 | 445 | Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu | 92.27 | |
| d2e7ja1 | 364 | Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl | 91.78 | |
| d2z67a1 | 434 | Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco | 86.27 | |
| d1js3a_ | 476 | DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] | 84.72 |
| >d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: PLP-dependent transferase-like superfamily: PLP-dependent transferases family: GABA-aminotransferase-like domain: 4-aminobutyrate aminotransferase, GABA-aminotransferase species: Pig (Sus scrofa) [TaxId: 9823]
Probab=99.97 E-value=7.3e-31 Score=218.13 Aligned_cols=158 Identities=70% Similarity=1.215 Sum_probs=115.4
Q ss_pred CCCcchHHHHHHHHHHHHHHhhcCCCCCCCchhhhhhhhhccCCCCCCceEEEEcCCCCccchhhhhcCCCccccccCCC
Q psy4805 1 MMCGSCSNENAYKNIFIWYQNKQRGGASGFTKEEQESSMINQAPGAPNLSILSFKGAFHGRTLGCLSTTHSKYIHKIDIP 80 (159)
Q Consensus 1 ~~sGseA~e~AlklA~~~~~~~~~g~~~~~~~~~~~~~~~~~~~g~~r~~Ii~~~~sYHG~T~ga~s~s~~~~~~~~~~~ 80 (159)
++|||||||.|||+||+|+..+.++. +.++++..........++..|.+||+|++||||+|++++++|+++.++..+.+
T Consensus 123 ~~sGseAve~Aik~Ar~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~Ii~~~~syHG~t~~a~s~tg~~~~~~~~~~ 201 (461)
T d1ohwa_ 123 MACGSCSNENAFKTIFMWYRSKERGQ-SAFSKEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIP 201 (461)
T ss_dssp ESSHHHHHHHHHHHHHHHHHHHHHTT-CCCCHHHHHHHHTTCTTTSCCCEEEEETTCCCCSSHHHHHTCCSCHHHHTTCC
T ss_pred ecchhhhhHHHHHHHHHHhhhcccCc-ccccchhhhhhhhccccCCCCceEEEecCCcCCCCcccccccCCccccccccc
Confidence 48999999999999999987763332 23333333334444444444889999999999999999999998776666666
Q ss_pred CCCCCcccCCCCCCCCccchhhhhHHHHHHHHHHHHHHHHhccCCCCeEEEEEcccccCCCCccCCHHHHHHHHHHhcC
Q psy4805 81 AFDWPIASFPKYKYPLEENERENKAEDEKCLAEVEDLITKYNKKGTPVAGIVVEPIQSEGGDNHGSNYFFQQLQKIGKK 159 (159)
Q Consensus 81 ~~~~~~~p~p~~~~~~~~~~~~~~~~~~~~~~~le~~i~~~~~~~~~vAAvI~EPiqG~gGv~~pp~~fl~~lr~lc~~ 159 (159)
.......|++...+|.......++.....+++++++++......+++|||||+|||||++|+++||++||++||++|+|
T Consensus 202 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~iAavivEPi~g~~G~~~~~~~fl~~lr~lc~~ 280 (461)
T d1ohwa_ 202 SFDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGGDNHASDDFFRKLRDISRK 280 (461)
T ss_dssp CCCCCEECCCCCCSSGGGCHHHHHHHHHHHHHHHHHHHHHHHHTTCCEEEEEECSSBCTTTCBCCCHHHHHHHHHHHHH
T ss_pred ccCCcccccccccccccccccccchhhhhhHHHHHHHHHHHHhCCCccceeeeccccccccccCchhhHHHHHHHHHHh
Confidence 5555566665544444322222333445567777777765433468999999999999999999999999999999985
|
| >d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} | Back information, alignment and structure |
|---|
| >d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} | Back information, alignment and structure |
|---|
| >d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} | Back information, alignment and structure |
|---|
| >d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} | Back information, alignment and structure |
|---|
| >d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} | Back information, alignment and structure |
|---|
| >d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|