Psyllid ID: psy5139


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210------
MTTLLGVEIPQEYGGPGLSFMTDILIVEEIARVDPSVSILVDIQNTLVNDLIIKLGTTEQKEKYLPRLAQTDLMGVEIPQEYGGPGLSFMTDILIVEEIARVDPSVSILVDIQNTLVNDLIIKLGTTEQKEKYLPRLAQTDVSRTSRGYKALEWHAFYGRTDSLPLNDHLSHISSGCVGFDGQLKRWMVSCGLSLQILQFQNLSSDMHMTGLASRF
cccccccccccccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHccccEEEEEEEHHHHHHHHHHHcccHHHHHHcccccccccccccccccccccccccccccEEEcccccccEEEccccccccccEEEEEccccccEEEEEEEcccccccccccccc
ccccccccccHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHccccHHHHHHHHHHHHHHcccEccccHHcccccccHHHHHEEHHHHHHccccEEEEEcccccccHcHHHHcccHHHHHHHcHHHHHHHHHEEEccccccccccEEEEEEEEcccccEEEEEEccccccccEEEEEEccccccEEEEEEEEcccccccEEEEcc
MTTLLGVeipqeyggpglsfmtDILIVEEIARVDPSVSILVDIQNTLVNDLIIKLGtteqkekylprlaqtdlmgveipqeyggpglsfmtDILIVEEIARVDPSVSILVDIQNTLVNDLIIKLGtteqkekylprlaqtdvsrtsrgyKALEWHafygrtdslplndhlshissgcvgfdgQLKRWMVSCGLSLQILQFQNLSSDMHMTGLASRF
mttllgveipqeyggpgLSFMTDILIVEEIARVDPSVSILVDIQNTLVNDLIIKLgtteqkekylprlaqtdlMGVEIPQEYGGPGLSFMTDILIVEEIARVDPSVSILVDIQNTLVNDLIIKLGtteqkekylprlaqtdvsrtsRGYKALEWHAFYGRTDSLPLNDHLSHISSGCVGFDGQLKRWMVSCGLSLQILQFQNLSSDMHMTGLASRF
MTTLLGVEIPQEYGGPGLSFMTDILIVEEIARVDPSVSILVDIQNTLVNDLIIKLGTTEQKEKYLPRLAQTDLMGVEIPQEYGGPGLSFMTDILIVEEIARVDPSVSILVDIQNTLVNDLIIKLGTTEQKEKYLPRLAQTDVSRTSRGYKALEWHAFYGRTDSLPLNDHLSHISSGCVGFDGQLKRWMVSCGLSLQILQFQNLSSDMHMTGLASRF
****LGVEIPQEYGGPGLSFMTDILIVEEIARVDPSVSILVDIQNTLVNDLIIKLGTTEQKEKYLPRLAQTDLMGVEIPQEYGGPGLSFMTDILIVEEIARVDPSVSILVDIQNTLVNDLIIKLGTTEQKEKYLPRLAQTDVSRTSRGYKALEWHAFYGRTDSLPLNDHLSHISSGCVGFDGQLKRWMVSCGLSLQILQFQNL*************
MTTLLGVEIPQEYGGPGLSFMTDILIVEEIARVDPSVSILVDIQNTLVNDLIIKLGTTEQKEKYLPRLAQTDLMGVEIPQEYGGPGLSFMTDILIVEEIARVDPSVSILVDIQNTLVNDLIIKLGTTEQKEKYLPRLAQTDVSRTSRGYKALEWHAFYGRTDSLPLNDHLSHISSGCVGFDGQLKRWMVSCGLSLQILQFQNLSSDMHMTGLASRF
MTTLLGVEIPQEYGGPGLSFMTDILIVEEIARVDPSVSILVDIQNTLVNDLIIKLGTTEQKEKYLPRLAQTDLMGVEIPQEYGGPGLSFMTDILIVEEIARVDPSVSILVDIQNTLVNDLIIKLGTTEQKEKYLPRLAQTDVSRTSRGYKALEWHAFYGRTDSLPLNDHLSHISSGCVGFDGQLKRWMVSCGLSLQILQFQNLSSDMHMTGLASRF
*TTLLGVEIPQEYGGPGLSFMTDILIVEEIARVDPSVSILVDIQNTLVNDLIIKLGTTEQKEKYLPRLAQTDLMGVEIPQEYGGPGLSFMTDILIVEEIARVDPSVSILVDIQNTLVNDLIIKLGTTEQKEKYLPRLAQTDVSRTSRGYKALEWHAFYGRTDSLPLNDHLSHISSGCVGFDGQLKRWMVSCGLSLQILQFQNLSSDMHMTGLASRF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTTLLGVEIPQEYGGPGLSFMTDILIVEEIARVDPSVSILVDIQNTLVNDLIIKLGTTEQKEKYLPRLAQTDLMGVEIPQEYGGPGLSFMTDILIVEEIARVDPSVSILVDIQNTLVNDLIIKLGTTEQKEKYLPRLAQTDVSRTSRGYKALEWHAFYGRTDSLPLNDHLSHISSGCVGFDGQLKRWMVSCGLSLQILQFQNLSSDMHMTGLASRF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query216 2.2.26 [Sep-21-2011]
Q5EAD4 432 Short/branched chain spec yes N/A 0.351 0.175 0.539 1e-17
P45954 432 Short/branched chain spec yes N/A 0.342 0.171 0.533 9e-17
Q54RR5 413 Probable short/branched c yes N/A 0.393 0.205 0.453 9e-17
Q5RF40 432 Short/branched chain spec yes N/A 0.342 0.171 0.533 1e-16
P70584 432 Short/branched chain spec yes N/A 0.319 0.159 0.514 2e-15
Q9DBL1 432 Short/branched chain spec yes N/A 0.319 0.159 0.5 7e-15
P45857 379 Acyl-CoA dehydrogenase OS yes N/A 0.356 0.203 0.324 7e-10
Q3SZI8 426 Isovaleryl-CoA dehydrogen no N/A 0.337 0.171 0.383 1e-09
P12007 424 Isovaleryl-CoA dehydrogen no N/A 0.337 0.172 0.356 6e-09
Q9JHI5 424 Isovaleryl-CoA dehydrogen no N/A 0.337 0.172 0.356 8e-09
>sp|Q5EAD4|ACDSB_BOVIN Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Bos taurus GN=ACADSB PE=2 SV=1 Back     alignment and function desciption
 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 41/76 (53%), Positives = 55/76 (72%)

Query: 68  LAQTDLMGVEIPQEYGGPGLSFMTDILIVEEIARVDPSVSILVDIQNTLVNDLIIKLGTT 127
           L Q  LMG+EI  +YGG G SF + +L++EE+A+VD SV+++ DIQNTL+N +I K GT 
Sbjct: 97  LFQQGLMGIEIDTKYGGTGASFFSSVLVIEELAKVDASVALVCDIQNTLINRMIGKYGTE 156

Query: 128 EQKEKYLPRLAQTDVS 143
           EQK  YLP+LA    S
Sbjct: 157 EQKATYLPKLATEKAS 172




Has greatest activity toward short branched chain acyl-CoA derivative such as (s)-2-methylbutyryl-CoA, isobutyryl-CoA, and 2-methylhexanoyl-CoA as well as toward short straight chain acyl-CoAs such as butyryl-CoA and hexanoyl-CoA. Can use valproyl-CoA as substrate and may play a role in controlling the metabolic flux of valproic acid in the development of toxicity of this agent.
Bos taurus (taxid: 9913)
EC: 1EC: .EC: 3EC: .EC: 9EC: 9EC: .EC: -
>sp|P45954|ACDSB_HUMAN Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens GN=ACADSB PE=1 SV=1 Back     alignment and function description
>sp|Q54RR5|ACDSB_DICDI Probable short/branched chain specific acyl-CoA dehydrogenase OS=Dictyostelium discoideum GN=acadsb PE=3 SV=1 Back     alignment and function description
>sp|Q5RF40|ACDSB_PONAB Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Pongo abelii GN=ACADSB PE=2 SV=1 Back     alignment and function description
>sp|P70584|ACDSB_RAT Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Acadsb PE=1 SV=1 Back     alignment and function description
>sp|Q9DBL1|ACDSB_MOUSE Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus GN=Acadsb PE=1 SV=1 Back     alignment and function description
>sp|P45857|ACDB_BACSU Acyl-CoA dehydrogenase OS=Bacillus subtilis (strain 168) GN=mmgC PE=2 SV=3 Back     alignment and function description
>sp|Q3SZI8|IVD_BOVIN Isovaleryl-CoA dehydrogenase, mitochondrial OS=Bos taurus GN=IVD PE=2 SV=1 Back     alignment and function description
>sp|P12007|IVD_RAT Isovaleryl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Ivd PE=1 SV=2 Back     alignment and function description
>sp|Q9JHI5|IVD_MOUSE Isovaleryl-CoA dehydrogenase, mitochondrial OS=Mus musculus GN=Ivd PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query216
383866177 407 PREDICTED: short/branched chain specific 0.675 0.358 0.4 3e-20
17508101 419 Protein ACDH-3 [Caenorhabditis elegans] 0.620 0.319 0.398 4e-20
341885170 422 CBN-ACDH-3 protein [Caenorhabditis brenn 0.754 0.386 0.348 7e-20
268568006 421 Hypothetical protein CBG12633 [Caenorhab 0.800 0.410 0.329 9e-20
308475057 424 CRE-ACDH-3 protein [Caenorhabditis reman 0.754 0.384 0.354 1e-19
321460436 422 hypothetical protein DAPPUDRAFT_216649 [ 0.449 0.229 0.505 2e-19
406868684 439 hypothetical protein MBM_00834 [Marssoni 0.486 0.239 0.454 3e-19
380016208 414 PREDICTED: short/branched chain specific 0.361 0.188 0.602 3e-19
328783450 414 PREDICTED: short/branched chain specific 0.333 0.173 0.602 4e-19
330790553 419 hypothetical protein DICPUDRAFT_44750 [D 0.361 0.186 0.551 4e-19
>gi|383866177|ref|XP_003708547.1| PREDICTED: short/branched chain specific acyl-CoA dehydrogenase, mitochondrial-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  104 bits (259), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 86/155 (55%), Gaps = 9/155 (5%)

Query: 62  EKYLPRLAQTDLMGVEIPQEYGGPGLSFMTDILIVEEIARVDPSVSILVDIQNTLVNDLI 121
           E  L +L +  LMG+EIP++YGG G +FMT IL VEE+A+VD +VS LVDI NTLVN LI
Sbjct: 65  EGLLRKLFENGLMGIEIPEKYGGSGCNFMTTILTVEEVAKVDGAVSALVDIHNTLVNSLI 124

Query: 122 IKLGTTEQKEKYLPRLAQTDVSRTSRGYKALEWHAFYGRTDSLPLNDHLSHISSGCVGFD 181
            K+ T EQKEKYLP+LAQ                AF  +T++     H  ++ +G     
Sbjct: 125 KKVATEEQKEKYLPKLAQDYAGSFCLTEPGSGSDAFSLKTEAKKEGSH--YVING----- 177

Query: 182 GQLKRWMVSCGLSLQILQFQNLSSDMHMTGLASRF 216
              K W+ +  ++   L F N +      G+ + F
Sbjct: 178 --TKMWISNSDIAGLFLVFANANPSAGYRGITTFF 210




Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|17508101|ref|NP_491859.1| Protein ACDH-3 [Caenorhabditis elegans] gi|351060448|emb|CCD68115.1| Protein ACDH-3 [Caenorhabditis elegans] Back     alignment and taxonomy information
>gi|341885170|gb|EGT41105.1| CBN-ACDH-3 protein [Caenorhabditis brenneri] Back     alignment and taxonomy information
>gi|268568006|ref|XP_002640134.1| Hypothetical protein CBG12633 [Caenorhabditis briggsae] Back     alignment and taxonomy information
>gi|308475057|ref|XP_003099748.1| CRE-ACDH-3 protein [Caenorhabditis remanei] gi|308266403|gb|EFP10356.1| CRE-ACDH-3 protein [Caenorhabditis remanei] Back     alignment and taxonomy information
>gi|321460436|gb|EFX71478.1| hypothetical protein DAPPUDRAFT_216649 [Daphnia pulex] Back     alignment and taxonomy information
>gi|406868684|gb|EKD21721.1| hypothetical protein MBM_00834 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Back     alignment and taxonomy information
>gi|380016208|ref|XP_003692080.1| PREDICTED: short/branched chain specific acyl-CoA dehydrogenase, mitochondrial-like [Apis florea] Back     alignment and taxonomy information
>gi|328783450|ref|XP_393211.4| PREDICTED: short/branched chain specific acyl-CoA dehydrogenase, mitochondrial-like [Apis mellifera] Back     alignment and taxonomy information
>gi|330790553|ref|XP_003283361.1| hypothetical protein DICPUDRAFT_44750 [Dictyostelium purpureum] gi|325086786|gb|EGC40171.1| hypothetical protein DICPUDRAFT_44750 [Dictyostelium purpureum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query216
ZFIN|ZDB-GENE-070410-109 422 acadsb "acyl-CoA dehydrogenase 0.328 0.168 0.597 5e-21
WB|WBGene00019433 419 acdh-3 [Caenorhabditis elegans 0.800 0.412 0.345 7.4e-21
UNIPROTKB|G4NFW7 445 MGG_08690 "Short-chain specifi 0.879 0.426 0.338 9.7e-20
UNIPROTKB|Q5EAD4 432 ACADSB "Short/branched chain s 0.444 0.222 0.463 1.8e-19
UNIPROTKB|B4DQ51 330 ACADSB "cDNA FLJ57418, highly 0.388 0.254 0.482 1.1e-18
FB|FBgn0036824 414 CG3902 [Drosophila melanogaste 0.537 0.280 0.424 1.6e-18
UNIPROTKB|P45954 432 ACADSB "Short/branched chain s 0.425 0.212 0.462 1.4e-16
UNIPROTKB|F1NZ81 433 ACADSB "Uncharacterized protei 0.439 0.219 0.406 3.8e-17
WB|WBGene00020419 319 acdh-4 [Caenorhabditis elegans 0.398 0.269 0.465 4.2e-17
UNIPROTKB|F1PP63 432 ACADSB "Uncharacterized protei 0.347 0.173 0.52 2.3e-15
ZFIN|ZDB-GENE-070410-109 acadsb "acyl-CoA dehydrogenase, short/branched chain" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 229 (85.7 bits), Expect = 5.0e-21, Sum P(2) = 5.0e-21
 Identities = 43/72 (59%), Positives = 60/72 (83%)

Query:     4 LLGVEIPQEYGGPGLSFMTDILIVEEIARVDPSVSILVDIQNTLVNDLIIKLGTTEQKEK 63
             L+G+EI  EYGG G SF + +L++EE+A+VD SV++L DIQNTL+N L+++LGT  QKEK
Sbjct:    90 LMGMEIGSEYGGSGCSFFSSVLVIEELAKVDASVAVLCDIQNTLINTLMMQLGTHTQKEK 149

Query:    64 YLPRLAQTDLMG 75
             YLPRLA +D++G
Sbjct:   150 YLPRLA-SDMVG 160


GO:0016627 "oxidoreductase activity, acting on the CH-CH group of donors" evidence=IEA
GO:0003995 "acyl-CoA dehydrogenase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0005575 "cellular_component" evidence=ND
GO:0016491 "oxidoreductase activity" evidence=IEA
WB|WBGene00019433 acdh-3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|G4NFW7 MGG_08690 "Short-chain specific acyl-CoA dehydrogenase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|Q5EAD4 ACADSB "Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|B4DQ51 ACADSB "cDNA FLJ57418, highly similar to Short/branched chain specific acyl-CoAdehydrogenase, mitochondrial (EC 1.3.99.-)" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0036824 CG3902 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P45954 ACADSB "Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NZ81 ACADSB "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
WB|WBGene00020419 acdh-4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1PP63 ACADSB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query216
cd01158 373 cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrog 5e-27
cd01158 373 cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrog 7e-27
pfam02771113 pfam02771, Acyl-CoA_dh_N, Acyl-CoA dehydrogenase, 1e-25
pfam02771113 pfam02771, Acyl-CoA_dh_N, Acyl-CoA dehydrogenase, 5e-25
cd01151 386 cd01151, GCD, Glutaryl-CoA dehydrogenase 5e-13
cd01156 376 cd01156, IVD, Isovaleryl-CoA dehydrogenase 9e-13
cd01151 386 cd01151, GCD, Glutaryl-CoA dehydrogenase 1e-12
COG1960 393 COG1960, CaiA, Acyl-CoA dehydrogenases [Lipid meta 3e-12
COG1960 393 COG1960, CaiA, Acyl-CoA dehydrogenases [Lipid meta 3e-12
cd01156 376 cd01156, IVD, Isovaleryl-CoA dehydrogenase 1e-11
PLN02526 412 PLN02526, PLN02526, acyl-coenzyme A oxidase 4e-11
PLN02526 412 PLN02526, PLN02526, acyl-coenzyme A oxidase 1e-10
cd01161 409 cd01161, VLCAD, Very long chain acyl-CoA dehydroge 3e-10
PLN02519 404 PLN02519, PLN02519, isovaleryl-CoA dehydrogenase 1e-09
PLN02519 404 PLN02519, PLN02519, isovaleryl-CoA dehydrogenase 2e-09
cd01161 409 cd01161, VLCAD, Very long chain acyl-CoA dehydroge 2e-08
PRK13026 774 PRK13026, PRK13026, acyl-CoA dehydrogenase; Review 3e-08
PRK09463 777 PRK09463, fadE, acyl-CoA dehydrogenase; Reviewed 9e-08
cd01160 372 cd01160, LCAD, Long chain acyl-CoA dehydrogenase 2e-07
PRK13026 774 PRK13026, PRK13026, acyl-CoA dehydrogenase; Review 7e-07
cd01152 380 cd01152, ACAD_fadE6_17_26, Putative acyl-CoA dehyd 7e-07
cd01160 372 cd01160, LCAD, Long chain acyl-CoA dehydrogenase 9e-07
cd01157 378 cd01157, MCAD, Medium chain acyl-CoA dehydrogenase 1e-06
cd01152 380 cd01152, ACAD_fadE6_17_26, Putative acyl-CoA dehyd 2e-06
cd01157 378 cd01157, MCAD, Medium chain acyl-CoA dehydrogenase 2e-06
cd01162 375 cd01162, IBD, Isobutyryl-CoA dehydrogenase 2e-06
cd01162 375 cd01162, IBD, Isobutyryl-CoA dehydrogenase 3e-06
PRK09463 777 PRK09463, fadE, acyl-CoA dehydrogenase; Reviewed 6e-06
cd01163 377 cd01163, DszC, Dibenzothiophene (DBT) desulfurizat 4e-05
cd01163 377 cd01163, DszC, Dibenzothiophene (DBT) desulfurizat 1e-04
TIGR04022 391 TIGR04022, sulfur_SfnB, sulfur acquisition oxidore 2e-04
TIGR03204 395 TIGR03204, pimC_large, pimeloyl-CoA dehydrogenase, 2e-04
TIGR03204 395 TIGR03204, pimC_large, pimeloyl-CoA dehydrogenase, 2e-04
TIGR04022 391 TIGR04022, sulfur_SfnB, sulfur acquisition oxidore 9e-04
PTZ00461 410 PTZ00461, PTZ00461, isovaleryl-CoA dehydrogenase; 0.001
PTZ00461 410 PTZ00461, PTZ00461, isovaleryl-CoA dehydrogenase; 0.002
cd01153 407 cd01153, ACAD_fadE5, Putative acyl-CoA dehydrogena 0.002
TIGR03207 372 TIGR03207, cyc_hxne_CoA_dh, cyclohexanecarboxyl-Co 0.003
TIGR03207 372 TIGR03207, cyc_hxne_CoA_dh, cyclohexanecarboxyl-Co 0.003
>gnl|CDD|173847 cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases Back     alignment and domain information
 Score =  105 bits (265), Expect = 5e-27
 Identities = 37/75 (49%), Positives = 54/75 (72%)

Query: 67  RLAQTDLMGVEIPQEYGGPGLSFMTDILIVEEIARVDPSVSILVDIQNTLVNDLIIKLGT 126
            +A+  LMG+ IP+EYGG GL F+   + +EE+A+VD SV+++V + N+L  + IIK GT
Sbjct: 38  EMAELGLMGIPIPEEYGGAGLDFLAYAIAIEELAKVDASVAVIVSVHNSLGANPIIKFGT 97

Query: 127 TEQKEKYLPRLAQTD 141
            EQK+KYLP LA  +
Sbjct: 98  EEQKKKYLPPLATGE 112


Short chain acyl-CoA dehydrogenase (SCAD). SCAD is a mitochondrial beta-oxidation enzyme. It catalyzes the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of SCAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. This subgroup also contains the eukaryotic short/branched chain acyl-CoA dehydrogenase(SBCAD), the bacterial butyryl-CoA dehydorgenase(BCAD) and 2-methylbutyryl-CoA dehydrogenase, which is involved in isoleucine catabolism. These enzymes are homotetramers. Length = 373

>gnl|CDD|173847 cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases Back     alignment and domain information
>gnl|CDD|217220 pfam02771, Acyl-CoA_dh_N, Acyl-CoA dehydrogenase, N-terminal domain Back     alignment and domain information
>gnl|CDD|217220 pfam02771, Acyl-CoA_dh_N, Acyl-CoA dehydrogenase, N-terminal domain Back     alignment and domain information
>gnl|CDD|173840 cd01151, GCD, Glutaryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173845 cd01156, IVD, Isovaleryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173840 cd01151, GCD, Glutaryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|224871 COG1960, CaiA, Acyl-CoA dehydrogenases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|224871 COG1960, CaiA, Acyl-CoA dehydrogenases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|173845 cd01156, IVD, Isovaleryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|178141 PLN02526, PLN02526, acyl-coenzyme A oxidase Back     alignment and domain information
>gnl|CDD|178141 PLN02526, PLN02526, acyl-coenzyme A oxidase Back     alignment and domain information
>gnl|CDD|173850 cd01161, VLCAD, Very long chain acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|215284 PLN02519, PLN02519, isovaleryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|215284 PLN02519, PLN02519, isovaleryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173850 cd01161, VLCAD, Very long chain acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|237277 PRK13026, PRK13026, acyl-CoA dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|236528 PRK09463, fadE, acyl-CoA dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|173849 cd01160, LCAD, Long chain acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|237277 PRK13026, PRK13026, acyl-CoA dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|173841 cd01152, ACAD_fadE6_17_26, Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26 Back     alignment and domain information
>gnl|CDD|173849 cd01160, LCAD, Long chain acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173846 cd01157, MCAD, Medium chain acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173841 cd01152, ACAD_fadE6_17_26, Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26 Back     alignment and domain information
>gnl|CDD|173846 cd01157, MCAD, Medium chain acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173851 cd01162, IBD, Isobutyryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173851 cd01162, IBD, Isobutyryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|236528 PRK09463, fadE, acyl-CoA dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|173852 cd01163, DszC, Dibenzothiophene (DBT) desulfurization enzyme C Back     alignment and domain information
>gnl|CDD|173852 cd01163, DszC, Dibenzothiophene (DBT) desulfurization enzyme C Back     alignment and domain information
>gnl|CDD|188537 TIGR04022, sulfur_SfnB, sulfur acquisition oxidoreductase, SfnB family Back     alignment and domain information
>gnl|CDD|132248 TIGR03204, pimC_large, pimeloyl-CoA dehydrogenase, large subunit Back     alignment and domain information
>gnl|CDD|132248 TIGR03204, pimC_large, pimeloyl-CoA dehydrogenase, large subunit Back     alignment and domain information
>gnl|CDD|188537 TIGR04022, sulfur_SfnB, sulfur acquisition oxidoreductase, SfnB family Back     alignment and domain information
>gnl|CDD|185640 PTZ00461, PTZ00461, isovaleryl-CoA dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|185640 PTZ00461, PTZ00461, isovaleryl-CoA dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|173842 cd01153, ACAD_fadE5, Putative acyl-CoA dehydrogenases similar to fadE5 Back     alignment and domain information
>gnl|CDD|132251 TIGR03207, cyc_hxne_CoA_dh, cyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|132251 TIGR03207, cyc_hxne_CoA_dh, cyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 216
KOG0139|consensus398 99.97
KOG0140|consensus408 99.97
KOG0141|consensus421 99.96
TIGR03203378 pimD_small pimeloyl-CoA dehydrogenase, small subun 99.9
TIGR03204395 pimC_large pimeloyl-CoA dehydrogenase, large subun 99.87
PRK13026 774 acyl-CoA dehydrogenase; Reviewed 99.85
PRK09463 777 fadE acyl-CoA dehydrogenase; Reviewed 99.84
TIGR03207372 cyc_hxne_CoA_dh cyclohexanecarboxyl-CoA dehydrogen 99.83
cd01156376 IVD Isovaleryl-CoA dehydrogenase. Isovaleryl-CoA d 99.82
cd01157378 MCAD Medium chain acyl-CoA dehydrogenase. MCADs ar 99.82
PRK03354380 crotonobetainyl-CoA dehydrogenase; Validated 99.81
PTZ00461410 isovaleryl-CoA dehydrogenase; Provisional 99.81
PLN02519404 isovaleryl-CoA dehydrogenase 99.81
PTZ00457 520 acyl-CoA dehydrogenase; Provisional 99.81
cd01151386 GCD Glutaryl-CoA dehydrogenase. Glutaryl-CoA dehyd 99.8
cd01161409 VLCAD Very long chain acyl-CoA dehydrogenase. VLCA 99.8
cd01152380 ACAD_fadE6_17_26 Putative acyl-CoA dehydrogenases 99.79
PTZ00456 622 acyl-CoA dehydrogenase; Provisional 99.79
cd01155394 ACAD_FadE2 Acyl-CoA dehydrogenases similar to fadE 99.79
KOG0137|consensus 634 99.78
cd01162375 IBD Isobutyryl-CoA dehydrogenase. Isobutyryl-CoA d 99.78
cd01160372 LCAD Long chain acyl-CoA dehydrogenase. LCAD is an 99.78
PRK12341381 putative acyl-CoA dehydrogenase; Provisional 99.78
COG1960393 CaiA Acyl-CoA dehydrogenases [Lipid metabolism] 99.77
PLN02876822 acyl-CoA dehydrogenase 99.75
PLN02526412 acyl-coenzyme A oxidase 99.75
cd01158373 SCAD_SBCAD Short chain acyl-CoA dehydrogenases and 99.72
cd01153407 ACAD_fadE5 Putative acyl-CoA dehydrogenases simila 99.71
KOG0138|consensus432 99.69
KOG0139|consensus 398 99.68
cd01163377 DszC Dibenzothiophene (DBT) desulfurization enzyme 99.67
KOG0141|consensus 421 99.65
cd01154418 AidB Proteins involved in DNA damage response, sim 99.65
PRK11561 538 isovaleryl CoA dehydrogenase; Provisional 99.63
KOG0140|consensus 408 99.59
PLN02636 686 acyl-coenzyme A oxidase 99.54
PLN02312 680 acyl-CoA oxidase 99.5
KOG1469|consensus392 99.38
PF02771113 Acyl-CoA_dh_N: Acyl-CoA dehydrogenase, N-terminal 99.36
cd01159370 NcnH Naphthocyclinone hydroxylase. Naphthocyclinon 99.31
cd01151 386 GCD Glutaryl-CoA dehydrogenase. Glutaryl-CoA dehyd 99.3
PRK09463 777 fadE acyl-CoA dehydrogenase; Reviewed 99.25
TIGR03203 378 pimD_small pimeloyl-CoA dehydrogenase, small subun 99.25
PLN02519 404 isovaleryl-CoA dehydrogenase 99.25
PRK13026 774 acyl-CoA dehydrogenase; Reviewed 99.24
TIGR03204 395 pimC_large pimeloyl-CoA dehydrogenase, large subun 99.23
cd01156 376 IVD Isovaleryl-CoA dehydrogenase. Isovaleryl-CoA d 99.23
TIGR03207 372 cyc_hxne_CoA_dh cyclohexanecarboxyl-CoA dehydrogen 99.23
PRK03354 380 crotonobetainyl-CoA dehydrogenase; Validated 99.22
cd01157 378 MCAD Medium chain acyl-CoA dehydrogenase. MCADs ar 99.2
cd01152 380 ACAD_fadE6_17_26 Putative acyl-CoA dehydrogenases 99.2
cd01162 375 IBD Isobutyryl-CoA dehydrogenase. Isobutyryl-CoA d 99.19
cd01155 394 ACAD_FadE2 Acyl-CoA dehydrogenases similar to fadE 99.19
cd01160 372 LCAD Long chain acyl-CoA dehydrogenase. LCAD is an 99.19
PTZ00461 410 isovaleryl-CoA dehydrogenase; Provisional 99.18
cd01163 377 DszC Dibenzothiophene (DBT) desulfurization enzyme 99.18
PRK12341 381 putative acyl-CoA dehydrogenase; Provisional 99.17
cd01150 610 AXO Peroxisomal acyl-CoA oxidase. Peroxisomal acyl 99.16
KOG0138|consensus 432 99.16
PLN02526 412 acyl-coenzyme A oxidase 99.14
cd01161 409 VLCAD Very long chain acyl-CoA dehydrogenase. VLCA 99.09
cd01158 373 SCAD_SBCAD Short chain acyl-CoA dehydrogenases and 99.09
COG1960 393 CaiA Acyl-CoA dehydrogenases [Lipid metabolism] 99.03
PTZ00456 622 acyl-CoA dehydrogenase; Provisional 99.02
PTZ00457 520 acyl-CoA dehydrogenase; Provisional 99.02
KOG0137|consensus 634 99.0
cd01153 407 ACAD_fadE5 Putative acyl-CoA dehydrogenases simila 99.0
PTZ00460 646 acyl-CoA dehydrogenase; Provisional 98.94
cd01159 370 NcnH Naphthocyclinone hydroxylase. Naphthocyclinon 98.86
PLN02876 822 acyl-CoA dehydrogenase 98.83
PF02771113 Acyl-CoA_dh_N: Acyl-CoA dehydrogenase, N-terminal 98.64
cd00567327 ACAD Acyl-CoA dehydrogenase. Both mitochondrial ac 98.57
PLN02636 686 acyl-coenzyme A oxidase 98.54
KOG1469|consensus 392 98.54
PLN02312 680 acyl-CoA oxidase 98.38
cd01154 418 AidB Proteins involved in DNA damage response, sim 98.37
PLN02443 664 acyl-coenzyme A oxidase 98.34
PF0277052 Acyl-CoA_dh_M: Acyl-CoA dehydrogenase, middle doma 97.47
PRK11561 538 isovaleryl CoA dehydrogenase; Provisional 97.43
cd01150 610 AXO Peroxisomal acyl-CoA oxidase. Peroxisomal acyl 97.39
PTZ00460 646 acyl-CoA dehydrogenase; Provisional 96.56
cd00567 327 ACAD Acyl-CoA dehydrogenase. Both mitochondrial ac 96.47
PLN02443 664 acyl-coenzyme A oxidase 96.23
PF00441150 Acyl-CoA_dh_1: Acyl-CoA dehydrogenase, C-terminal 94.83
PF14749125 Acyl-CoA_ox_N: Acyl-coenzyme A oxidase N-terminal; 90.54
>KOG0139|consensus Back     alignment and domain information
Probab=99.97  E-value=1.3e-33  Score=213.74  Aligned_cols=199  Identities=33%  Similarity=0.490  Sum_probs=168.1

Q ss_pred             CccccccCCCCCCCCCCCHHHHHHHHHHHHccCCChhHHHHHHHhhHHHHHHhcCChhHHHHHHHHHHhCCceeeecCCC
Q psy5139           2 TTLLGVEIPQEYGGPGLSFMTDILIVEEIARVDPSVSILVDIQNTLVNDLIIKLGTTEQKEKYLPRLAQTDLMGVEIPQE   81 (216)
Q Consensus         2 ~G~~~~~~p~~~GG~g~~~~~~~~~~ee~~~~~~~~~~~~~~~~~~~~~~l~~~g~~~~~~~~l~~l~~g~~~~~~~~e~   81 (216)
                      +|++++.+|++|||.|.++...+++.||+++.+++++..+.+++.+..++|..||+++||+.++|.+...-.-+++++||
T Consensus        80 ~Glmgv~vpeeyGGsG~df~~~~~v~EEisk~d~sv~~~v~v~ntL~~~~i~~fGteeqK~~~~P~~~~d~vgsfAlSEp  159 (398)
T KOG0139|consen   80 LGLMGVEVPEEYGGSGLDFFAAAIVIEEISKVDASVGVIVDVQNTLYLPLIIQFGTEEQKEKYLPKLTGDLVGSFALSEP  159 (398)
T ss_pred             cCcceeecChhhCCCchhHHHHHHHHHHHhccCccceeEEEecccccchHHHHhCcHHHHhhhcchhhccccceeeecCC
Confidence            69999999999999999999999999999999999999888888899999999999999998888876444457899999


Q ss_pred             CCCCCccHHH-------------------------HHHHHHHHHhhCCC------ceeEeeechh--hhHHHHHhcCCH-
Q psy5139          82 YGGPGLSFMT-------------------------DILIVEEIARVDPS------VSILVDIQNT--LVNDLIIKLGTT-  127 (216)
Q Consensus        82 ~gG~~~~~~~-------------------------~~~v~e~lar~~~~------~~~~v~~~~~--~~~~~~~~~g~~-  127 (216)
                      ..|||.....                         ++.++  ++.+|++      +.|+|+.+..  ....+..++|.+ 
T Consensus       160 gaGSDa~A~~T~Ak~~Gd~~viNGsKmWItN~~~A~~~lV--fan~d~~~~~Kgit~fiV~rd~~Gl~~~k~eDKLGmRa  237 (398)
T KOG0139|consen  160 GAGSDAFALKTTAKKDGDDYVINGSKMWITNAGEADWFLV--FANADPSKGYKGITCFIVPRDTPGLSLGKKEDKLGMRA  237 (398)
T ss_pred             CCCcchHHhhhhHhhcCCeEEEecceeeecCCcccceEEE--EEecChhhccCceeEEEeeCCCCCcccCCccccccccc
Confidence            9999985322                         23333  5544443      3488887653  445667888887 


Q ss_pred             -HHhhhhchhc---ccccccccccchhhhhhhhccccCCceeeccceeeeecCcccCCCcceeeeeecc---------cc
Q psy5139         128 -EQKEKYLPRL---AQTDVSRTSRGYKALEWHAFYGRTDSLPLNDHLSHISSGCVGFDGQLKRWMVSCG---------LS  194 (216)
Q Consensus       128 -~~~~~~l~~~---~~~~lg~~~~g~~~~~~~~~~~~~~~~~l~g~k~~va~~~~g~~~~~~~~~~~~~---------fg  194 (216)
                       ..+..+|+++   .++.+|++|.|++.....++.+|          +.+++..+|.    +|.+++.+         ||
T Consensus       238 SsTcql~fedVrVpks~IlGe~G~GykyAm~~Ln~gR----------Igi~Aqmlgl----aQ~c~d~tI~Y~q~R~~FG  303 (398)
T KOG0139|consen  238 SSTCQLHFEDVRVPKSSILGEYGKGYKYAIEVLNAGR----------IGIGAQMLGL----AQGCFDETIPYAQERLQFG  303 (398)
T ss_pred             cceeeEEeccccccchhhcccCCcchHHHHHhcCccc----------eeehhhhhhh----hHhHHHhhhHHHHHHHHhc
Confidence             4466788886   57899999999999999988888          9999999999    88888765         99


Q ss_pred             ceeeeeeccc---ccccccccccCC
Q psy5139         195 LQILQFQNLS---SDMHMTGLASRF  216 (216)
Q Consensus       195 ~~i~~~Q~v~---ad~~~~~~~~r~  216 (216)
                      ++|.+||.+|   |||.+++|++|+
T Consensus       304 k~l~d~Q~iQhqiA~~~teiEaaRl  328 (398)
T KOG0139|consen  304 KRLLDFQGLQHQIADMATEIEAARL  328 (398)
T ss_pred             chhhhHHHHHHHHHHHHHHHHHHHH
Confidence            9999999999   999999999995



>KOG0140|consensus Back     alignment and domain information
>KOG0141|consensus Back     alignment and domain information
>TIGR03203 pimD_small pimeloyl-CoA dehydrogenase, small subunit Back     alignment and domain information
>TIGR03204 pimC_large pimeloyl-CoA dehydrogenase, large subunit Back     alignment and domain information
>PRK13026 acyl-CoA dehydrogenase; Reviewed Back     alignment and domain information
>PRK09463 fadE acyl-CoA dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03207 cyc_hxne_CoA_dh cyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>cd01156 IVD Isovaleryl-CoA dehydrogenase Back     alignment and domain information
>cd01157 MCAD Medium chain acyl-CoA dehydrogenase Back     alignment and domain information
>PRK03354 crotonobetainyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PTZ00461 isovaleryl-CoA dehydrogenase; Provisional Back     alignment and domain information
>PLN02519 isovaleryl-CoA dehydrogenase Back     alignment and domain information
>PTZ00457 acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>cd01151 GCD Glutaryl-CoA dehydrogenase Back     alignment and domain information
>cd01161 VLCAD Very long chain acyl-CoA dehydrogenase Back     alignment and domain information
>cd01152 ACAD_fadE6_17_26 Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26 Back     alignment and domain information
>PTZ00456 acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>cd01155 ACAD_FadE2 Acyl-CoA dehydrogenases similar to fadE2 Back     alignment and domain information
>KOG0137|consensus Back     alignment and domain information
>cd01162 IBD Isobutyryl-CoA dehydrogenase Back     alignment and domain information
>cd01160 LCAD Long chain acyl-CoA dehydrogenase Back     alignment and domain information
>PRK12341 putative acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>COG1960 CaiA Acyl-CoA dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PLN02876 acyl-CoA dehydrogenase Back     alignment and domain information
>PLN02526 acyl-coenzyme A oxidase Back     alignment and domain information
>cd01158 SCAD_SBCAD Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases Back     alignment and domain information
>cd01153 ACAD_fadE5 Putative acyl-CoA dehydrogenases similar to fadE5 Back     alignment and domain information
>KOG0138|consensus Back     alignment and domain information
>KOG0139|consensus Back     alignment and domain information
>cd01163 DszC Dibenzothiophene (DBT) desulfurization enzyme C Back     alignment and domain information
>KOG0141|consensus Back     alignment and domain information
>cd01154 AidB Proteins involved in DNA damage response, similar to the AidB gene product Back     alignment and domain information
>PRK11561 isovaleryl CoA dehydrogenase; Provisional Back     alignment and domain information
>KOG0140|consensus Back     alignment and domain information
>PLN02636 acyl-coenzyme A oxidase Back     alignment and domain information
>PLN02312 acyl-CoA oxidase Back     alignment and domain information
>KOG1469|consensus Back     alignment and domain information
>PF02771 Acyl-CoA_dh_N: Acyl-CoA dehydrogenase, N-terminal domain; InterPro: IPR006092 Mammalian Co-A dehydrogenases (1 Back     alignment and domain information
>cd01159 NcnH Naphthocyclinone hydroxylase Back     alignment and domain information
>cd01151 GCD Glutaryl-CoA dehydrogenase Back     alignment and domain information
>PRK09463 fadE acyl-CoA dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03203 pimD_small pimeloyl-CoA dehydrogenase, small subunit Back     alignment and domain information
>PLN02519 isovaleryl-CoA dehydrogenase Back     alignment and domain information
>PRK13026 acyl-CoA dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03204 pimC_large pimeloyl-CoA dehydrogenase, large subunit Back     alignment and domain information
>cd01156 IVD Isovaleryl-CoA dehydrogenase Back     alignment and domain information
>TIGR03207 cyc_hxne_CoA_dh cyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK03354 crotonobetainyl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd01157 MCAD Medium chain acyl-CoA dehydrogenase Back     alignment and domain information
>cd01152 ACAD_fadE6_17_26 Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26 Back     alignment and domain information
>cd01162 IBD Isobutyryl-CoA dehydrogenase Back     alignment and domain information
>cd01155 ACAD_FadE2 Acyl-CoA dehydrogenases similar to fadE2 Back     alignment and domain information
>cd01160 LCAD Long chain acyl-CoA dehydrogenase Back     alignment and domain information
>PTZ00461 isovaleryl-CoA dehydrogenase; Provisional Back     alignment and domain information
>cd01163 DszC Dibenzothiophene (DBT) desulfurization enzyme C Back     alignment and domain information
>PRK12341 putative acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>cd01150 AXO Peroxisomal acyl-CoA oxidase Back     alignment and domain information
>KOG0138|consensus Back     alignment and domain information
>PLN02526 acyl-coenzyme A oxidase Back     alignment and domain information
>cd01161 VLCAD Very long chain acyl-CoA dehydrogenase Back     alignment and domain information
>cd01158 SCAD_SBCAD Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases Back     alignment and domain information
>COG1960 CaiA Acyl-CoA dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PTZ00456 acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>PTZ00457 acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>KOG0137|consensus Back     alignment and domain information
>cd01153 ACAD_fadE5 Putative acyl-CoA dehydrogenases similar to fadE5 Back     alignment and domain information
>PTZ00460 acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>cd01159 NcnH Naphthocyclinone hydroxylase Back     alignment and domain information
>PLN02876 acyl-CoA dehydrogenase Back     alignment and domain information
>PF02771 Acyl-CoA_dh_N: Acyl-CoA dehydrogenase, N-terminal domain; InterPro: IPR006092 Mammalian Co-A dehydrogenases (1 Back     alignment and domain information
>cd00567 ACAD Acyl-CoA dehydrogenase Back     alignment and domain information
>PLN02636 acyl-coenzyme A oxidase Back     alignment and domain information
>KOG1469|consensus Back     alignment and domain information
>PLN02312 acyl-CoA oxidase Back     alignment and domain information
>cd01154 AidB Proteins involved in DNA damage response, similar to the AidB gene product Back     alignment and domain information
>PLN02443 acyl-coenzyme A oxidase Back     alignment and domain information
>PF02770 Acyl-CoA_dh_M: Acyl-CoA dehydrogenase, middle domain; InterPro: IPR006091 Acyl-CoA dehydrogenases (1 Back     alignment and domain information
>PRK11561 isovaleryl CoA dehydrogenase; Provisional Back     alignment and domain information
>cd01150 AXO Peroxisomal acyl-CoA oxidase Back     alignment and domain information
>PTZ00460 acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>cd00567 ACAD Acyl-CoA dehydrogenase Back     alignment and domain information
>PLN02443 acyl-coenzyme A oxidase Back     alignment and domain information
>PF00441 Acyl-CoA_dh_1: Acyl-CoA dehydrogenase, C-terminal domain; InterPro: IPR006090 Mammalian Co-A dehydrogenases (1 Back     alignment and domain information
>PF14749 Acyl-CoA_ox_N: Acyl-coenzyme A oxidase N-terminal; PDB: 2FON_A 1W07_B 1IS2_B 2DDH_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query216
2jif_A 404 Structure Of Human Short-Branched Chain Acyl-Coa De 8e-18
3gqt_A 399 Crystal Structure Of Glutaryl-Coa Dehydrogenase Fro 2e-12
3gqt_A 399 Crystal Structure Of Glutaryl-Coa Dehydrogenase Fro 9e-12
3eom_A 396 2.4 A Crystal Structure Of Native Glutaryl-Coa Dehy 3e-12
3eom_A 396 2.4 A Crystal Structure Of Native Glutaryl-Coa Dehy 1e-11
3d6b_A 395 2.2 A Crystal Structure Of Glutaryl-Coa Dehydrogena 3e-12
3d6b_A 395 2.2 A Crystal Structure Of Glutaryl-Coa Dehydrogena 1e-11
2eba_A 385 Crystal Structure Of The Putative Glutaryl-coa Dehy 2e-10
1ivh_A 394 Structure Of Human Isovaleryl-coa Dehydrogenase At 1e-09
1ivh_A 394 Structure Of Human Isovaleryl-coa Dehydrogenase At 2e-09
2ix5_A 436 Short Chain Specific Acyl-Coa Oxidase From Arabidop 2e-08
2ix6_A 449 Short Chain Specific Acyl-Coa Oxidase From Arabidop 2e-08
1ws9_A 387 Crystal Structure Of Project Id Tt0172 From Thermus 5e-08
2vig_A 391 Crystal Structure Of Human Short-Chain Acyl Coa Deh 2e-07
2vig_A 391 Crystal Structure Of Human Short-Chain Acyl Coa Deh 1e-06
2z1q_A 577 Crystal Structure Of Acyl Coa Dehydrogenase Length 3e-07
2dvl_A 372 Crystal Structure Of Project Tt0160 From Thermus Th 5e-07
1siq_A 392 The Crystal Structure And Mechanism Of Human Glutar 6e-07
1siq_A 392 The Crystal Structure And Mechanism Of Human Glutar 2e-05
1sir_A 394 The Crystal Structure And Mechanism Of Human Glutar 7e-07
1sir_A 394 The Crystal Structure And Mechanism Of Human Glutar 2e-05
2r0m_A 394 The Effect Of A Glu370asp Mutation In Glutaryl-Coa 7e-07
2r0m_A 394 The Effect Of A Glu370asp Mutation In Glutaryl-Coa 2e-05
3owa_A 597 Crystal Structure Of Acyl-Coa Dehydrogenase Complex 8e-07
3pfd_A 393 Crystal Structure Of An Acyl-Coa Dehydrogenase From 1e-06
1jqi_A 388 Crystal Structure Of Rat Short Chain Acyl-Coa Dehyd 1e-06
1jqi_A 388 Crystal Structure Of Rat Short Chain Acyl-Coa Dehyd 3e-06
3mpi_A 397 Structure Of The Glutaryl-Coenzyme A Dehydrogenase 7e-06
2uxw_A 607 Crystal Structure Of Human Very Long Chain Acyl-coa 4e-05
3b96_A 587 Structural Basis For Substrate Fatty-Acyl Chain Spe 4e-05
3nf4_A 387 Crystal Structure Of Acyl-Coa Dehydrogenase From My 6e-05
2pg0_A 385 Crystal Structure Of Acyl-Coa Dehydrogenase From Ge 1e-04
2pg0_A 385 Crystal Structure Of Acyl-Coa Dehydrogenase From Ge 1e-04
1ukw_A 379 Crystal Structure Of Medium-Chain Acyl-Coa Dehydrog 1e-04
4doy_A 437 Crystal Structure Of Dibenzothiophene Desulfurizati 1e-04
3mdd_A 385 Crystal Structures Of Medium Chain Acyl-Coa Dehydro 3e-04
1udy_A 396 Medium-Chain Acyl-Coa Dehydrogenase With 3-Thiaocta 3e-04
3swo_A 399 Crystal Structure Of A Glutaryl-Coa Dehydrogenase F 8e-04
>pdb|2JIF|A Chain A, Structure Of Human Short-Branched Chain Acyl-Coa Dehydrogenase (Acadsb) Length = 404 Back     alignment and structure

Iteration: 1

Score = 86.7 bits (213), Expect = 8e-18, Method: Compositional matrix adjust. Identities = 40/75 (53%), Positives = 54/75 (72%) Query: 68 LAQTDLMGVEIPQEYGGPGLSFMTDILIVEEIARVDPSVSILVDIQNTLVNDLIIKLGTT 127 L Q LMG+E+ EYGG G SF++ +L++EE+A+VD SV++ +IQNTL+N LI K GT Sbjct: 69 LFQQGLMGIEVDPEYGGTGASFLSTVLVIEELAKVDASVAVFCEIQNTLINTLIRKHGTE 128 Query: 128 EQKEKYLPRLAQTDV 142 EQK YLP+L V Sbjct: 129 EQKATYLPQLTTEKV 143
>pdb|3GQT|A Chain A, Crystal Structure Of Glutaryl-Coa Dehydrogenase From Burkholderia Pseudomallei With Fragment (1,4-Dimethyl-1,2,3,4- Tetrahydroquinoxalin-6-Yl)methylamine Length = 399 Back     alignment and structure
>pdb|3GQT|A Chain A, Crystal Structure Of Glutaryl-Coa Dehydrogenase From Burkholderia Pseudomallei With Fragment (1,4-Dimethyl-1,2,3,4- Tetrahydroquinoxalin-6-Yl)methylamine Length = 399 Back     alignment and structure
>pdb|3EOM|A Chain A, 2.4 A Crystal Structure Of Native Glutaryl-Coa Dehydrogenase From Burkholderia Pseudomallei Length = 396 Back     alignment and structure
>pdb|3EOM|A Chain A, 2.4 A Crystal Structure Of Native Glutaryl-Coa Dehydrogenase From Burkholderia Pseudomallei Length = 396 Back     alignment and structure
>pdb|3D6B|A Chain A, 2.2 A Crystal Structure Of Glutaryl-Coa Dehydrogenase From Burkholderia Pseudomallei Length = 395 Back     alignment and structure
>pdb|3D6B|A Chain A, 2.2 A Crystal Structure Of Glutaryl-Coa Dehydrogenase From Burkholderia Pseudomallei Length = 395 Back     alignment and structure
>pdb|2EBA|A Chain A, Crystal Structure Of The Putative Glutaryl-coa Dehydrogenase From Thermus Thermophilus Length = 385 Back     alignment and structure
>pdb|1IVH|A Chain A, Structure Of Human Isovaleryl-coa Dehydrogenase At 2.6 Angstroms Resolution: Structural Basis For Substrate Specificity Length = 394 Back     alignment and structure
>pdb|1IVH|A Chain A, Structure Of Human Isovaleryl-coa Dehydrogenase At 2.6 Angstroms Resolution: Structural Basis For Substrate Specificity Length = 394 Back     alignment and structure
>pdb|2IX5|A Chain A, Short Chain Specific Acyl-Coa Oxidase From Arabidopsis Thaliana, Acx4 In Complex With Acetoacetyl-Coa Length = 436 Back     alignment and structure
>pdb|2IX6|A Chain A, Short Chain Specific Acyl-Coa Oxidase From Arabidopsis Thaliana, Acx4 Length = 449 Back     alignment and structure
>pdb|1WS9|A Chain A, Crystal Structure Of Project Id Tt0172 From Thermus Thermophilus Hb8 Length = 387 Back     alignment and structure
>pdb|2VIG|A Chain A, Crystal Structure Of Human Short-Chain Acyl Coa Dehydrogenase Length = 391 Back     alignment and structure
>pdb|2VIG|A Chain A, Crystal Structure Of Human Short-Chain Acyl Coa Dehydrogenase Length = 391 Back     alignment and structure
>pdb|2Z1Q|A Chain A, Crystal Structure Of Acyl Coa Dehydrogenase Length = 577 Back     alignment and structure
>pdb|2DVL|A Chain A, Crystal Structure Of Project Tt0160 From Thermus Thermophilus Hb8 Length = 372 Back     alignment and structure
>pdb|1SIQ|A Chain A, The Crystal Structure And Mechanism Of Human Glutaryl-Coa Dehydrogenase Length = 392 Back     alignment and structure
>pdb|1SIQ|A Chain A, The Crystal Structure And Mechanism Of Human Glutaryl-Coa Dehydrogenase Length = 392 Back     alignment and structure
>pdb|1SIR|A Chain A, The Crystal Structure And Mechanism Of Human Glutaryl-Coa Dehydrogenase Length = 394 Back     alignment and structure
>pdb|1SIR|A Chain A, The Crystal Structure And Mechanism Of Human Glutaryl-Coa Dehydrogenase Length = 394 Back     alignment and structure
>pdb|2R0M|A Chain A, The Effect Of A Glu370asp Mutation In Glutaryl-Coa Dehydrogenase On Proton Transfer To The Dienolate Intermediate Length = 394 Back     alignment and structure
>pdb|2R0M|A Chain A, The Effect Of A Glu370asp Mutation In Glutaryl-Coa Dehydrogenase On Proton Transfer To The Dienolate Intermediate Length = 394 Back     alignment and structure
>pdb|3OWA|A Chain A, Crystal Structure Of Acyl-Coa Dehydrogenase Complexed With Fad From Bacillus Anthracis Length = 597 Back     alignment and structure
>pdb|3PFD|A Chain A, Crystal Structure Of An Acyl-Coa Dehydrogenase From Mycobacterium Thermoresistibile Bound To Reduced Flavin Adenine Dinucleotide Solved By Combined Iodide Ion Sad Mr Length = 393 Back     alignment and structure
>pdb|1JQI|A Chain A, Crystal Structure Of Rat Short Chain Acyl-Coa Dehydrogenase Complexed With Acetoacetyl-Coa Length = 388 Back     alignment and structure
>pdb|1JQI|A Chain A, Crystal Structure Of Rat Short Chain Acyl-Coa Dehydrogenase Complexed With Acetoacetyl-Coa Length = 388 Back     alignment and structure
>pdb|3MPI|A Chain A, Structure Of The Glutaryl-Coenzyme A Dehydrogenase Glutaryl-Coa Complex Length = 397 Back     alignment and structure
>pdb|2UXW|A Chain A, Crystal Structure Of Human Very Long Chain Acyl-coa Dehydrogenase (acadvl) Length = 607 Back     alignment and structure
>pdb|3B96|A Chain A, Structural Basis For Substrate Fatty-Acyl Chain Specificity: Crystal Structure Of Human Very-Long-Chain Acyl-Coa Dehydrogenase Length = 587 Back     alignment and structure
>pdb|3NF4|A Chain A, Crystal Structure Of Acyl-Coa Dehydrogenase From Mycobacterium Thermoresistibile Bound To Flavin Adenine Dinucleotide Length = 387 Back     alignment and structure
>pdb|2PG0|A Chain A, Crystal Structure Of Acyl-Coa Dehydrogenase From Geobacillus Kaustophilus Length = 385 Back     alignment and structure
>pdb|2PG0|A Chain A, Crystal Structure Of Acyl-Coa Dehydrogenase From Geobacillus Kaustophilus Length = 385 Back     alignment and structure
>pdb|1UKW|A Chain A, Crystal Structure Of Medium-Chain Acyl-Coa Dehydrogenase From Thermus Thermophilus Hb8 Length = 379 Back     alignment and structure
>pdb|4DOY|A Chain A, Crystal Structure Of Dibenzothiophene Desulfurization Enzyme C Length = 437 Back     alignment and structure
>pdb|3MDD|A Chain A, Crystal Structures Of Medium Chain Acyl-Coa Dehydrogenase From Pig Liver Mitochondria With And Without Substrate Length = 385 Back     alignment and structure
>pdb|1UDY|A Chain A, Medium-Chain Acyl-Coa Dehydrogenase With 3-Thiaoctanoyl-Coa Length = 396 Back     alignment and structure
>pdb|3SWO|A Chain A, Crystal Structure Of A Glutaryl-Coa Dehydrogenase From Mycobacterium Smegmatis In Complex With Fadh2 Length = 399 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query216
2jif_A 404 Short/branched chain specific acyl-COA dehydrogen; 2e-29
2jif_A 404 Short/branched chain specific acyl-COA dehydrogen; 1e-27
2vig_A 391 Short-chain specific acyl-COA dehydrogenase,; fatt 2e-24
2vig_A 391 Short-chain specific acyl-COA dehydrogenase,; fatt 6e-23
2d29_A 387 Acyl-COA dehydrogenase; structural genomics, NPPSF 6e-24
2d29_A 387 Acyl-COA dehydrogenase; structural genomics, NPPSF 2e-22
2dvl_A 372 Acyl-COA dehydrogenase; structural genomics, NPPSF 8e-24
2dvl_A 372 Acyl-COA dehydrogenase; structural genomics, NPPSF 2e-22
1buc_A 383 Butyryl-COA dehydrogenase; acyl-COA dehydrogenase 1e-22
1buc_A 383 Butyryl-COA dehydrogenase; acyl-COA dehydrogenase 5e-21
3pfd_A 393 Acyl-COA dehydrogenase; structural genomics, seatt 4e-22
3pfd_A 393 Acyl-COA dehydrogenase; structural genomics, seatt 5e-21
1egd_A 396 Medium chain acyl-COA dehydrogenase; flavoprotein, 5e-22
1egd_A 396 Medium chain acyl-COA dehydrogenase; flavoprotein, 2e-21
3ii9_A 396 Glutaryl-COA dehydrogenase; slipchip, microfluidic 6e-22
3ii9_A 396 Glutaryl-COA dehydrogenase; slipchip, microfluidic 4e-21
2c12_A 439 Nitroalkane oxidase; oxidoreductase, flavoenzyme, 9e-22
2c12_A 439 Nitroalkane oxidase; oxidoreductase, flavoenzyme, 3e-20
2eba_A 385 Putative glutaryl-COA dehydrogenase; thermus therm 9e-22
2eba_A 385 Putative glutaryl-COA dehydrogenase; thermus therm 1e-20
1r2j_A 366 Protein FKBI; polyketide synthase, polyketide, acy 2e-21
1r2j_A 366 Protein FKBI; polyketide synthase, polyketide, acy 2e-19
1ukw_A 379 Acyl-COA dehydrogenase; oxidoreductase, riken stru 2e-21
1ukw_A 379 Acyl-COA dehydrogenase; oxidoreductase, riken stru 2e-20
2uxw_A 607 VERY-long-chain specific acyl-COA dehydrogenase; f 2e-21
2uxw_A 607 VERY-long-chain specific acyl-COA dehydrogenase; f 8e-21
1rx0_A 393 Acyl-COA dehydrogenase family member 8, mitochondr 3e-21
1rx0_A 393 Acyl-COA dehydrogenase family member 8, mitochondr 5e-20
3nf4_A 387 Acyl-COA dehydrogenase; seattle structural genomic 9e-21
3nf4_A 387 Acyl-COA dehydrogenase; seattle structural genomic 1e-19
3mkh_A 438 Nitroalkane oxidase; oxidoreductase flavoenzyme, a 2e-20
3mkh_A 438 Nitroalkane oxidase; oxidoreductase flavoenzyme, a 7e-19
1ivh_A 394 Isovaleryl-COA dehydrogenase; oxidoreductase, acyl 3e-20
1ivh_A 394 Isovaleryl-COA dehydrogenase; oxidoreductase, acyl 1e-19
2ix5_A 436 Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, 3e-20
2ix5_A 436 Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, 6e-19
2z1q_A 577 Acyl-COA dehydrogenase; FAD, structural genomics, 5e-20
2z1q_A 577 Acyl-COA dehydrogenase; FAD, structural genomics, 1e-18
3swo_A 399 Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA d 8e-20
3swo_A 399 Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA d 7e-19
3mpi_A 397 Glutaryl-COA dehydrogenase; alpha-beta fold, oxido 8e-20
3mpi_A 397 Glutaryl-COA dehydrogenase; alpha-beta fold, oxido 9e-19
3sf6_A 403 Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SB 9e-20
3sf6_A 403 Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SB 9e-19
3owa_A 597 Acyl-COA dehydrogenase; structural genomics, cente 1e-19
3owa_A 597 Acyl-COA dehydrogenase; structural genomics, cente 2e-18
1siq_A 392 GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrog 1e-18
1siq_A 392 GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrog 1e-17
2pg0_A 385 Acyl-COA dehydrogenase; GK1316, geobacillus kausto 3e-18
2pg0_A 385 Acyl-COA dehydrogenase; GK1316, geobacillus kausto 9e-18
3p4t_A 403 Putative acyl-COA dehydrogenase; ssgcid, structura 6e-18
3p4t_A 403 Putative acyl-COA dehydrogenase; ssgcid, structura 7e-18
3r7k_A 403 Probable acyl COA dehydrogenase; ssgcid, structura 2e-17
3r7k_A 403 Probable acyl COA dehydrogenase; ssgcid, structura 2e-17
3m9v_A 439 FAD-dependent oxidoreductase; KIJD3, fatty acyl-CO 7e-17
3m9v_A 439 FAD-dependent oxidoreductase; KIJD3, fatty acyl-CO 2e-16
3mxl_A 395 Nitrososynthase; flavin monooxygenase, acyl-COA de 8e-17
3mxl_A 395 Nitrososynthase; flavin monooxygenase, acyl-COA de 1e-15
2jbr_A 422 P-hydroxyphenylacetate hydroxylase C2 oxygenase C; 4e-09
2jbr_A 422 P-hydroxyphenylacetate hydroxylase C2 oxygenase C; 6e-08
2rfq_A 394 3-HSA hydroxylase, oxygenase; rhodococcus SP. RHA1 2e-07
2rfq_A 394 3-HSA hydroxylase, oxygenase; rhodococcus SP. RHA1 9e-07
2or0_A 414 Hydroxylase; APC7385, rhodococcus SP. RHA1, struct 1e-06
2or0_A 414 Hydroxylase; APC7385, rhodococcus SP. RHA1, struct 5e-06
2ddh_A 661 Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundl 2e-05
2ddh_A 661 Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundl 2e-04
>2jif_A Short/branched chain specific acyl-COA dehydrogen; mitochondrion, oxidoreductase, transit peptide, fatty acid metabolism, FAD, flavoprotein; HET: FAD COS; 2.0A {Homo sapiens} Length = 404 Back     alignment and structure
 Score =  112 bits (282), Expect = 2e-29
 Identities = 39/74 (52%), Positives = 54/74 (72%)

Query: 65  LPRLAQTDLMGVEIPQEYGGPGLSFMTDILIVEEIARVDPSVSILVDIQNTLVNDLIIKL 124
           +  L Q  LMG+E+  EYGG G SF++ +L++EE+A+VD SV++  +IQNTL+N LI K 
Sbjct: 66  IQGLFQQGLMGIEVDPEYGGTGASFLSTVLVIEELAKVDASVAVFCEIQNTLINTLIRKH 125

Query: 125 GTTEQKEKYLPRLA 138
           GT EQK  YLP+L 
Sbjct: 126 GTEEQKATYLPQLT 139


>2jif_A Short/branched chain specific acyl-COA dehydrogen; mitochondrion, oxidoreductase, transit peptide, fatty acid metabolism, FAD, flavoprotein; HET: FAD COS; 2.0A {Homo sapiens} Length = 404 Back     alignment and structure
>2vig_A Short-chain specific acyl-COA dehydrogenase,; fatty acid metabolism, FAD, polymorphism, flavoprotein, mitochondrion, disease mutation; HET: FAD COS; 1.9A {Homo sapiens} PDB: 1jqi_A* Length = 391 Back     alignment and structure
>2vig_A Short-chain specific acyl-COA dehydrogenase,; fatty acid metabolism, FAD, polymorphism, flavoprotein, mitochondrion, disease mutation; HET: FAD COS; 1.9A {Homo sapiens} PDB: 1jqi_A* Length = 391 Back     alignment and structure
>2d29_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; HET: FAD; 1.65A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 PDB: 1ws9_A 2cx9_A* Length = 387 Back     alignment and structure
>2d29_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; HET: FAD; 1.65A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 PDB: 1ws9_A 2cx9_A* Length = 387 Back     alignment and structure
>2dvl_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project on protein STR and functional analyses; HET: FAD; 2.50A {Thermus thermophilus} Length = 372 Back     alignment and structure
>2dvl_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project on protein STR and functional analyses; HET: FAD; 2.50A {Thermus thermophilus} Length = 372 Back     alignment and structure
>1buc_A Butyryl-COA dehydrogenase; acyl-COA dehydrogenase short-chain acyl-COA dehydrogenase, flavoprotein, oxidoreductase; HET: CAA FAD; 2.50A {Megasphaera elsdenii} SCOP: a.29.3.1 e.6.1.1 Length = 383 Back     alignment and structure
>1buc_A Butyryl-COA dehydrogenase; acyl-COA dehydrogenase short-chain acyl-COA dehydrogenase, flavoprotein, oxidoreductase; HET: CAA FAD; 2.50A {Megasphaera elsdenii} SCOP: a.29.3.1 e.6.1.1 Length = 383 Back     alignment and structure
>3pfd_A Acyl-COA dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: FDA; 2.10A {Mycobacterium thermoresistibile} Length = 393 Back     alignment and structure
>3pfd_A Acyl-COA dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: FDA; 2.10A {Mycobacterium thermoresistibile} Length = 393 Back     alignment and structure
>1egd_A Medium chain acyl-COA dehydrogenase; flavoprotein, electron transfer; HET: FAD; 2.40A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 1egc_A* 1ege_A* 1t9g_A* 2a1t_A* 1udy_A* 3mdd_A* 3mde_A* Length = 396 Back     alignment and structure
>1egd_A Medium chain acyl-COA dehydrogenase; flavoprotein, electron transfer; HET: FAD; 2.40A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 1egc_A* 1ege_A* 1t9g_A* 2a1t_A* 1udy_A* 3mdd_A* 3mde_A* Length = 396 Back     alignment and structure
>3ii9_A Glutaryl-COA dehydrogenase; slipchip, microfluidics, screening, optimization, protein crystallization, structural genomics; HET: PGE PG4; 1.74A {Burkholderia pseudomallei 1710B} PDB: 3eon_A* 3eom_A* 3gqt_A* 3gnc_A* 3d6b_A Length = 396 Back     alignment and structure
>3ii9_A Glutaryl-COA dehydrogenase; slipchip, microfluidics, screening, optimization, protein crystallization, structural genomics; HET: PGE PG4; 1.74A {Burkholderia pseudomallei 1710B} PDB: 3eon_A* 3eom_A* 3gqt_A* 3gnc_A* 3d6b_A Length = 396 Back     alignment and structure
>2c12_A Nitroalkane oxidase; oxidoreductase, flavoenzyme, acyl-COA dehydrogenase, long cell EDGE, FAD, inhibitor, flavoprotein; HET: SPM FAD PE4; 2.07A {Fusarium oxysporum} SCOP: a.29.3.1 e.6.1.1 PDB: 2c0u_A* 2zaf_A* 2reh_A* 3d9g_A* 3d9f_A* 3d9d_A* 3d9e_A* 3fcj_A* Length = 439 Back     alignment and structure
>2c12_A Nitroalkane oxidase; oxidoreductase, flavoenzyme, acyl-COA dehydrogenase, long cell EDGE, FAD, inhibitor, flavoprotein; HET: SPM FAD PE4; 2.07A {Fusarium oxysporum} SCOP: a.29.3.1 e.6.1.1 PDB: 2c0u_A* 2zaf_A* 2reh_A* 3d9g_A* 3d9f_A* 3d9d_A* 3d9e_A* 3fcj_A* Length = 439 Back     alignment and structure
>2eba_A Putative glutaryl-COA dehydrogenase; thermus thermophilius, FAD, STRU genomics, NPPSFA; HET: FAD; 2.21A {Thermus thermophilus} Length = 385 Back     alignment and structure
>2eba_A Putative glutaryl-COA dehydrogenase; thermus thermophilius, FAD, STRU genomics, NPPSFA; HET: FAD; 2.21A {Thermus thermophilus} Length = 385 Back     alignment and structure
>1r2j_A Protein FKBI; polyketide synthase, polyketide, acyl-COA dehydrogenase, , aldehyde dehydrogenase, oxidoreductase; HET: FAD; 2.10A {Streptomyces hygroscopicus} SCOP: a.29.3.1 e.6.1.1 Length = 366 Back     alignment and structure
>1r2j_A Protein FKBI; polyketide synthase, polyketide, acyl-COA dehydrogenase, , aldehyde dehydrogenase, oxidoreductase; HET: FAD; 2.10A {Streptomyces hygroscopicus} SCOP: a.29.3.1 e.6.1.1 Length = 366 Back     alignment and structure
>1ukw_A Acyl-COA dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: FAD; 2.40A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 Length = 379 Back     alignment and structure
>1ukw_A Acyl-COA dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: FAD; 2.40A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 Length = 379 Back     alignment and structure
>2uxw_A VERY-long-chain specific acyl-COA dehydrogenase; fatty acid metabolism, transit peptide, disease mutation, LI metabolism, coenzyme A dehydrogenase; HET: FAD TH3; 1.45A {Homo sapiens} PDB: 3b96_A* Length = 607 Back     alignment and structure
>2uxw_A VERY-long-chain specific acyl-COA dehydrogenase; fatty acid metabolism, transit peptide, disease mutation, LI metabolism, coenzyme A dehydrogenase; HET: FAD TH3; 1.45A {Homo sapiens} PDB: 3b96_A* Length = 607 Back     alignment and structure
>1rx0_A Acyl-COA dehydrogenase family member 8, mitochondrial; flavoprotein, coenzyme A, oxidoreductase; HET: FAD 2MC; 1.77A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Length = 393 Back     alignment and structure
>1rx0_A Acyl-COA dehydrogenase family member 8, mitochondrial; flavoprotein, coenzyme A, oxidoreductase; HET: FAD 2MC; 1.77A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Length = 393 Back     alignment and structure
>3nf4_A Acyl-COA dehydrogenase; seattle structural genomics center for infectious disease, S FAD, FADH, tuberculosis, oxidoredu; HET: FAD; 2.35A {Mycobacterium thermoresistibile} Length = 387 Back     alignment and structure
>3nf4_A Acyl-COA dehydrogenase; seattle structural genomics center for infectious disease, S FAD, FADH, tuberculosis, oxidoredu; HET: FAD; 2.35A {Mycobacterium thermoresistibile} Length = 387 Back     alignment and structure
>3mkh_A Nitroalkane oxidase; oxidoreductase flavoenzyme, acyl-COA dehydrogen flavoprotein, oxidoreductase; HET: FAD; 2.00A {Podospora anserina} Length = 438 Back     alignment and structure
>3mkh_A Nitroalkane oxidase; oxidoreductase flavoenzyme, acyl-COA dehydrogen flavoprotein, oxidoreductase; HET: FAD; 2.00A {Podospora anserina} Length = 438 Back     alignment and structure
>1ivh_A Isovaleryl-COA dehydrogenase; oxidoreductase, acyl-COA dehydrogenase, flavoprotein, isovaleric acidemia; HET: FAD COS; 2.60A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Length = 394 Back     alignment and structure
>1ivh_A Isovaleryl-COA dehydrogenase; oxidoreductase, acyl-COA dehydrogenase, flavoprotein, isovaleric acidemia; HET: FAD COS; 2.60A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Length = 394 Back     alignment and structure
>2ix5_A Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, flavin, peroxisome, glyoxysome, fatty acid metabo lipid metabolism, acyl-COA oxidase; HET: CAA FAD; 2.7A {Arabidopsis thaliana} PDB: 2ix6_A* Length = 436 Back     alignment and structure
>2ix5_A Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, flavin, peroxisome, glyoxysome, fatty acid metabo lipid metabolism, acyl-COA oxidase; HET: CAA FAD; 2.7A {Arabidopsis thaliana} PDB: 2ix6_A* Length = 436 Back     alignment and structure
>2z1q_A Acyl-COA dehydrogenase; FAD, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: FAD; 2.30A {Thermus thermophilus} Length = 577 Back     alignment and structure
>2z1q_A Acyl-COA dehydrogenase; FAD, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: FAD; 2.30A {Thermus thermophilus} Length = 577 Back     alignment and structure
>3swo_A Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA dehdrogenase, mycobacerium smegmatis, S genomics; HET: FDA; 1.45A {Mycobacterium smegmatis} Length = 399 Back     alignment and structure
>3swo_A Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA dehdrogenase, mycobacerium smegmatis, S genomics; HET: FDA; 1.45A {Mycobacterium smegmatis} Length = 399 Back     alignment and structure
>3mpi_A Glutaryl-COA dehydrogenase; alpha-beta fold, oxidoreductase; HET: FAD GRA; 2.05A {Desulfococcus multivorans} PDB: 3mpj_A* Length = 397 Back     alignment and structure
>3mpi_A Glutaryl-COA dehydrogenase; alpha-beta fold, oxidoreductase; HET: FAD GRA; 2.05A {Desulfococcus multivorans} PDB: 3mpj_A* Length = 397 Back     alignment and structure
>3sf6_A Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; HET: FDA; 1.70A {Mycobacterium smegmatis} Length = 403 Back     alignment and structure
>3sf6_A Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; HET: FDA; 1.70A {Mycobacterium smegmatis} Length = 403 Back     alignment and structure
>3owa_A Acyl-COA dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-structure, beta-barrel; HET: MSE FAD 1PE; 1.97A {Bacillus anthracis} Length = 597 Back     alignment and structure
>3owa_A Acyl-COA dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-structure, beta-barrel; HET: MSE FAD 1PE; 1.97A {Bacillus anthracis} Length = 597 Back     alignment and structure
>1siq_A GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrogenase, decarboxylation, flavin protein, oxidoreductase; HET: FAD; 2.10A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 2r0n_A* 1sir_A* 2r0m_A* Length = 392 Back     alignment and structure
>1siq_A GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrogenase, decarboxylation, flavin protein, oxidoreductase; HET: FAD; 2.10A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 2r0n_A* 1sir_A* 2r0m_A* Length = 392 Back     alignment and structure
>2pg0_A Acyl-COA dehydrogenase; GK1316, geobacillus kaustophilus HTA structural genomics, PSI, protein structure initiative; HET: FAD; 1.80A {Geobacillus kaustophilus} Length = 385 Back     alignment and structure
>2pg0_A Acyl-COA dehydrogenase; GK1316, geobacillus kaustophilus HTA structural genomics, PSI, protein structure initiative; HET: FAD; 1.80A {Geobacillus kaustophilus} Length = 385 Back     alignment and structure
>3p4t_A Putative acyl-COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FAO; 1.70A {Mycobacterium smegmatis} PDB: 3oib_A* Length = 403 Back     alignment and structure
>3p4t_A Putative acyl-COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FAO; 1.70A {Mycobacterium smegmatis} PDB: 3oib_A* Length = 403 Back     alignment and structure
>3r7k_A Probable acyl COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FDA; 2.50A {Mycobacterium abscessus} Length = 403 Back     alignment and structure
>3r7k_A Probable acyl COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FDA; 2.50A {Mycobacterium abscessus} Length = 403 Back     alignment and structure
>3m9v_A FAD-dependent oxidoreductase; KIJD3, fatty acyl-COA dehydrogenase family, kijanose, kijani FAD, flavoprotein; HET: TYD; 2.05A {Actinomadura kijaniata} Length = 439 Back     alignment and structure
>3m9v_A FAD-dependent oxidoreductase; KIJD3, fatty acyl-COA dehydrogenase family, kijanose, kijani FAD, flavoprotein; HET: TYD; 2.05A {Actinomadura kijaniata} Length = 439 Back     alignment and structure
>3mxl_A Nitrososynthase; flavin monooxygenase, acyl-COA dehydrogenas oxidoreductase; 3.15A {Micromonospora carbonacea} Length = 395 Back     alignment and structure
>3mxl_A Nitrososynthase; flavin monooxygenase, acyl-COA dehydrogenas oxidoreductase; 3.15A {Micromonospora carbonacea} Length = 395 Back     alignment and structure
>2jbr_A P-hydroxyphenylacetate hydroxylase C2 oxygenase C; flavoenzyme hydroxylase, oxidoreductase; 2.3A {Acinetobacter baumannii} PDB: 2jbs_A* 2jbt_A* Length = 422 Back     alignment and structure
>2jbr_A P-hydroxyphenylacetate hydroxylase C2 oxygenase C; flavoenzyme hydroxylase, oxidoreductase; 2.3A {Acinetobacter baumannii} PDB: 2jbs_A* 2jbt_A* Length = 422 Back     alignment and structure
>2rfq_A 3-HSA hydroxylase, oxygenase; rhodococcus SP. RHA1, structural genomics protein structure initiative, midwest center for structural genomics, MCSG; HET: 1PS; 1.65A {Rhodococcus SP} PDB: 3aff_A 3afe_A Length = 394 Back     alignment and structure
>2rfq_A 3-HSA hydroxylase, oxygenase; rhodococcus SP. RHA1, structural genomics protein structure initiative, midwest center for structural genomics, MCSG; HET: 1PS; 1.65A {Rhodococcus SP} PDB: 3aff_A 3afe_A Length = 394 Back     alignment and structure
>2or0_A Hydroxylase; APC7385, rhodococcus SP. RHA1, structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 2.10A {Rhodococcus SP} Length = 414 Back     alignment and structure
>2or0_A Hydroxylase; APC7385, rhodococcus SP. RHA1, structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 2.10A {Rhodococcus SP} Length = 414 Back     alignment and structure
>2ddh_A Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundle, oxidoreductase; HET: FAD HXD; 2.07A {Rattus norvegicus} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 1is2_A* Length = 661 Back     alignment and structure
>2ddh_A Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundle, oxidoreductase; HET: FAD HXD; 2.07A {Rattus norvegicus} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 1is2_A* Length = 661 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query216
1r2j_A366 Protein FKBI; polyketide synthase, polyketide, acy 99.88
2jif_A404 Short/branched chain specific acyl-COA dehydrogen; 99.88
2dvl_A372 Acyl-COA dehydrogenase; structural genomics, NPPSF 99.87
3p4t_A403 Putative acyl-COA dehydrogenase; ssgcid, structura 99.87
3pfd_A393 Acyl-COA dehydrogenase; structural genomics, seatt 99.87
2d29_A387 Acyl-COA dehydrogenase; structural genomics, NPPSF 99.87
1rx0_A393 Acyl-COA dehydrogenase family member 8, mitochondr 99.87
3r7k_A403 Probable acyl COA dehydrogenase; ssgcid, structura 99.87
1ivh_A394 Isovaleryl-COA dehydrogenase; oxidoreductase, acyl 99.86
3nf4_A387 Acyl-COA dehydrogenase; seattle structural genomic 99.86
3owa_A 597 Acyl-COA dehydrogenase; structural genomics, cente 99.86
1ukw_A379 Acyl-COA dehydrogenase; oxidoreductase, riken stru 99.86
2pg0_A385 Acyl-COA dehydrogenase; GK1316, geobacillus kausto 99.86
1egd_A396 Medium chain acyl-COA dehydrogenase; flavoprotein, 99.86
3sf6_A403 Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SB 99.86
2vig_A391 Short-chain specific acyl-COA dehydrogenase,; fatt 99.86
2eba_A385 Putative glutaryl-COA dehydrogenase; thermus therm 99.85
3swo_A399 Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA d 99.85
2z1q_A 577 Acyl-COA dehydrogenase; FAD, structural genomics, 99.85
1buc_A383 Butyryl-COA dehydrogenase; acyl-COA dehydrogenase 99.85
2ix5_A436 Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, 99.85
2uxw_A 607 VERY-long-chain specific acyl-COA dehydrogenase; f 99.84
3ii9_A396 Glutaryl-COA dehydrogenase; slipchip, microfluidic 99.84
4hr3_A415 Putative acyl-COA dehydrogenase; ssgcid, seattle s 99.84
3mpi_A397 Glutaryl-COA dehydrogenase; alpha-beta fold, oxido 99.83
1siq_A392 GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrog 99.78
3mkh_A 438 Nitroalkane oxidase; oxidoreductase flavoenzyme, a 99.78
2c12_A 439 Nitroalkane oxidase; oxidoreductase, flavoenzyme, 99.78
3mxl_A395 Nitrososynthase; flavin monooxygenase, acyl-COA de 99.72
2wbi_A428 Acyl-COA dehydrogenase family member 11; human, ph 99.71
3m9v_A 439 FAD-dependent oxidoreductase; KIJD3, fatty acyl-CO 99.68
2jbr_A422 P-hydroxyphenylacetate hydroxylase C2 oxygenase C; 99.62
2rfq_A394 3-HSA hydroxylase, oxygenase; rhodococcus SP. RHA1 99.58
2or0_A 414 Hydroxylase; APC7385, rhodococcus SP. RHA1, struct 99.58
3djl_A 541 Protein AIDB; alpha helix, beta-barrel, FAD, flavo 99.53
2jif_A 404 Short/branched chain specific acyl-COA dehydrogen; 99.4
2d29_A 387 Acyl-COA dehydrogenase; structural genomics, NPPSF 99.39
3p4t_A 403 Putative acyl-COA dehydrogenase; ssgcid, structura 99.39
2dvl_A 372 Acyl-COA dehydrogenase; structural genomics, NPPSF 99.38
1ukw_A 379 Acyl-COA dehydrogenase; oxidoreductase, riken stru 99.37
3ii9_A 396 Glutaryl-COA dehydrogenase; slipchip, microfluidic 99.37
2vig_A 391 Short-chain specific acyl-COA dehydrogenase,; fatt 99.37
3pfd_A 393 Acyl-COA dehydrogenase; structural genomics, seatt 99.36
2eba_A 385 Putative glutaryl-COA dehydrogenase; thermus therm 99.36
1r2j_A 366 Protein FKBI; polyketide synthase, polyketide, acy 99.36
3r7k_A 403 Probable acyl COA dehydrogenase; ssgcid, structura 99.36
3nf4_A 387 Acyl-COA dehydrogenase; seattle structural genomic 99.36
2pg0_A 385 Acyl-COA dehydrogenase; GK1316, geobacillus kausto 99.36
4hr3_A 415 Putative acyl-COA dehydrogenase; ssgcid, seattle s 99.36
1rx0_A 393 Acyl-COA dehydrogenase family member 8, mitochondr 99.35
1egd_A 396 Medium chain acyl-COA dehydrogenase; flavoprotein, 99.34
3sf6_A 403 Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SB 99.33
1ivh_A 394 Isovaleryl-COA dehydrogenase; oxidoreductase, acyl 99.33
2ix5_A 436 Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, 99.32
1buc_A 383 Butyryl-COA dehydrogenase; acyl-COA dehydrogenase 99.31
3swo_A 399 Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA d 99.3
2z1q_A 577 Acyl-COA dehydrogenase; FAD, structural genomics, 99.29
3mpi_A 397 Glutaryl-COA dehydrogenase; alpha-beta fold, oxido 99.28
3owa_A 597 Acyl-COA dehydrogenase; structural genomics, cente 99.26
2uxw_A 607 VERY-long-chain specific acyl-COA dehydrogenase; f 99.21
2c12_A 439 Nitroalkane oxidase; oxidoreductase, flavoenzyme, 99.19
3mkh_A 438 Nitroalkane oxidase; oxidoreductase flavoenzyme, a 99.15
1siq_A 392 GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrog 99.15
3mxl_A 395 Nitrososynthase; flavin monooxygenase, acyl-COA de 99.13
3m9v_A 439 FAD-dependent oxidoreductase; KIJD3, fatty acyl-CO 99.04
2wbi_A 428 Acyl-COA dehydrogenase family member 11; human, ph 99.03
1w07_A 659 Acyl-COA oxidase; oxidoreductase, peroxisomal beta 99.01
2jbr_A 422 P-hydroxyphenylacetate hydroxylase C2 oxygenase C; 98.98
2or0_A 414 Hydroxylase; APC7385, rhodococcus SP. RHA1, struct 98.96
2rfq_A 394 3-HSA hydroxylase, oxygenase; rhodococcus SP. RHA1 98.95
2ddh_A 661 Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundl 98.68
1u8v_A 490 Gamma-aminobutyrate metabolism dehydratase/isomera 98.26
3djl_A 541 Protein AIDB; alpha helix, beta-barrel, FAD, flavo 98.02
2yyk_A 481 4-hydroxyphenylacetate-3-hydroxylase; structurome, 97.65
3hwc_A 515 Chlorophenol-4-monooxygenase component 2; beta bar 97.62
1w07_A 659 Acyl-COA oxidase; oxidoreductase, peroxisomal beta 97.52
1u8v_A 490 Gamma-aminobutyrate metabolism dehydratase/isomera 96.51
2ddh_A 661 Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundl 95.76
2yyk_A 481 4-hydroxyphenylacetate-3-hydroxylase; structurome, 95.36
3hwc_A 515 Chlorophenol-4-monooxygenase component 2; beta bar 94.82
>1r2j_A Protein FKBI; polyketide synthase, polyketide, acyl-COA dehydrogenase, , aldehyde dehydrogenase, oxidoreductase; HET: FAD; 2.10A {Streptomyces hygroscopicus} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
Probab=99.88  E-value=4.3e-26  Score=182.92  Aligned_cols=197  Identities=21%  Similarity=0.281  Sum_probs=149.9

Q ss_pred             CccccccCCCCCCCCCCCHHHHHHHHHHHHccCCChhHHHHHHHhhHHHHHHhcCChhHHHHHHHHHHhCCceeeecCCC
Q psy5139           2 TTLLGVEIPQEYGGPGLSFMTDILIVEEIARVDPSVSILVDIQNTLVNDLIIKLGTTEQKEKYLPRLAQTDLMGVEIPQE   81 (216)
Q Consensus         2 ~G~~~~~~p~~~GG~g~~~~~~~~~~ee~~~~~~~~~~~~~~~~~~~~~~l~~~g~~~~~~~~l~~l~~g~~~~~~~~e~   81 (216)
                      .||+++.+|++|||.|+++.+...+.||+++.+.++++.+..|..++...|. +++++|+++|+|++.+|++.+++++||
T Consensus        36 ~Gl~~~~~P~~~GG~g~~~~~~~~v~eel~~~~~~~~~~~~~~~~~~~~~l~-~g~~~q~~~~l~~~~~G~~~~~a~tEp  114 (366)
T 1r2j_A           36 DGLLCAEVAAEHGGLGLGSRENGEFTAHVGSLCSSLRSVMTSQGMAAWTVQR-LGDAGQRATFLKELTSGKLAAVGFSER  114 (366)
T ss_dssp             TTTTSTTSCGGGTCCCCCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHH-HSCHHHHHHHHHHTTCC-CEEEECCBT
T ss_pred             CCCCCCCCChhhCCCCCCHHHHHHHHHHHHHHChHHHHHHHHHHHHHHHHHH-hCCHHHHHHHHHHHhCCCeeEEEeCCC
Confidence            5999999999999999999999999999999999887766555445666778 999999999999999999557899999


Q ss_pred             CCCCCccHH-------------------------HHHHHHHHHHhhCC-Cce-eEeeechh-h-hHHHHHhcCCH--HHh
Q psy5139          82 YGGPGLSFM-------------------------TDILIVEEIARVDP-SVS-ILVDIQNT-L-VNDLIIKLGTT--EQK  130 (216)
Q Consensus        82 ~gG~~~~~~-------------------------~~~~v~e~lar~~~-~~~-~~v~~~~~-~-~~~~~~~~g~~--~~~  130 (216)
                      .+|+|...+                         .+.+++  +++++. +++ |+|+.+.+ + ......++|.+  ...
T Consensus       115 ~~Gsd~~~~~t~A~~~~~g~~lnG~K~~~s~~~~Ad~~~v--~a~~~~~g~~~flV~~~~~Gv~~~~~~~~~G~r~~~~~  192 (366)
T 1r2j_A          115 QAGSDLSAMRTRVRLDGDTAVVDGHKVWTTAAAYADHLVV--FGLQEDGSGAVVVVPADTPGVRVERVPKPSGCRAAGHA  192 (366)
T ss_dssp             TBSSCGGGCCCEEEEETTEEEEEEEEEEETTTTTCSEEEE--EEBCSSSCCEEEEEETTSTTEEEEECSSCSSSTTSCCE
T ss_pred             CCCCchhhCEeEEEEeCCEEEEEEEEecccCCcccCEEEE--EEEeCCCceEEEEEECCCCCeEecCCcCCccCCCCCee
Confidence            999885321                         133344  666653 443 77876542 2 22222445633  456


Q ss_pred             hhhchhc---ccccccccccchhhh-hhhhccccCCceeeccceeeeecCcccCCCcceeeeeec---------ccccee
Q psy5139         131 EKYLPRL---AQTDVSRTSRGYKAL-EWHAFYGRTDSLPLNDHLSHISSGCVGFDGQLKRWMVSC---------GLSLQI  197 (216)
Q Consensus       131 ~~~l~~~---~~~~lg~~~~g~~~~-~~~~~~~~~~~~~l~g~k~~va~~~~g~~~~~~~~~~~~---------~fg~~i  197 (216)
                      +.+|+++   .++.++.++.|+... ...+...|          ..+++..+|.    ++.+++.         +||+||
T Consensus       193 ~v~f~~v~Vp~~~~lg~~~~g~~~~~~~~l~~~r----------~~~aa~~~G~----a~~al~~a~~ya~~R~~fg~~i  258 (366)
T 1r2j_A          193 DLHLDQVRVPAGAVLAGSGASLPMLVAASLAYGR----------KSVAWGCVGI----LRACRTAAVAHARTREQFGRPL  258 (366)
T ss_dssp             EEEEEEEEEEGGGBCTTTTSCTTTTTHHHHHHHH----------HHHHHHHHHH----HHHHHHHHHHHHTTCEETTEEG
T ss_pred             EEEEeeEEEcHHHcCCCCCccHHHHHHHHhhHHH----------HHHHHHHHHH----HHHHHHHHHHHHhcCccCCCch
Confidence            6788875   467888888888877 66666666          8888888888    6666543         499999


Q ss_pred             eeeeccc---ccccccccccC
Q psy5139         198 LQFQNLS---SDMHMTGLASR  215 (216)
Q Consensus       198 ~~~Q~v~---ad~~~~~~~~r  215 (216)
                      ++||.||   +||.++++++|
T Consensus       259 ~~~q~v~~~la~~~~~~~~ar  279 (366)
T 1r2j_A          259 GDHQLVAGHIADLWTAEQIAA  279 (366)
T ss_dssp             GGSHHHHHHHHHHHHHHHHHH
T ss_pred             hhhHHHHHHHHHHHHHHHHHH
Confidence            9999999   99999999876



>2jif_A Short/branched chain specific acyl-COA dehydrogen; mitochondrion, oxidoreductase, transit peptide, fatty acid metabolism, FAD, flavoprotein; HET: FAD COS; 2.0A {Homo sapiens} Back     alignment and structure
>2dvl_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project on protein STR and functional analyses; HET: FAD; 2.50A {Thermus thermophilus} Back     alignment and structure
>3p4t_A Putative acyl-COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FAO; 1.70A {Mycobacterium smegmatis} PDB: 3oib_A* Back     alignment and structure
>3pfd_A Acyl-COA dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: FDA; 2.10A {Mycobacterium thermoresistibile} Back     alignment and structure
>2d29_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; HET: FAD; 1.65A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 PDB: 1ws9_A 2cx9_A* Back     alignment and structure
>1rx0_A Acyl-COA dehydrogenase family member 8, mitochondrial; flavoprotein, coenzyme A, oxidoreductase; HET: FAD 2MC; 1.77A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>3r7k_A Probable acyl COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FDA; 2.50A {Mycobacterium abscessus} Back     alignment and structure
>1ivh_A Isovaleryl-COA dehydrogenase; oxidoreductase, acyl-COA dehydrogenase, flavoprotein, isovaleric acidemia; HET: FAD COS; 2.60A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>3nf4_A Acyl-COA dehydrogenase; seattle structural genomics center for infectious disease, S FAD, FADH, tuberculosis, oxidoredu; HET: FAD; 2.35A {Mycobacterium thermoresistibile} Back     alignment and structure
>3owa_A Acyl-COA dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-structure, beta-barrel; HET: MSE FAD 1PE; 1.97A {Bacillus anthracis} Back     alignment and structure
>1ukw_A Acyl-COA dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: FAD; 2.40A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>2pg0_A Acyl-COA dehydrogenase; GK1316, geobacillus kaustophilus HTA structural genomics, PSI, protein structure initiative; HET: FAD; 1.80A {Geobacillus kaustophilus} Back     alignment and structure
>1egd_A Medium chain acyl-COA dehydrogenase; flavoprotein, electron transfer; HET: FAD; 2.40A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 1egc_A* 1ege_A* 1t9g_A* 2a1t_A* 1udy_A* 3mdd_A* 3mde_A* Back     alignment and structure
>3sf6_A Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; HET: FDA; 1.70A {Mycobacterium smegmatis} Back     alignment and structure
>2vig_A Short-chain specific acyl-COA dehydrogenase,; fatty acid metabolism, FAD, polymorphism, flavoprotein, mitochondrion, disease mutation; HET: FAD COS; 1.9A {Homo sapiens} PDB: 1jqi_A* Back     alignment and structure
>2eba_A Putative glutaryl-COA dehydrogenase; thermus thermophilius, FAD, STRU genomics, NPPSFA; HET: FAD; 2.21A {Thermus thermophilus} Back     alignment and structure
>3swo_A Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA dehdrogenase, mycobacerium smegmatis, S genomics; HET: FDA; 1.45A {Mycobacterium smegmatis} Back     alignment and structure
>2z1q_A Acyl-COA dehydrogenase; FAD, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: FAD; 2.30A {Thermus thermophilus} Back     alignment and structure
>1buc_A Butyryl-COA dehydrogenase; acyl-COA dehydrogenase short-chain acyl-COA dehydrogenase, flavoprotein, oxidoreductase; HET: CAA FAD; 2.50A {Megasphaera elsdenii} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>2ix5_A Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, flavin, peroxisome, glyoxysome, fatty acid metabo lipid metabolism, acyl-COA oxidase; HET: CAA FAD; 2.7A {Arabidopsis thaliana} PDB: 2ix6_A* Back     alignment and structure
>2uxw_A VERY-long-chain specific acyl-COA dehydrogenase; fatty acid metabolism, transit peptide, disease mutation, LI metabolism, coenzyme A dehydrogenase; HET: FAD TH3; 1.45A {Homo sapiens} PDB: 3b96_A* Back     alignment and structure
>3ii9_A Glutaryl-COA dehydrogenase; slipchip, microfluidics, screening, optimization, protein crystallization, structural genomics; HET: PGE PG4; 1.74A {Burkholderia pseudomallei 1710B} PDB: 3eon_A* 3eom_A* 3gqt_A* 3gnc_A* 3d6b_A Back     alignment and structure
>4hr3_A Putative acyl-COA dehydrogenase; ssgcid, seattle structural genomics center for infectious DI niaid; HET: FAD; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>3mpi_A Glutaryl-COA dehydrogenase; alpha-beta fold, oxidoreductase; HET: FAD GRA; 2.05A {Desulfococcus multivorans} PDB: 3mpj_A* Back     alignment and structure
>1siq_A GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrogenase, decarboxylation, flavin protein, oxidoreductase; HET: FAD; 2.10A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 2r0n_A* 1sir_A* 2r0m_A* Back     alignment and structure
>3mkh_A Nitroalkane oxidase; oxidoreductase flavoenzyme, acyl-COA dehydrogen flavoprotein, oxidoreductase; HET: FAD; 2.00A {Podospora anserina} Back     alignment and structure
>2c12_A Nitroalkane oxidase; oxidoreductase, flavoenzyme, acyl-COA dehydrogenase, long cell EDGE, FAD, inhibitor, flavoprotein; HET: SPM FAD PE4; 2.07A {Fusarium oxysporum} SCOP: a.29.3.1 e.6.1.1 PDB: 2c0u_A* 2zaf_A* 2reh_A* 3d9g_A* 3d9f_A* 3d9d_A* 3d9e_A* 3fcj_A* Back     alignment and structure
>3mxl_A Nitrososynthase; flavin monooxygenase, acyl-COA dehydrogenas oxidoreductase; 3.15A {Micromonospora carbonacea} Back     alignment and structure
>2wbi_A Acyl-COA dehydrogenase family member 11; human, phosphoprotein, oxidoreducta; HET: FAD; 2.80A {Homo sapiens} Back     alignment and structure
>3m9v_A FAD-dependent oxidoreductase; KIJD3, fatty acyl-COA dehydrogenase family, kijanose, kijani FAD, flavoprotein; HET: TYD; 2.05A {Actinomadura kijaniata} Back     alignment and structure
>2jbr_A P-hydroxyphenylacetate hydroxylase C2 oxygenase C; flavoenzyme hydroxylase, oxidoreductase; 2.3A {Acinetobacter baumannii} PDB: 2jbs_A* 2jbt_A* Back     alignment and structure
>2rfq_A 3-HSA hydroxylase, oxygenase; rhodococcus SP. RHA1, structural genomics protein structure initiative, midwest center for structural genomics, MCSG; HET: 1PS; 1.65A {Rhodococcus SP} PDB: 3aff_A 3afe_A Back     alignment and structure
>2or0_A Hydroxylase; APC7385, rhodococcus SP. RHA1, structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 2.10A {Rhodococcus SP} Back     alignment and structure
>3djl_A Protein AIDB; alpha helix, beta-barrel, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.70A {Escherichia coli} PDB: 3u33_A* Back     alignment and structure
>2jif_A Short/branched chain specific acyl-COA dehydrogen; mitochondrion, oxidoreductase, transit peptide, fatty acid metabolism, FAD, flavoprotein; HET: FAD COS; 2.0A {Homo sapiens} Back     alignment and structure
>2d29_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; HET: FAD; 1.65A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 PDB: 1ws9_A 2cx9_A* Back     alignment and structure
>3p4t_A Putative acyl-COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FAO; 1.70A {Mycobacterium smegmatis} PDB: 3oib_A* Back     alignment and structure
>2dvl_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project on protein STR and functional analyses; HET: FAD; 2.50A {Thermus thermophilus} Back     alignment and structure
>1ukw_A Acyl-COA dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: FAD; 2.40A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>3ii9_A Glutaryl-COA dehydrogenase; slipchip, microfluidics, screening, optimization, protein crystallization, structural genomics; HET: PGE PG4; 1.74A {Burkholderia pseudomallei 1710B} PDB: 3eon_A* 3eom_A* 3gqt_A* 3gnc_A* 3d6b_A Back     alignment and structure
>2vig_A Short-chain specific acyl-COA dehydrogenase,; fatty acid metabolism, FAD, polymorphism, flavoprotein, mitochondrion, disease mutation; HET: FAD COS; 1.9A {Homo sapiens} PDB: 1jqi_A* Back     alignment and structure
>3pfd_A Acyl-COA dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: FDA; 2.10A {Mycobacterium thermoresistibile} Back     alignment and structure
>2eba_A Putative glutaryl-COA dehydrogenase; thermus thermophilius, FAD, STRU genomics, NPPSFA; HET: FAD; 2.21A {Thermus thermophilus} Back     alignment and structure
>1r2j_A Protein FKBI; polyketide synthase, polyketide, acyl-COA dehydrogenase, , aldehyde dehydrogenase, oxidoreductase; HET: FAD; 2.10A {Streptomyces hygroscopicus} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>3r7k_A Probable acyl COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FDA; 2.50A {Mycobacterium abscessus} Back     alignment and structure
>3nf4_A Acyl-COA dehydrogenase; seattle structural genomics center for infectious disease, S FAD, FADH, tuberculosis, oxidoredu; HET: FAD; 2.35A {Mycobacterium thermoresistibile} Back     alignment and structure
>2pg0_A Acyl-COA dehydrogenase; GK1316, geobacillus kaustophilus HTA structural genomics, PSI, protein structure initiative; HET: FAD; 1.80A {Geobacillus kaustophilus} Back     alignment and structure
>4hr3_A Putative acyl-COA dehydrogenase; ssgcid, seattle structural genomics center for infectious DI niaid; HET: FAD; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>1rx0_A Acyl-COA dehydrogenase family member 8, mitochondrial; flavoprotein, coenzyme A, oxidoreductase; HET: FAD 2MC; 1.77A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>1egd_A Medium chain acyl-COA dehydrogenase; flavoprotein, electron transfer; HET: FAD; 2.40A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 1egc_A* 1ege_A* 1t9g_A* 2a1t_A* 1udy_A* 3mdd_A* 3mde_A* Back     alignment and structure
>3sf6_A Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; HET: FDA; 1.70A {Mycobacterium smegmatis} Back     alignment and structure
>1ivh_A Isovaleryl-COA dehydrogenase; oxidoreductase, acyl-COA dehydrogenase, flavoprotein, isovaleric acidemia; HET: FAD COS; 2.60A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>2ix5_A Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, flavin, peroxisome, glyoxysome, fatty acid metabo lipid metabolism, acyl-COA oxidase; HET: CAA FAD; 2.7A {Arabidopsis thaliana} PDB: 2ix6_A* Back     alignment and structure
>1buc_A Butyryl-COA dehydrogenase; acyl-COA dehydrogenase short-chain acyl-COA dehydrogenase, flavoprotein, oxidoreductase; HET: CAA FAD; 2.50A {Megasphaera elsdenii} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>3swo_A Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA dehdrogenase, mycobacerium smegmatis, S genomics; HET: FDA; 1.45A {Mycobacterium smegmatis} Back     alignment and structure
>2z1q_A Acyl-COA dehydrogenase; FAD, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: FAD; 2.30A {Thermus thermophilus} Back     alignment and structure
>3mpi_A Glutaryl-COA dehydrogenase; alpha-beta fold, oxidoreductase; HET: FAD GRA; 2.05A {Desulfococcus multivorans} PDB: 3mpj_A* Back     alignment and structure
>3owa_A Acyl-COA dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-structure, beta-barrel; HET: MSE FAD 1PE; 1.97A {Bacillus anthracis} Back     alignment and structure
>2uxw_A VERY-long-chain specific acyl-COA dehydrogenase; fatty acid metabolism, transit peptide, disease mutation, LI metabolism, coenzyme A dehydrogenase; HET: FAD TH3; 1.45A {Homo sapiens} PDB: 3b96_A* Back     alignment and structure
>2c12_A Nitroalkane oxidase; oxidoreductase, flavoenzyme, acyl-COA dehydrogenase, long cell EDGE, FAD, inhibitor, flavoprotein; HET: SPM FAD PE4; 2.07A {Fusarium oxysporum} SCOP: a.29.3.1 e.6.1.1 PDB: 2c0u_A* 2zaf_A* 2reh_A* 3d9g_A* 3d9f_A* 3d9d_A* 3d9e_A* 3fcj_A* Back     alignment and structure
>3mkh_A Nitroalkane oxidase; oxidoreductase flavoenzyme, acyl-COA dehydrogen flavoprotein, oxidoreductase; HET: FAD; 2.00A {Podospora anserina} Back     alignment and structure
>1siq_A GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrogenase, decarboxylation, flavin protein, oxidoreductase; HET: FAD; 2.10A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 2r0n_A* 1sir_A* 2r0m_A* Back     alignment and structure
>3mxl_A Nitrososynthase; flavin monooxygenase, acyl-COA dehydrogenas oxidoreductase; 3.15A {Micromonospora carbonacea} Back     alignment and structure
>3m9v_A FAD-dependent oxidoreductase; KIJD3, fatty acyl-COA dehydrogenase family, kijanose, kijani FAD, flavoprotein; HET: TYD; 2.05A {Actinomadura kijaniata} Back     alignment and structure
>2wbi_A Acyl-COA dehydrogenase family member 11; human, phosphoprotein, oxidoreducta; HET: FAD; 2.80A {Homo sapiens} Back     alignment and structure
>1w07_A Acyl-COA oxidase; oxidoreductase, peroxisomal beta-oxidation, FAD cofactor; HET: FAD; 2.0A {Arabidopsis thaliana} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 2fon_A* Back     alignment and structure
>2jbr_A P-hydroxyphenylacetate hydroxylase C2 oxygenase C; flavoenzyme hydroxylase, oxidoreductase; 2.3A {Acinetobacter baumannii} PDB: 2jbs_A* 2jbt_A* Back     alignment and structure
>2or0_A Hydroxylase; APC7385, rhodococcus SP. RHA1, structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 2.10A {Rhodococcus SP} Back     alignment and structure
>2rfq_A 3-HSA hydroxylase, oxygenase; rhodococcus SP. RHA1, structural genomics protein structure initiative, midwest center for structural genomics, MCSG; HET: 1PS; 1.65A {Rhodococcus SP} PDB: 3aff_A 3afe_A Back     alignment and structure
>2ddh_A Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundle, oxidoreductase; HET: FAD HXD; 2.07A {Rattus norvegicus} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 1is2_A* Back     alignment and structure
>1u8v_A Gamma-aminobutyrate metabolism dehydratase/isomerase; ALFA-helixes, beta-strands, lyase; HET: FAD; 1.60A {Clostridium aminobutyricum} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>3djl_A Protein AIDB; alpha helix, beta-barrel, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.70A {Escherichia coli} PDB: 3u33_A* Back     alignment and structure
>2yyk_A 4-hydroxyphenylacetate-3-hydroxylase; structurome, riken spring-8 center, oxygnase component, 4- hydroxyphenylacetate 3-monooxygenase; 1.60A {Thermus thermophilus} PDB: 2yyl_A* 2yym_A* 2yyi_A* 2yyg_A* 2yyj_A* Back     alignment and structure
>3hwc_A Chlorophenol-4-monooxygenase component 2; beta barrel, helix bundle, oxidoreductase; 2.50A {Burkholderia cepacia} Back     alignment and structure
>1w07_A Acyl-COA oxidase; oxidoreductase, peroxisomal beta-oxidation, FAD cofactor; HET: FAD; 2.0A {Arabidopsis thaliana} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 2fon_A* Back     alignment and structure
>1u8v_A Gamma-aminobutyrate metabolism dehydratase/isomerase; ALFA-helixes, beta-strands, lyase; HET: FAD; 1.60A {Clostridium aminobutyricum} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>2ddh_A Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundle, oxidoreductase; HET: FAD HXD; 2.07A {Rattus norvegicus} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 1is2_A* Back     alignment and structure
>2yyk_A 4-hydroxyphenylacetate-3-hydroxylase; structurome, riken spring-8 center, oxygnase component, 4- hydroxyphenylacetate 3-monooxygenase; 1.60A {Thermus thermophilus} PDB: 2yyl_A* 2yym_A* 2yyi_A* 2yyg_A* 2yyj_A* Back     alignment and structure
>3hwc_A Chlorophenol-4-monooxygenase component 2; beta barrel, helix bundle, oxidoreductase; 2.50A {Burkholderia cepacia} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 216
d1ivha2236 e.6.1.1 (A:6-241) Isovaleryl-coa dehydrogenase, NM 1e-04
d1ivha2236 e.6.1.1 (A:6-241) Isovaleryl-coa dehydrogenase, NM 1e-04
>d1ivha2 e.6.1.1 (A:6-241) Isovaleryl-coa dehydrogenase, NM domains {Human (Homo sapiens) [TaxId: 9606]} Length = 236 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: Acyl-CoA dehydrogenase NM domain-like
superfamily: Acyl-CoA dehydrogenase NM domain-like
family: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains
domain: Isovaleryl-coa dehydrogenase, NM domains
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 39.8 bits (92), Expect = 1e-04
 Identities = 24/83 (28%), Positives = 46/83 (55%)

Query: 56  GTTEQKEKYLPRLAQTDLMGVEIPQEYGGPGLSFMTDILIVEEIARVDPSVSILVDIQNT 115
              +   ++  +L    ++G+  P +YGG GL ++  +L++EEI+R   +V +     + 
Sbjct: 38  NEFKNLREFWKQLGNLGVLGITAPVQYGGSGLGYLEHVLVMEEISRASGAVGLSYGAHSN 97

Query: 116 LVNDLIIKLGTTEQKEKYLPRLA 138
           L  + +++ G   QKEKYLP+L 
Sbjct: 98  LCINQLVRNGNEAQKEKYLPKLI 120


>d1ivha2 e.6.1.1 (A:6-241) Isovaleryl-coa dehydrogenase, NM domains {Human (Homo sapiens) [TaxId: 9606]} Length = 236 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query216
d2c12a2259 Nitroalkane oxidase {Fusarium oxysporum [TaxId: 55 99.66
d1ivha2236 Isovaleryl-coa dehydrogenase, NM domains {Human (H 99.66
d2d29a2233 Acyl-CoA dehydrogenase {Thermus thermophilus [TaxI 99.62
d3mdea2231 Medium chain acyl-CoA dehydrogenase, NM domains {P 99.59
d1jqia2231 Butyryl-CoA dehydrogenase, NM domains {Rat (Rattus 99.58
d1ukwa2227 Medium chain acyl-CoA dehydrogenase, NM domains {T 99.57
d1r2ja2210 Protein FkbI {Streptomyces hygroscopicus [TaxId: 1 99.51
d1siqa2236 Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapie 99.49
d1r2ja2210 Protein FkbI {Streptomyces hygroscopicus [TaxId: 1 99.49
d1rx0a2231 Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) 99.47
d1buca2232 Butyryl-CoA dehydrogenase, NM domains {Megasphaera 99.19
d2c12a2259 Nitroalkane oxidase {Fusarium oxysporum [TaxId: 55 98.4
d2d29a2233 Acyl-CoA dehydrogenase {Thermus thermophilus [TaxI 98.27
d1ivha2236 Isovaleryl-coa dehydrogenase, NM domains {Human (H 98.23
d1jqia2231 Butyryl-CoA dehydrogenase, NM domains {Rat (Rattus 98.06
d1ukwa2227 Medium chain acyl-CoA dehydrogenase, NM domains {T 97.98
d2ddha3267 Peroxisomal acyl-CoA oxidase-II, domains 1 and 2 { 97.97
d1w07a3271 Acyl-coenzyme A oxidase 1, domains 1 and 2 {Thale 97.9
d3mdea2231 Medium chain acyl-CoA dehydrogenase, NM domains {P 97.89
d1ivha1151 Isovaleryl-CoA dehydrogenase, C-domain {Human (Hom 97.63
d2d29a1153 Acyl-CoA dehydrogenase {Thermus thermophilus [TaxI 97.57
d1siqa1154 Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapie 97.55
d2ddha3267 Peroxisomal acyl-CoA oxidase-II, domains 1 and 2 { 97.55
d1jqia1153 Butyryl-CoA dehydrogenase, C-domain {Rat (Rattus n 97.53
d1rx0a2231 Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) 97.49
d3mdea1154 Medium chain acyl-CoA dehydrogenase, C-domain {Pig 97.37
d1siqa2236 Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapie 97.37
d1w07a3271 Acyl-coenzyme A oxidase 1, domains 1 and 2 {Thale 97.28
d2c12a1170 Nitroalkane oxidase {Fusarium oxysporum [TaxId: 55 97.19
d1ukwa1152 Medium chain acyl-CoA dehydrogenase, C-domain {The 97.18
d1rx0a1153 Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) 97.05
d1buca1151 Butyryl-CoA dehydrogenase, C-domain {Megasphaera e 97.03
d1r2ja1153 Protein FkbI {Streptomyces hygroscopicus [TaxId: 1 96.86
d1u8va2275 4-hydroxybutyryl-CoA dehydratase AbfD, NM domains 96.53
d1buca2232 Butyryl-CoA dehydrogenase, NM domains {Megasphaera 95.59
d1w07a1 189 Acyl-coenzyme A oxidase 1, domains 3 and 4 {Thale 87.49
>d2c12a2 e.6.1.1 (A:2-260) Nitroalkane oxidase {Fusarium oxysporum [TaxId: 5507]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: Acyl-CoA dehydrogenase NM domain-like
superfamily: Acyl-CoA dehydrogenase NM domain-like
family: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains
domain: Nitroalkane oxidase
species: Fusarium oxysporum [TaxId: 5507]
Probab=99.66  E-value=2.7e-16  Score=118.26  Aligned_cols=85  Identities=21%  Similarity=0.308  Sum_probs=74.4

Q ss_pred             CccccccCCCCCCCCCCCHHHHHHHHHHHHccCCChhHHHHHHHhhHHHHHHhcCChhHHHHHHHHHHh--CCc-eeeec
Q psy5139           2 TTLLGVEIPQEYGGPGLSFMTDILIVEEIARVDPSVSILVDIQNTLVNDLIIKLGTTEQKEKYLPRLAQ--TDL-MGVEI   78 (216)
Q Consensus         2 ~G~~~~~~p~~~GG~g~~~~~~~~~~ee~~~~~~~~~~~~~~~~~~~~~~l~~~g~~~~~~~~l~~l~~--g~~-~~~~~   78 (216)
                      .||+++.+|++|||.|++..+.+++.||+++.+.+++..+..+. +....+..+++++|+++|++++.+  +.+ .++++
T Consensus        54 ~G~~~~~vPee~GG~g~~~~~~~~~~eel~~~~~~~~~~~~~~~-~~~~~i~~~g~~eq~~~~l~~~~~~~g~~~~a~a~  132 (259)
T d2c12a2          54 HGLIKAQVPIPLGGTMESLVHESIILEELFAVEPATSITIVATA-LGLMPVILCDSPSLQEKFLKPFISGEGEPLASLMH  132 (259)
T ss_dssp             TTTTGGGSBGGGTCCBCCHHHHHHHHHHHHTTCCTTHHHHHHHH-HHHHHHHHSSCHHHHHHHTGGGGSSCSCCCEEEEC
T ss_pred             cCCCCcCCChHHhhccchhhhhhhhhhhcccccccccccccccc-chHHHHHHhhhccccccccccccccceeeeeeccc
Confidence            59999999999999999999999999999999999877665543 677778899999999999999986  455 47899


Q ss_pred             CCCCCCCCc
Q psy5139          79 PQEYGGPGL   87 (216)
Q Consensus        79 ~e~~gG~~~   87 (216)
                      +||.+|+|.
T Consensus       133 TEp~~Gsd~  141 (259)
T d2c12a2         133 SEPNGTANW  141 (259)
T ss_dssp             CCTTCSTTT
T ss_pred             cCCcccccc
Confidence            999999874



>d1ivha2 e.6.1.1 (A:6-241) Isovaleryl-coa dehydrogenase, NM domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d29a2 e.6.1.1 (A:2-234) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3mdea2 e.6.1.1 (A:11-241) Medium chain acyl-CoA dehydrogenase, NM domains {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jqia2 e.6.1.1 (A:4-234) Butyryl-CoA dehydrogenase, NM domains {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ukwa2 e.6.1.1 (A:32-258) Medium chain acyl-CoA dehydrogenase, NM domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r2ja2 e.6.1.1 (A:3-212) Protein FkbI {Streptomyces hygroscopicus [TaxId: 1912]} Back     information, alignment and structure
>d1siqa2 e.6.1.1 (A:3-238) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2ja2 e.6.1.1 (A:3-212) Protein FkbI {Streptomyces hygroscopicus [TaxId: 1912]} Back     information, alignment and structure
>d1rx0a2 e.6.1.1 (A:10-240) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1buca2 e.6.1.1 (A:1-232) Butyryl-CoA dehydrogenase, NM domains {Megasphaera elsdenii [TaxId: 907]} Back     information, alignment and structure
>d2c12a2 e.6.1.1 (A:2-260) Nitroalkane oxidase {Fusarium oxysporum [TaxId: 5507]} Back     information, alignment and structure
>d2d29a2 e.6.1.1 (A:2-234) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ivha2 e.6.1.1 (A:6-241) Isovaleryl-coa dehydrogenase, NM domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqia2 e.6.1.1 (A:4-234) Butyryl-CoA dehydrogenase, NM domains {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ukwa2 e.6.1.1 (A:32-258) Medium chain acyl-CoA dehydrogenase, NM domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ddha3 e.6.1.2 (A:1-267) Peroxisomal acyl-CoA oxidase-II, domains 1 and 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w07a3 e.6.1.2 (A:2-272) Acyl-coenzyme A oxidase 1, domains 1 and 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3mdea2 e.6.1.1 (A:11-241) Medium chain acyl-CoA dehydrogenase, NM domains {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ivha1 a.29.3.1 (A:242-392) Isovaleryl-CoA dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d29a1 a.29.3.1 (A:235-387) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1siqa1 a.29.3.1 (A:239-392) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ddha3 e.6.1.2 (A:1-267) Peroxisomal acyl-CoA oxidase-II, domains 1 and 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jqia1 a.29.3.1 (A:235-387) Butyryl-CoA dehydrogenase, C-domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rx0a2 e.6.1.1 (A:10-240) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3mdea1 a.29.3.1 (A:242-395) Medium chain acyl-CoA dehydrogenase, C-domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1siqa2 e.6.1.1 (A:3-238) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w07a3 e.6.1.2 (A:2-272) Acyl-coenzyme A oxidase 1, domains 1 and 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c12a1 a.29.3.1 (A:261-430) Nitroalkane oxidase {Fusarium oxysporum [TaxId: 5507]} Back     information, alignment and structure
>d1ukwa1 a.29.3.1 (A:259-410) Medium chain acyl-CoA dehydrogenase, C-domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rx0a1 a.29.3.1 (A:241-393) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1buca1 a.29.3.1 (A:233-383) Butyryl-CoA dehydrogenase, C-domain {Megasphaera elsdenii [TaxId: 907]} Back     information, alignment and structure
>d1r2ja1 a.29.3.1 (A:213-365) Protein FkbI {Streptomyces hygroscopicus [TaxId: 1912]} Back     information, alignment and structure
>d1u8va2 e.6.1.1 (A:1-275) 4-hydroxybutyryl-CoA dehydratase AbfD, NM domains {Clostridium aminobutyricum [TaxId: 33953]} Back     information, alignment and structure
>d1buca2 e.6.1.1 (A:1-232) Butyryl-CoA dehydrogenase, NM domains {Megasphaera elsdenii [TaxId: 907]} Back     information, alignment and structure
>d1w07a1 a.29.3.2 (A:273-461) Acyl-coenzyme A oxidase 1, domains 3 and 4 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure