Psyllid ID: psy5435

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-----
MSFFSYFEDILILKRCRATQASVAEKSVNVPSTQVTSIDNGLRVATEDSGAPTATVGIWVDAGSRYETDANNGVAHFLEHMAFKTRENGFYFYYFSNASKGLGYAQYLPREQYLYSKEQLLDRMCMTLGGRVSEEIFFGRITTGAEDDLKKVTQSAYAQVAHFGMNEKVGKSESKLVDHREVLVQQVLALEGLDVLGRSQDGVAQRSALECGGVKVIEHDFLQVGFHFLHFTQDDATLTLDFGLT
cccccccHHHHHHHcccccHHHHHHHcccccccEEEEcccccEEEEccccccEEEEEEEcccccEEEEHHHHHHHHHHHHHHccccccccEEEEEEcccccccccccccccHHHccHHHHHHHHHHHccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHccc
ccHHHHHHHHHHHHHHHHHHccHHHHHHcccccEEEEcccccEEEEEEccccEEEEEEEEcccccccccccccHHHHHHHHHcccEccEEEEEEEcccHHccEEEEEccHHcccccHHHHHHHHHHHHccHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccccccccEEEcccccccEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHcccEEEEccccc
MSFFSYFEDILILKRCRATQAsvaeksvnvpstqvtsidnglrvatedsgaptatvgiwvdagsryetdanngVAHFLEHMafktrengFYFYYFSNaskglgyaqylpreqylySKEQLLDRMCMTLGGRVSEEIFFGrittgaeddlKKVTQSAYAQVAHFgmnekvgksesklvDHREVLVQQVLALEGLdvlgrsqdgvaQRSAlecggvkviehdflqvgfhflhftqddatltldfglt
MSFFSYFEDILILKRCRATQASvaeksvnvpstqvtsidnglrvatedsgaptaTVGIWVDAGSRYETDANNGVAHFLEHMAFKTRENGFYFYYFSNASKGLGYAQYLPREQYLYSKEQLLDRMCMTLGGRVSEEIFFGRITTGAEDDLKKVTQSAYAQVAHFGMNEKVGKSESKLVDHREVLVQQVLALEGLDVLGRSQDGVAQRSALECGGVKVIEHDFLQVGFHFLHFTQDDATLTLDFGLT
MSFFSYFEDILILKRCRATQASVAEKSVNVPSTQVTSIDNGLRVATEDSGAPTATVGIWVDAGSRYETDANNGVAHFLEHMAFKTRENGFYFYYFSNASKGLGYAQYLPREQYLYSKEQLLDRMCMTLGGRVSEEIFFGRITTGAEDDLKKVTQSAYAQVAHFGMNEKVGKSESKLVDHREVLVQQVLALEGLDVLGRSQDGVAQRSALECGGVKVIEHDFLQVGFHFLHFTQDDATLTLDFGLT
**FFSYFEDILILKRCRATQASVA************SIDNGLRVAT***GAPTATVGIWVDAGSRYETDANNGVAHFLEHMAFKTRENGFYFYYFSNASKGLGYAQYLPREQYLYSKEQLLDRMCMTLGGRVSEEIFFGRITTGAEDDLKKVTQSAYAQVAHFGMNEKVG***SKLVDHREVLVQQVLALEGLDVLGRSQDGVAQRSALECGGVKVIEHDFLQVGFHFLHFTQDDATLTLDF***
**************************SVNVPSTQVTSIDNGLRVATEDSGAPTATVGIWVDAGSRYETDANNGVAHFLEHMAFKTRENGFYFYYFSNASKGLGYAQYLPREQYLYSKEQLLDRMCMTLGGRVSEEIFFGRITTGAEDDLKKVTQSAYAQVAHFGMNEKVGKSESKLVDHREVLVQQVLALEGLDVLGRSQDGVAQRSALECGGVKVIEHDFLQVGFHFLHFTQDDATLTLDFGL*
MSFFSYFEDILILKRCRATQASVAEKSVNVPSTQVTSIDNGLRVATEDSGAPTATVGIWVDAGSRYETDANNGVAHFLEHMAFKTRENGFYFYYFSNASKGLGYAQYLPREQYLYSKEQLLDRMCMTLGGRVSEEIFFGRITTGAEDDLKKVTQSAYAQVAHFGMNEKVGKSESKLVDHREVLVQQVLALEGLDVLGRSQDGVAQRSALECGGVKVIEHDFLQVGFHFLHFTQDDATLTLDFGLT
*SFFSYFEDILILKRCRATQASVAEK*VNVPSTQVTSIDNGLRVATEDSGAPTATVGIWVDAGSRYETDANNGVAHFLEHMAFKTRENGFYFYYFSNASKGLGYAQYLPREQYLYSKEQLLDRMCMTLGGRVSEEIFFGRITTGAEDDLKKVTQSAYAQVAHFGMNEKVGKSESKLVDHREVLVQQVLALEGLDVLGRSQDGVAQRSALECGGVKVIEHDFLQVGFHFLHFTQDDATLTLDFGLT
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFFSYFEDILILKRCRATQASVAEKSVNVPSTQVTSIDNGLRVATEDSGAPTATVGIWVDAGSRYETDANNGVAHFLEHMAFKTRENGFYFYYFSNASKGLGYAQYLPREQYLYSKEQLLDRMCMTLGGRVSEEIFFGRITTGAEDDLKKVTQSAYAQVAHFGMNEKVGKSESKLVDHREVLVQQVLALEGLDVLGRSQDGVAQRSALECGGVKVIEHDFLQVGFHFLHFTQDDATLTLDFGLT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query245 2.2.26 [Sep-21-2011]
Q2KJI7805 AFG3-like protein 2 OS=Bo yes N/A 0.293 0.089 0.888 1e-33
Q8JZQ2802 AFG3-like protein 2 OS=Mu yes N/A 0.293 0.089 0.888 2e-33
Q9Y4W6797 AFG3-like protein 2 OS=Ho yes N/A 0.293 0.090 0.888 2e-33
Q920A7789 AFG3-like protein 1 OS=Mu no N/A 0.355 0.110 0.655 1e-29
D0MGU8697 ATP-dependent zinc metall yes N/A 0.285 0.100 0.642 2e-22
Q3SZ71 490 Mitochondrial-processing no N/A 0.412 0.206 0.524 4e-22
Q9CXT8 489 Mitochondrial-processing no N/A 0.408 0.204 0.519 1e-21
Q03346 489 Mitochondrial-processing no N/A 0.408 0.204 0.519 1e-21
Q5REK3 489 Mitochondrial-processing no N/A 0.432 0.216 0.491 5e-21
O75439 489 Mitochondrial-processing no N/A 0.412 0.206 0.504 6e-21
>sp|Q2KJI7|AFG32_BOVIN AFG3-like protein 2 OS=Bos taurus GN=AFG3L2 PE=2 SV=1 Back     alignment and function desciption
 Score =  143 bits (360), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 64/72 (88%), Positives = 70/72 (97%)

Query: 100 KGLGYAQYLPREQYLYSKEQLLDRMCMTLGGRVSEEIFFGRITTGAEDDLKKVTQSAYAQ 159
           KGLGYAQYLPREQYLY++EQLLDRMCMTLGGRVSEEIFFGRITTGA+DDL+KVTQSAYAQ
Sbjct: 602 KGLGYAQYLPREQYLYTREQLLDRMCMTLGGRVSEEIFFGRITTGAQDDLRKVTQSAYAQ 661

Query: 160 VAHFGMNEKVGK 171
           +  FGMNEKVG+
Sbjct: 662 IVQFGMNEKVGQ 673
Putative ATP-dependent protease.
Bos taurus (taxid: 9913)
EC: 3EC: .EC: 4EC: .EC: 2EC: 4EC: .EC: -
>sp|Q8JZQ2|AFG32_MOUSE AFG3-like protein 2 OS=Mus musculus GN=Afg3l2 PE=1 SV=1 Back     alignment and function description
>sp|Q9Y4W6|AFG32_HUMAN AFG3-like protein 2 OS=Homo sapiens GN=AFG3L2 PE=1 SV=2 Back     alignment and function description
>sp|Q920A7|AFG31_MOUSE AFG3-like protein 1 OS=Mus musculus GN=Afg3l1 PE=2 SV=2 Back     alignment and function description
>sp|D0MGU8|FTSH_RHOM4 ATP-dependent zinc metalloprotease FtsH OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) GN=ftsH PE=3 SV=1 Back     alignment and function description
>sp|Q3SZ71|MPPB_BOVIN Mitochondrial-processing peptidase subunit beta OS=Bos taurus GN=PMPCB PE=2 SV=1 Back     alignment and function description
>sp|Q9CXT8|MPPB_MOUSE Mitochondrial-processing peptidase subunit beta OS=Mus musculus GN=Pmpcb PE=2 SV=1 Back     alignment and function description
>sp|Q03346|MPPB_RAT Mitochondrial-processing peptidase subunit beta OS=Rattus norvegicus GN=Pmpcb PE=1 SV=3 Back     alignment and function description
>sp|Q5REK3|MPPB_PONAB Mitochondrial-processing peptidase subunit beta OS=Pongo abelii GN=PMPCB PE=2 SV=1 Back     alignment and function description
>sp|O75439|MPPB_HUMAN Mitochondrial-processing peptidase subunit beta OS=Homo sapiens GN=PMPCB PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query245
162287285 800 AFG3-like protein 2 [Danio rerio] gi|161 0.355 0.108 0.770 2e-32
395856224 952 PREDICTED: AFG3-like protein 2 [Otolemur 0.293 0.075 0.888 5e-32
432103515 817 AFG3-like protein 2 [Myotis davidii] 0.293 0.088 0.902 5e-32
357604266 477 hypothetical protein KGM_08960 [Danaus p 0.355 0.182 0.735 5e-32
344244614 506 AFG3-like protein 2 [Cricetulus griseus] 0.293 0.142 0.888 6e-32
440908828 752 AFG3-like protein 2, partial [Bos grunni 0.293 0.095 0.888 7e-32
114051125 805 AFG3-like protein 2 [Bos taurus] gi|1185 0.293 0.089 0.888 8e-32
410977326 994 PREDICTED: AFG3-like protein 2 [Felis ca 0.293 0.072 0.888 8e-32
426253763 805 PREDICTED: AFG3-like protein 2 [Ovis ari 0.293 0.089 0.888 8e-32
426385502 1006 PREDICTED: AFG3-like protein 2 [Gorilla 0.293 0.071 0.888 8e-32
>gi|162287285|ref|NP_001104667.1| AFG3-like protein 2 [Danio rerio] gi|161612073|gb|AAI55656.1| Si:ch211-12e1.4 protein [Danio rerio] Back     alignment and taxonomy information
 Score =  145 bits (365), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 77/87 (88%)

Query: 100 KGLGYAQYLPREQYLYSKEQLLDRMCMTLGGRVSEEIFFGRITTGAEDDLKKVTQSAYAQ 159
           KGLGYAQYLP+EQYLY+KEQLLDRMCMTLGGRVSEEIFFGRITTGA+DDLKKVTQSAYAQ
Sbjct: 596 KGLGYAQYLPKEQYLYTKEQLLDRMCMTLGGRVSEEIFFGRITTGAQDDLKKVTQSAYAQ 655

Query: 160 VAHFGMNEKVGKSESKLVDHREVLVQQ 186
           +  FGMNEKVG+    L    E+++++
Sbjct: 656 IVQFGMNEKVGQVSFDLPRQGELVLEK 682

Source: Danio rerio

Species: Danio rerio

Genus: Danio

Family: Cyprinidae

Order: Cypriniformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota
>gi|395856224|ref|XP_003800531.1| PREDICTED: AFG3-like protein 2 [Otolemur garnettii] Back     alignment and taxonomy information
>gi|432103515|gb|ELK30619.1| AFG3-like protein 2 [Myotis davidii] Back     alignment and taxonomy information
>gi|357604266|gb|EHJ64116.1| hypothetical protein KGM_08960 [Danaus plexippus] Back     alignment and taxonomy information
>gi|344244614|gb|EGW00718.1| AFG3-like protein 2 [Cricetulus griseus] Back     alignment and taxonomy information
>gi|440908828|gb|ELR58811.1| AFG3-like protein 2, partial [Bos grunniens mutus] Back     alignment and taxonomy information
>gi|114051125|ref|NP_001039676.1| AFG3-like protein 2 [Bos taurus] gi|118572819|sp|Q2KJI7.1|AFG32_BOVIN RecName: Full=AFG3-like protein 2 gi|86820707|gb|AAI05323.1| AFG3 ATPase family gene 3-like 2 (yeast) [Bos taurus] gi|296473687|tpg|DAA15802.1| TPA: AFG3-like protein 2 [Bos taurus] Back     alignment and taxonomy information
>gi|410977326|ref|XP_003995057.1| PREDICTED: AFG3-like protein 2 [Felis catus] Back     alignment and taxonomy information
>gi|426253763|ref|XP_004020561.1| PREDICTED: AFG3-like protein 2 [Ovis aries] Back     alignment and taxonomy information
>gi|426385502|ref|XP_004059249.1| PREDICTED: AFG3-like protein 2 [Gorilla gorilla gorilla] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query245
ZFIN|ZDB-GENE-070912-46800 afg3l2 "AFG3 ATPase family gen 0.355 0.108 0.770 4.6e-31
UNIPROTKB|F1N9N5635 AFG3L2 "Uncharacterized protei 0.355 0.137 0.747 1e-30
UNIPROTKB|Q9Y4W6797 AFG3L2 "AFG3-like protein 2" [ 0.355 0.109 0.747 2e-30
MGI|MGI:1916847802 Afg3l2 "AFG3(ATPase family gen 0.355 0.108 0.747 2e-30
UNIPROTKB|F1LN92802 Afg3l2 "Protein Afg3l2" [Rattu 0.355 0.108 0.747 2e-30
UNIPROTKB|E1BZ74805 AFG3L2 "Uncharacterized protei 0.355 0.108 0.747 2.1e-30
UNIPROTKB|Q2KJI7805 AFG3L2 "AFG3-like protein 2" [ 0.355 0.108 0.747 2.1e-30
UNIPROTKB|E2QYF3806 AFG3L2 "Uncharacterized protei 0.355 0.107 0.747 2.1e-30
WB|WBGene00004978782 spg-7 [Caenorhabditis elegans 0.289 0.090 0.859 2.1e-28
RGD|1309722761 Afg3l1 "AFG3(ATPase family gen 0.355 0.114 0.666 1.9e-27
ZFIN|ZDB-GENE-070912-46 afg3l2 "AFG3 ATPase family gene 3-like 2 (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 351 (128.6 bits), Expect = 4.6e-31, P = 4.6e-31
 Identities = 67/87 (77%), Positives = 77/87 (88%)

Query:   100 KGLGYAQYLPREQYLYSKEQLLDRMCMTLGGRVSEEIFFGRITTGAEDDLKKVTQSAYAQ 159
             KGLGYAQYLP+EQYLY+KEQLLDRMCMTLGGRVSEEIFFGRITTGA+DDLKKVTQSAYAQ
Sbjct:   596 KGLGYAQYLPKEQYLYTKEQLLDRMCMTLGGRVSEEIFFGRITTGAQDDLKKVTQSAYAQ 655

Query:   160 VAHFGMNEKVGKSESKLVDHREVLVQQ 186
             +  FGMNEKVG+    L    E+++++
Sbjct:   656 IVQFGMNEKVGQVSFDLPRQGELVLEK 682
GO:0000166 "nucleotide binding" evidence=IEA
GO:0004222 "metalloendopeptidase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0030163 "protein catabolic process" evidence=IEA
GO:0006508 "proteolysis" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
UNIPROTKB|F1N9N5 AFG3L2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y4W6 AFG3L2 "AFG3-like protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1916847 Afg3l2 "AFG3(ATPase family gene 3)-like 2 (yeast)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1LN92 Afg3l2 "Protein Afg3l2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BZ74 AFG3L2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KJI7 AFG3L2 "AFG3-like protein 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QYF3 AFG3L2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
WB|WBGene00004978 spg-7 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
RGD|1309722 Afg3l1 "AFG3(ATPase family gene 3)-like 1 (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.24LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query245
pfam01434212 pfam01434, Peptidase_M41, Peptidase family M41 5e-30
TIGR01241495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 1e-24
COG0465596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 9e-18
pfam00675149 pfam00675, Peptidase_M16, Insulinase (Peptidase fa 8e-17
COG0612 438 COG0612, PqqL, Predicted Zn-dependent peptidases [ 4e-15
CHL00176638 CHL00176, ftsH, cell division protein; Validated 7e-11
PRK10733644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 1e-06
COG1025 937 COG1025, Ptr, Secreted/periplasmic Zn-dependent pe 0.001
TIGR02110 696 TIGR02110, PQQ_syn_pqqF, coenzyme PQQ biosynthesis 0.001
>gnl|CDD|216502 pfam01434, Peptidase_M41, Peptidase family M41 Back     alignment and domain information 
 Score =  111 bits (279), Expect = 5e-30
 Identities = 36/72 (50%), Positives = 51/72 (70%), Gaps = 3/72 (4%)

Query: 102 LGYAQYLPRE-QYLYSKEQLLDRMCMTLGGRVSEEIFFG--RITTGAEDDLKKVTQSAYA 158
           LGY Q+LP E + LY+K QLL R+ + LGGR +EE+ FG   +TTGA +DL++ T+ A  
Sbjct: 63  LGYTQFLPEEDKLLYTKSQLLARIDVALGGRAAEELIFGDDEVTTGASNDLEQATKIARQ 122

Query: 159 QVAHFGMNEKVG 170
            V  FGM++K+G
Sbjct: 123 MVTEFGMSDKLG 134

Length = 212
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|216056 pfam00675, Peptidase_M16, Insulinase (Peptidase family M16) Back     alignment and domain information
>gnl|CDD|223685 COG0612, PqqL, Predicted Zn-dependent peptidases [General function prediction only] Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|223956 COG1025, Ptr, Secreted/periplasmic Zn-dependent peptidases, insulinase-like [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233732 TIGR02110, PQQ_syn_pqqF, coenzyme PQQ biosynthesis probable peptidase PqqF Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 245
KOG0734|consensus752 99.89
PF01434213 Peptidase_M41: Peptidase family M41 This is family 99.85
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 99.85
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 99.85
CHL00176638 ftsH cell division protein; Validated 99.84
KOG0731|consensus774 99.82
COG0612 438 PqqL Predicted Zn-dependent peptidases [General fu 99.78
TIGR02110 696 PQQ_syn_pqqF coenzyme PQQ biosynthesis probable pe 99.76
KOG0960|consensus 467 99.74
PRK15101 961 protease3; Provisional 99.72
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.69
KOG2067|consensus 472 99.6
COG1025 937 Ptr Secreted/periplasmic Zn-dependent peptidases, 99.34
KOG2583|consensus 429 99.3
KOG0959|consensus 974 99.23
PF00675149 Peptidase_M16: Insulinase (Peptidase family M16) T 99.16
PTZ00432 1119 falcilysin; Provisional 99.11
PRK15101 961 protease3; Provisional 98.02
CHL00206 2281 ycf2 Ycf2; Provisional 97.54
COG1026 978 Predicted Zn-dependent peptidases, insulinase-like 96.34
KOG0961|consensus 1022 93.94
PF03410 590 Peptidase_M44: Protein G1; InterPro: IPR005072 In 84.27
>KOG0734|consensus Back     alignment and domain information 
Probab=99.89  E-value=3e-23  Score=190.53  Aligned_cols=140  Identities=29%  Similarity=0.386  Sum_probs=123.6

Q ss_pred             EecccccccccccchhhhccccccccccccceeeeeeccccceeEEEEcCc-chhhchHHHHHHHHHHhhchhhHHHHHh
Q psy5435          60 VDAGSRYETDANNGVAHFLEHMAFKTRENGFYFYYFSNASKGLGYAQYLPR-EQYLYSKEQLLDRMCMTLGGRVSEEIFF  138 (245)
Q Consensus        60 ~~aGs~~E~~g~aGvAhll~~~~~~gt~~~~~~~tI~~rg~~lG~~~~~~~-e~~~~t~~~L~~~l~~~L~g~~aEel~~  138 (245)
                      -+.=.+||+.||+.||.++...++      ++|.||+|||.++|.+.+.|+ |...+|+.+++.++++.||||+|||++|
T Consensus       556 ak~~TAyHE~GHAivA~yTk~A~P------lhKaTImPRG~sLG~t~~LPe~D~~~~Tk~q~LA~lDV~MGGRvAEELIf  629 (752)
T KOG0734|consen  556 AKKITAYHEGGHAIVALYTKGAMP------LHKATIMPRGPSLGHTSQLPEKDRYSITKAQLLARLDVCMGGRVAEELIF  629 (752)
T ss_pred             hhhhhhhhccCceEEEeecCCCcc------ccceeeccCCccccceeecCccchhhHHHHHHHHHHHHhhcchHHHHHhc
Confidence            455678999999999999999999      999999999999999999998 9999999999999999999999999999


Q ss_pred             C--CCCCCChhHHHHHHHHHHHHHHHhCCCCcCcCcccccccCcchhhhhhhhhhhHHHhhccchHHHHHHHHhcccc
Q psy5435         139 G--RITTGAEDDLKKVTQSAYAQVAHFGMNEKVGKSESKLVDHREVLVQQVLALEGLDVLGRSQDGVAQRSALECGGV  214 (245)
Q Consensus       139 ~--~~~~g~~~DL~~at~~a~~~v~~~Gm~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~e~~~~~~~~~~~  214 (245)
                      |  ++++|+++||++||++|+.||+.|||++.+|++.+....+.     .+.+..+.+    .||.|+++++.++|++
T Consensus       630 G~D~iTsGAssDl~qAT~lA~~MVt~fGMSd~vG~v~~~~~~~~-----~s~~~~t~~----lidaEi~~lL~~sYeR  698 (752)
T KOG0734|consen  630 GTDKITSGASSDLDQATKLARRMVTKFGMSDKVGPVTLSAEDNS-----SSLSPRTQE----LIDAEIKRLLRDSYER  698 (752)
T ss_pred             cCCcccccccchHHHHHHHHHHHHHHcCccccccceeeeccCCC-----CCCCchhHH----HHHHHHHHHHHHHHHH
Confidence            8  69999999999999999999999999999999877533221     122333333    4599999999999995

>PF01434 Peptidase_M41: Peptidase family M41 This is family M41 in the peptidase classification Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>KOG0731|consensus Back     alignment and domain information
>COG0612 PqqL Predicted Zn-dependent peptidases [General function prediction only] Back     alignment and domain information
>TIGR02110 PQQ_syn_pqqF coenzyme PQQ biosynthesis probable peptidase PqqF Back     alignment and domain information
>KOG0960|consensus Back     alignment and domain information
>PRK15101 protease3; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>KOG2067|consensus Back     alignment and domain information
>COG1025 Ptr Secreted/periplasmic Zn-dependent peptidases, insulinase-like [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2583|consensus Back     alignment and domain information
>KOG0959|consensus Back     alignment and domain information
>PF00675 Peptidase_M16: Insulinase (Peptidase family M16) This is family M16 in the peptidase classification Back     alignment and domain information
>PTZ00432 falcilysin; Provisional Back     alignment and domain information
>PRK15101 protease3; Provisional Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>COG1026 Predicted Zn-dependent peptidases, insulinase-like [General function prediction only] Back     alignment and domain information
>KOG0961|consensus Back     alignment and domain information
>PF03410 Peptidase_M44: Protein G1; InterPro: IPR005072 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query245
1sqb_A 480 Crystal Structure Analysis Of Bovine Bc1 With Azoxy 4e-19
1bgy_A 446 Cytochrome Bc1 Complex From Bovine Length = 446 4e-19
1qcr_A 446 Crystal Structure Of Bovine Mitochondrial Cytochrom 4e-19
3cwb_A 446 Chicken Cytochrome Bc1 Complex Inhibited By An Iodi 5e-19
1bcc_A 446 Cytochrome Bc1 Complex From Chicken Length = 446 7e-19
2ce7_A476 Edta Treated Length = 476 3e-13
3kds_E465 Apo-ftsh Crystal Structure Length = 465 3e-13
2di4_A238 Crystal Structure Of The Ftsh Protease Domain Lengt 6e-13
1hr6_B 443 Yeast Mitochondrial Processing Peptidase Length = 4 6e-12
1hr7_B 443 Yeast Mitochondrial Processing Peptidase Beta-E73q 1e-11
2dhr_A499 Whole Cytosolic Region Of Atp-Dependent Metalloprot 5e-11
4eiw_A508 Whole Cytosolic Region Of Atp-Dependent Metalloprot 6e-11
3hdi_A 421 Crystal Structure Of Bacillus Halodurans Metallo Pe 4e-10
3cwb_B 441 Chicken Cytochrome Bc1 Complex Inhibited By An Iodi 1e-07
1hr6_A 475 Yeast Mitochondrial Processing Peptidase Length = 4 1e-06
3ami_A 445 The Crystal Structure Of The M16b Metallopeptidase 4e-06
3amj_C 437 The Crystal Structure Of The Heterodimer Of M16b Pe 5e-06
3bcc_B 422 Stigmatellin And Antimycin Bound Cytochrome Bc1 Com 6e-06
1bcc_B 422 Cytochrome Bc1 Complex From Chicken Length = 422 6e-06
1sqb_B 453 Crystal Structure Analysis Of Bovine Bc1 With Azoxy 1e-05
3eoq_A 406 The Crystal Structure Of Putative Zinc Protease Bet 2e-05
1bgy_B 439 Cytochrome Bc1 Complex From Bovine Length = 439 6e-05
1qcr_B 423 Crystal Structure Of Bovine Mitochondrial Cytochrom 1e-04
1ezv_A 430 Structure Of The Yeast Cytochrome Bc1 Complex Co- C 2e-04
>pdb|1SQB|A Chain A, Crystal Structure Analysis Of Bovine Bc1 With Azoxystrobin Length = 480 Back     alignment and structure 
Iteration: 1

 Score = 91.7 bits (226), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 53/68 (77%)
Query: 21  ASVAEKSVNVPSTQVTSIDNGLRVATEDSGAPTATVGIWVDAGSRYETDANNGVAHFLEH 80
           A+ A+   +VP TQV+ +DNGLRVA+E S  PT TVG+W+DAGSRYE++ NNG  +F+EH
Sbjct: 36  ATYAQALQSVPETQVSQLDNGLRVASEQSSQPTCTVGVWIDAGSRYESEKNNGAGYFVEH 95
Query: 81  MAFKTREN 88
           +AFK  +N
Sbjct: 96  LAFKGTKN 103
>pdb|1BGY|A Chain A, Cytochrome Bc1 Complex From Bovine Length = 446 Back     alignment and structure
>pdb|1QCR|A Chain A, Crystal Structure Of Bovine Mitochondrial Cytochrome Bc1 Complex, Alpha Carbon Atoms Only Length = 446 Back     alignment and structure
>pdb|3CWB|A Chain A, Chicken Cytochrome Bc1 Complex Inhibited By An Iodinated Analogue Of The Polyketide Crocacin-d Length = 446 Back     alignment and structure
>pdb|1BCC|A Chain A, Cytochrome Bc1 Complex From Chicken Length = 446 Back     alignment and structure
>pdb|2CE7|A Chain A, Edta Treated Length = 476 Back     alignment and structure
>pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 Back     alignment and structure
>pdb|2DI4|A Chain A, Crystal Structure Of The Ftsh Protease Domain Length = 238 Back     alignment and structure
>pdb|1HR6|B Chain B, Yeast Mitochondrial Processing Peptidase Length = 443 Back     alignment and structure
>pdb|1HR7|B Chain B, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant Length = 443 Back     alignment and structure
>pdb|2DHR|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 499 Back     alignment and structure
>pdb|4EIW|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 508 Back     alignment and structure
>pdb|3HDI|A Chain A, Crystal Structure Of Bacillus Halodurans Metallo Peptidase Length = 421 Back     alignment and structure
>pdb|3CWB|B Chain B, Chicken Cytochrome Bc1 Complex Inhibited By An Iodinated Analogue Of The Polyketide Crocacin-d Length = 441 Back     alignment and structure
>pdb|1HR6|A Chain A, Yeast Mitochondrial Processing Peptidase Length = 475 Back     alignment and structure
>pdb|3AMI|A Chain A, The Crystal Structure Of The M16b Metallopeptidase Subunit From Sphingomonas Sp. A1 Length = 445 Back     alignment and structure
>pdb|3AMJ|C Chain C, The Crystal Structure Of The Heterodimer Of M16b Peptidase From Sphingomonas Sp. A1 Length = 437 Back     alignment and structure
>pdb|3BCC|B Chain B, Stigmatellin And Antimycin Bound Cytochrome Bc1 Complex From Chicken Length = 422 Back     alignment and structure
>pdb|1BCC|B Chain B, Cytochrome Bc1 Complex From Chicken Length = 422 Back     alignment and structure
>pdb|1SQB|B Chain B, Crystal Structure Analysis Of Bovine Bc1 With Azoxystrobin Length = 453 Back     alignment and structure
>pdb|3EOQ|A Chain A, The Crystal Structure Of Putative Zinc Protease Beta- Subunit From Thermus Thermophilus Hb8 Length = 406 Back     alignment and structure
>pdb|1BGY|B Chain B, Cytochrome Bc1 Complex From Bovine Length = 439 Back     alignment and structure
>pdb|1QCR|B Chain B, Crystal Structure Of Bovine Mitochondrial Cytochrome Bc1 Complex, Alpha Carbon Atoms Only Length = 423 Back     alignment and structure
>pdb|1EZV|A Chain A, Structure Of The Yeast Cytochrome Bc1 Complex Co- Crystallized With An Antibody Fv-Fragment Length = 430 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query245
1pp9_A 446 Ubiquinol-cytochrome C reductase complex core Pro 1e-29
1pp9_B 439 Ubiquinol-cytochrome C reductase complex core Pro 2e-29
1hr6_A 475 Alpha-MPP, mitochondrial processing peptidase alph 3e-27
3cx5_A 431 Cytochrome B-C1 complex subunit 1, mitochondrial; 1e-25
1hr6_B 443 Beta-MPP, mitochondrial processing peptidase beta 6e-25
3eoq_A 406 Putative zinc protease; two similar domains of bet 1e-24
2di4_A238 Zinc protease, cell division protein FTSH homolog; 2e-24
3hdi_A 421 Processing protease; CAGE structure, M16B peptidas 3e-24
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 7e-23
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 3e-22
3cx5_B 352 Cytochrome B-C1 complex subunit 2, mitochondrial; 6e-20
3go9_A 492 Insulinase family protease; IDP00573, structural g 1e-14
3amj_B 424 Zinc peptidase inactive subunit; alpha/beta, zinc 7e-13
3ami_A 445 Zinc peptidase; alpha/beta, zinc binding, hydrolas 2e-12
1q2l_A 939 Protease III; hydrolase; 2.20A {Escherichia coli s 4e-10
3gwb_A 434 Peptidase M16 inactive domain family protein; pept 6e-10
3cww_A 990 Insulysin, insulin-degrading enzyme, insulinase; A 7e-09
3d3y_A 425 Uncharacterized protein; APC29635, conserved prote 3e-08
2fge_A 995 Atprep2;, zinc metalloprotease (insulinase family) 2e-05
>1pp9_A Ubiquinol-cytochrome C reductase complex core Pro mitochondrial; cytochrome BC1, membrane protein, heme protein, rieske iron protein, cytochrome B, complex III; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} SCOP: d.185.1.1 d.185.1.1 PDB: 1bgy_A* 1be3_A* 1l0n_A* 1ntk_A* 1ntm_A* 1ntz_A* 1nu1_A* 1l0l_A* 1ppj_A* 1sqq_A* 1sqv_A* 1sqx_A* 2a06_A* 2fyu_A* 2ybb_A* 1sqb_A* 1sqp_A* 1qcr_A* 1bcc_A* 2bcc_A* ... Length = 446 Back     alignment and structure
 Score =  114 bits (287), Expect = 1e-29
 Identities = 38/64 (59%), Positives = 51/64 (79%)

Query: 21 ASVAEKSVNVPSTQVTSIDNGLRVATEDSGAPTATVGIWVDAGSRYETDANNGVAHFLEH 80
          A+ A+   +VP TQV+ +DNGLRVA+E S  PT TVG+W+DAGSRYE++ NNG  +F+EH
Sbjct: 2  ATYAQALQSVPETQVSQLDNGLRVASEQSSQPTCTVGVWIDAGSRYESEKNNGAGYFVEH 61

Query: 81 MAFK 84
          +AFK
Sbjct: 62 LAFK 65
>1pp9_B Ubiquinol-cytochrome C reductase complex core Pro mitochondrial; cytochrome BC1, membrane protein, heme protein, rieske iron protein, cytochrome B, complex III; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} SCOP: d.185.1.1 d.185.1.1 PDB: 1bgy_B* 1be3_B* 1l0n_B* 1ntk_B* 1ntm_B* 1ntz_B* 1nu1_B* 1l0l_B* 1ppj_B* 1sqq_B* 1sqv_B* 1sqx_B* 2a06_B* 2fyu_B* 2ybb_B* 1sqb_B* 1sqp_B* 1qcr_B* 2bcc_B* 3bcc_B* ... Length = 439 Back     alignment and structure
>1hr6_A Alpha-MPP, mitochondrial processing peptidase alpha subunit; hxxeh zinc-binding motif, hydrolase; HET: EPE; 2.50A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1hr7_A 1hr8_A* 1hr9_A* Length = 475 Back     alignment and structure
>3cx5_A Cytochrome B-C1 complex subunit 1, mitochondrial; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1p84_A* 2ibz_A* 1kb9_A* 3cxh_A* 1ezv_A* 1kyo_A* Length = 431 Back     alignment and structure
>1hr6_B Beta-MPP, mitochondrial processing peptidase beta subunit; hxxeh zinc-binding motif, hydrolase; HET: EPE; 2.50A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1hr7_B 1hr8_B* 1hr9_B* Length = 443 Back     alignment and structure
>3eoq_A Putative zinc protease; two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)- beta structure, hydrolase; 2.29A {Thermus thermophilus} Length = 406 Back     alignment and structure
>2di4_A Zinc protease, cell division protein FTSH homolog; metalloproteinase, hexamer-ring, hydrolase; 2.79A {Aquifex aeolicus} SCOP: a.269.1.1 Length = 238 Back     alignment and structure
>3hdi_A Processing protease; CAGE structure, M16B peptidase, metallopeptidase, peptidasome, protease, hydrolase; 2.70A {Bacillus halodurans c-125} Length = 421 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure
>3cx5_B Cytochrome B-C1 complex subunit 2, mitochondrial; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1kb9_B* 1kyo_B* 1p84_B* 2ibz_B* 1ezv_B* 3cxh_B* Length = 352 Back     alignment and structure
>3go9_A Insulinase family protease; IDP00573, structural genomics, for structural genomics of infectious diseases, csgid, HYDR; HET: MSE; 1.62A {Yersinia pestis} Length = 492 Back     alignment and structure
>3amj_B Zinc peptidase inactive subunit; alpha/beta, zinc binding, hydrolase; 3.00A {Sphingomonas} Length = 424 Back     alignment and structure
>3ami_A Zinc peptidase; alpha/beta, zinc binding, hydrolase; 2.40A {Sphingomonas} PDB: 3amj_C Length = 445 Back     alignment and structure
>1q2l_A Protease III; hydrolase; 2.20A {Escherichia coli str} SCOP: d.185.1.1 d.185.1.1 d.185.1.1 d.185.1.1 Length = 939 Back     alignment and structure
>3gwb_A Peptidase M16 inactive domain family protein; peptidase M16 family, PFL_5859, structural genomics, PSI-2, structure initiative; 1.90A {Pseudomonas fluorescens} Length = 434 Back     alignment and structure
>3cww_A Insulysin, insulin-degrading enzyme, insulinase; A-beta degrading enzyme, criptidase, kinins, hydrolase; 1.96A {Homo sapiens} PDB: 3ofi_A 2wc0_A 3h44_A 3n56_A 3n57_A 2wby_A 3qz2_A 3e4z_A 2wk3_A 3e4a_A* 2g47_A 2g48_A 2g49_A 2g54_A 2g56_A 2jbu_A 3e50_A 2jg4_A 3hgz_A 2yb3_A* ... Length = 990 Back     alignment and structure
>3d3y_A Uncharacterized protein; APC29635, conserved protein, enterococcus faecalis V583, STR genomics, PSI-2, protein structure initiative; 1.95A {Enterococcus faecalis} Length = 425 Back     alignment and structure
>2fge_A Atprep2;, zinc metalloprotease (insulinase family); peptidasome, protease-peptide complex, hydrolase, plant protein; 2.10A {Arabidopsis thaliana} SCOP: d.185.1.1 d.185.1.1 d.185.1.1 d.185.1.1 Length = 995 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query245
2di4_A238 Zinc protease, cell division protein FTSH homolog; 99.94
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 99.85
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.81
3eoq_A 406 Putative zinc protease; two similar domains of bet 99.72
3hdi_A 421 Processing protease; CAGE structure, M16B peptidas 99.7
1pp9_A 446 Ubiquinol-cytochrome C reductase complex core Pro 99.68
1q2l_A 939 Protease III; hydrolase; 2.20A {Escherichia coli s 99.68
1hr6_A 475 Alpha-MPP, mitochondrial processing peptidase alph 99.67
3go9_A 492 Insulinase family protease; IDP00573, structural g 99.66
3ami_A 445 Zinc peptidase; alpha/beta, zinc binding, hydrolas 99.65
1hr6_B 443 Beta-MPP, mitochondrial processing peptidase beta 99.64
3cww_A 990 Insulysin, insulin-degrading enzyme, insulinase; A 99.61
1pp9_B 439 Ubiquinol-cytochrome C reductase complex core Pro 99.58
3gwb_A 434 Peptidase M16 inactive domain family protein; pept 99.57
3amj_B 424 Zinc peptidase inactive subunit; alpha/beta, zinc 99.55
3cx5_A 431 Cytochrome B-C1 complex subunit 1, mitochondrial; 99.46
2fge_A 995 Atprep2;, zinc metalloprotease (insulinase family) 99.37
3cx5_B 352 Cytochrome B-C1 complex subunit 2, mitochondrial; 99.36
3s5m_A 1193 Falcilysin; M16 metalloprotease, peptidase, hydrol 99.34
3d3y_A 425 Uncharacterized protein; APC29635, conserved prote 99.23
1q2l_A 939 Protease III; hydrolase; 2.20A {Escherichia coli s 97.71
2fge_A 995 Atprep2;, zinc metalloprotease (insulinase family) 96.84
3cww_A 990 Insulysin, insulin-degrading enzyme, insulinase; A 96.11
3s5m_A 1193 Falcilysin; M16 metalloprotease, peptidase, hydrol 86.4
>2di4_A Zinc protease, cell division protein FTSH homolog; metalloproteinase, hexamer-ring, hydrolase; 2.79A {Aquifex aeolicus} SCOP: a.269.1.1 Back     alignment and structure
Probab=99.94  E-value=4.1e-28  Score=206.25  Aligned_cols=152  Identities=27%  Similarity=0.368  Sum_probs=112.1

Q ss_pred             ccccccccchhhhccccccccccccceeeeeeccccceeEEEEcCc-chhhchHHHHHHHHHHhhchhhHHHHHh--CCC
Q psy5435          65 RYETDANNGVAHFLEHMAFKTRENGFYFYYFSNASKGLGYAQYLPR-EQYLYSKEQLLDRMCMTLGGRVSEEIFF--GRI  141 (245)
Q Consensus        65 ~~E~~g~aGvAhll~~~~~~gt~~~~~~~tI~~rg~~lG~~~~~~~-e~~~~t~~~L~~~l~~~L~g~~aEel~~--~~~  141 (245)
                      +||++||+.+++++++..+      +.++||+|||.++||+.+.|. |...++++.|.++|+++||||+||+++|  +++
T Consensus        20 AyHEAGHAlva~~l~~~~p------V~KVTIiPRG~alG~t~~~P~ed~~~~tk~~l~~~i~v~LgGRaAEelifG~g~v   93 (238)
T 2di4_A           20 AIHEAGHALMGLVSDDDDK------VHKISIIPRGMALGVTQQLPIEDKHIYDKKDLYNKILVLLGGRAAEEVFFGKDGI   93 (238)
T ss_dssp             HHHHHHHHHHHHHCSSCCC------CCCEECC----------------CCCCBHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHcCCCCc------eeEEEEeecCCcceEEEeCCcccccccCHHHHHHHHHHHHhHHHHHHHHhCCCCc
Confidence            6899999999999999888      999999999999999999997 7889999999999999999999999999  789


Q ss_pred             CCCChhHHHHHHHHHHHHHHHhCCCCcCcCcccccccCcchhhhhh-hhhhhHHHhhccchHHHHHHHHhcccc--chh-
Q psy5435         142 TTGAEDDLKKVTQSAYAQVAHFGMNEKVGKSESKLVDHREVLVQQV-LALEGLDVLGRSQDGVAQRSALECGGV--KVI-  217 (245)
Q Consensus       142 ~~g~~~DL~~at~~a~~~v~~~Gm~~~~g~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~d~e~~~~~~~~~~~--~~~-  217 (245)
                      ++|+++||++||++|+.||++|||++.+|++.|..+++  +++..+ .....++.+.+.||.|+++++++||++  .++ 
T Consensus        94 ttGA~~Dl~~AT~iAr~MV~~~GMs~~lG~v~~~~~~~--~flg~~~~~~~~Se~ta~~iD~Ev~~il~~ay~~a~~iL~  171 (238)
T 2di4_A           94 TTGAENDLQRATDLAYRMVSMWGMSDKVGPIAIRRVAN--PFLGGMTTAVDTSPDLLREIDEEVKRIITEQYEKAKAIVE  171 (238)
T ss_dssp             CGGGHHHHHHHHHHHHHHHHTSCCCTTTCSCCCCC------------CCCSCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ccChHhHHHHHHHHHHHHHHHhCCCCCCCceeecCCcc--ccccccccccccCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999874432  444311 122345556677799999999999984  454 


Q ss_pred             -hcccccc
Q psy5435         218 -EHDFLQV  224 (245)
Q Consensus       218 -~~~~~~~  224 (245)
                       +++.|+.
T Consensus       172 ~nr~~L~~  179 (238)
T 2di4_A          172 EYKEPLKA  179 (238)
T ss_dssp             HTHHHHHH
T ss_pred             HHHHHHHH
Confidence             3455543
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3eoq_A Putative zinc protease; two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)- beta structure, hydrolase; 2.29A {Thermus thermophilus} Back     alignment and structure
>3hdi_A Processing protease; CAGE structure, M16B peptidase, metallopeptidase, peptidasome, protease, hydrolase; 2.70A {Bacillus halodurans c-125} Back     alignment and structure
>1pp9_A Ubiquinol-cytochrome C reductase complex core Pro mitochondrial; cytochrome BC1, membrane protein, heme protein, rieske iron protein, cytochrome B, complex III; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} SCOP: d.185.1.1 d.185.1.1 PDB: 1bgy_A* 1be3_A* 1l0n_A* 1ntk_A* 1ntm_A* 1ntz_A* 1nu1_A* 1l0l_A* 1ppj_A* 1sqq_A* 1sqv_A* 1sqx_A* 2a06_A* 2fyu_A* 2ybb_A* 1sqb_A* 1sqp_A* 1qcr_A* 1bcc_A* 2bcc_A* ... Back     alignment and structure
>1q2l_A Protease III; hydrolase; 2.20A {Escherichia coli str} SCOP: d.185.1.1 d.185.1.1 d.185.1.1 d.185.1.1 Back     alignment and structure
>1hr6_A Alpha-MPP, mitochondrial processing peptidase alpha subunit; hxxeh zinc-binding motif, hydrolase; HET: EPE; 2.50A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1hr7_A 1hr8_A* 1hr9_A* Back     alignment and structure
>3go9_A Insulinase family protease; IDP00573, structural genomics, for structural genomics of infectious diseases, csgid, HYDR; HET: MSE; 1.62A {Yersinia pestis} Back     alignment and structure
>3ami_A Zinc peptidase; alpha/beta, zinc binding, hydrolase; 2.40A {Sphingomonas} PDB: 3amj_C Back     alignment and structure
>1hr6_B Beta-MPP, mitochondrial processing peptidase beta subunit; hxxeh zinc-binding motif, hydrolase; HET: EPE; 2.50A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1hr7_B 1hr8_B* 1hr9_B* Back     alignment and structure
>3cww_A Insulysin, insulin-degrading enzyme, insulinase; A-beta degrading enzyme, criptidase, kinins, hydrolase; 1.96A {Homo sapiens} PDB: 3ofi_A 2wc0_A 3h44_A 3n56_A 3n57_A 2wby_A 3qz2_A 3e4z_A 2wk3_A 3e4a_A* 2g47_A 2g48_A 2g49_A 2g54_A 2g56_A 2jbu_A 3e50_A 2jg4_A 3hgz_A 2yb3_A* ... Back     alignment and structure
>1pp9_B Ubiquinol-cytochrome C reductase complex core Pro mitochondrial; cytochrome BC1, membrane protein, heme protein, rieske iron protein, cytochrome B, complex III; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} SCOP: d.185.1.1 d.185.1.1 PDB: 1bgy_B* 1be3_B* 1l0n_B* 1ntk_B* 1ntm_B* 1ntz_B* 1nu1_B* 1l0l_B* 1ppj_B* 1sqq_B* 1sqv_B* 1sqx_B* 2a06_B* 2fyu_B* 2ybb_B* 1sqb_B* 1sqp_B* 1qcr_B* 2bcc_B* 3bcc_B* ... Back     alignment and structure
>3gwb_A Peptidase M16 inactive domain family protein; peptidase M16 family, PFL_5859, structural genomics, PSI-2, structure initiative; 1.90A {Pseudomonas fluorescens} Back     alignment and structure
>3amj_B Zinc peptidase inactive subunit; alpha/beta, zinc binding, hydrolase; 3.00A {Sphingomonas} Back     alignment and structure
>3cx5_A Cytochrome B-C1 complex subunit 1, mitochondrial; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1p84_A* 2ibz_A* 1kb9_A* 3cxh_A* 1ezv_A* 1kyo_A* Back     alignment and structure
>2fge_A Atprep2;, zinc metalloprotease (insulinase family); peptidasome, protease-peptide complex, hydrolase, plant protein; 2.10A {Arabidopsis thaliana} SCOP: d.185.1.1 d.185.1.1 d.185.1.1 d.185.1.1 Back     alignment and structure
>3cx5_B Cytochrome B-C1 complex subunit 2, mitochondrial; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1kb9_B* 1kyo_B* 1p84_B* 2ibz_B* 1ezv_B* 3cxh_B* Back     alignment and structure
>3s5m_A Falcilysin; M16 metalloprotease, peptidase, hydrolase; 1.55A {Plasmodium falciparum} PDB: 3s5i_A 3s5k_A 3s5h_A Back     alignment and structure
>3d3y_A Uncharacterized protein; APC29635, conserved protein, enterococcus faecalis V583, STR genomics, PSI-2, protein structure initiative; 1.95A {Enterococcus faecalis} Back     alignment and structure
>1q2l_A Protease III; hydrolase; 2.20A {Escherichia coli str} SCOP: d.185.1.1 d.185.1.1 d.185.1.1 d.185.1.1 Back     alignment and structure
>2fge_A Atprep2;, zinc metalloprotease (insulinase family); peptidasome, protease-peptide complex, hydrolase, plant protein; 2.10A {Arabidopsis thaliana} SCOP: d.185.1.1 d.185.1.1 d.185.1.1 d.185.1.1 Back     alignment and structure
>3cww_A Insulysin, insulin-degrading enzyme, insulinase; A-beta degrading enzyme, criptidase, kinins, hydrolase; 1.96A {Homo sapiens} PDB: 3ofi_A 2wc0_A 3h44_A 3n56_A 3n57_A 2wby_A 3qz2_A 3e4z_A 2wk3_A 3e4a_A* 2g47_A 2g48_A 2g49_A 2g54_A 2g56_A 2jbu_A 3e50_A 2jg4_A 3hgz_A 2yb3_A* ... Back     alignment and structure
>3s5m_A Falcilysin; M16 metalloprotease, peptidase, hydrolase; 1.55A {Plasmodium falciparum} PDB: 3s5i_A 3s5k_A 3s5h_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 245
d1ppja1232 d.185.1.1 (A:2-233) Cytochrome bc1 core subunit 1 3e-21
d1ppjb1219 d.185.1.1 (B:17-235) Cytochrome bc1 core subunit 2 7e-18
d1hr6b1222 d.185.1.1 (B:24-245) Mitochondrial processing pept 2e-17
d1hr6a1220 d.185.1.1 (A:14-233) Mitochondrial processing pept 6e-17
d3cx5a1213 d.185.1.1 (A:27-239) Cytochrome bc1 core subunit 1 4e-16
d3cx5b1202 d.185.1.1 (B:17-218) Cytochrome bc1 core subunit 2 2e-15
d2ce7a1193 a.269.1.1 (A:411-603) Cell division protein FtsH, 8e-14
d1q2la4240 d.185.1.1 (A:24-263) Protease III {Escherichia col 2e-13
d2di4a1202 a.269.1.1 (A:406-607) Cell division protein FtsH, 3e-06
d2fgea4257 d.185.1.1 (A:15-271) Presequence protease 1, PREP1 1e-05
>d1ppja1 d.185.1.1 (A:2-233) Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [TaxId: 9913]} Length = 232 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: LuxS/MPP-like metallohydrolase
superfamily: LuxS/MPP-like metallohydrolase
family: MPP-like
domain: Cytochrome bc1 core subunit 1
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 86.6 bits (213), Expect = 3e-21
 Identities = 43/122 (35%), Positives = 62/122 (50%), Gaps = 4/122 (3%)

Query: 21  ASVAEKSVNVPSTQVTSIDNGLRVATEDSGAPTATVGIWVDAGSRYETDANNGVAHFLEH 80
           A+ A+   +VP TQV+ +DNGLRVA+E S  PT TVG+W+DAGSRYE++ NNG  +F+EH
Sbjct: 1   ATYAQALQSVPETQVSQLDNGLRVASEQSSQPTCTVGVWIDAGSRYESEKNNGAGYFVEH 60

Query: 81  MA----FKTRENGFYFYYFSNASKGLGYAQYLPREQYLYSKEQLLDRMCMTLGGRVSEEI 136
           +A         N       S  +    Y+       Y+ +  + L +    L   V    
Sbjct: 61  LAFKGTKNRPGNALEKEVESMGAHLNAYSTREHTAYYIKALSKDLPKAVELLADIVQNCS 120

Query: 137 FF 138
             
Sbjct: 121 LE 122
>d1ppjb1 d.185.1.1 (B:17-235) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 219 Back     information, alignment and structure
>d1hr6b1 d.185.1.1 (B:24-245) Mitochondrial processing peptidase (MPP) beta chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 Back     information, alignment and structure
>d1hr6a1 d.185.1.1 (A:14-233) Mitochondrial processing peptidase (MPP) alpha chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 220 Back     information, alignment and structure
>d3cx5a1 d.185.1.1 (A:27-239) Cytochrome bc1 core subunit 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 213 Back     information, alignment and structure
>d3cx5b1 d.185.1.1 (B:17-218) Cytochrome bc1 core subunit 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 202 Back     information, alignment and structure
>d2ce7a1 a.269.1.1 (A:411-603) Cell division protein FtsH, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 193 Back     information, alignment and structure
>d1q2la4 d.185.1.1 (A:24-263) Protease III {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d2di4a1 a.269.1.1 (A:406-607) Cell division protein FtsH, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 202 Back     information, alignment and structure
>d2fgea4 d.185.1.1 (A:15-271) Presequence protease 1, PREP1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 257 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query245
d2ce7a1193 Cell division protein FtsH, C-terminal domain {The 99.84
d2di4a1202 Cell division protein FtsH, C-terminal domain {Aqu 99.84
d1ppjb1219 Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [T 99.83
d1hr6a1220 Mitochondrial processing peptidase (MPP) alpha cha 99.74
d1ppja1232 Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [T 99.74
d3cx5a1213 Cytochrome bc1 core subunit 1 {Baker's yeast (Sacc 99.71
d1hr6b1222 Mitochondrial processing peptidase (MPP) beta chai 99.7
d1q2la4240 Protease III {Escherichia coli [TaxId: 562]} 99.7
d3cx5b1202 Cytochrome bc1 core subunit 2 {Baker's yeast (Sacc 99.49
d2fgea4257 Presequence protease 1, PREP1 {Thale cress (Arabid 99.27
d1q2la1229 Protease III {Escherichia coli [TaxId: 562]} 98.52
>d2ce7a1 a.269.1.1 (A:411-603) Cell division protein FtsH, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: All alpha proteins
fold: FtsH protease domain-like
superfamily: FtsH protease domain-like
family: FtsH protease domain-like
domain: Cell division protein FtsH, C-terminal domain
species: Thermotoga maritima [TaxId: 2336]

Probab=99.84  E-value=3.2e-22  Score=163.55  Aligned_cols=143  Identities=26%  Similarity=0.412  Sum_probs=104.3

Q ss_pred             ccccccccchhhhccccccccccccceeeeeeccc-cceeEEEEcCc-chhhchHHHHHHHHHHhhchhhHHHHHhCCCC
Q psy5435          65 RYETDANNGVAHFLEHMAFKTRENGFYFYYFSNAS-KGLGYAQYLPR-EQYLYSKEQLLDRMCMTLGGRVSEEIFFGRIT  142 (245)
Q Consensus        65 ~~E~~g~aGvAhll~~~~~~gt~~~~~~~tI~~rg-~~lG~~~~~~~-e~~~~t~~~L~~~l~~~L~g~~aEel~~~~~~  142 (245)
                      ++|++||+.+++++++...      +.+++|.||+ .++|++.+.|. |....|++.+.++|+++||||+||+++|++++
T Consensus        11 A~HEAGHAlva~~l~~~~~------i~~vsI~~r~~~~~g~~~~~~~~~~~~~t~~~l~~~i~v~LaGraAE~~~~g~~s   84 (193)
T d2ce7a1          11 AYHEAGHAVVSTVVPNGEP------VHRISIIPRGYKALGYTLHLPEEDKYLVSRNELLDKLTALLGGRAAEEVVFGDVT   84 (193)
T ss_dssp             HHHHHHHHHHHHHSTTCCC------CCEEECC-----------------CCSCBHHHHHHHHHHHTHHHHHHHHHHSSCC
T ss_pred             HHHHHHHHHHHHHcCCCCc------eeEEEEecCccCCCceeecCCccccccCcHHHHHHHHHHHHHHHHHHHHHhCCCC
Confidence            6799999999999988777      8999999996 56789888886 56788999999999999999999999999999


Q ss_pred             CCChhHHHHHHHHHHHHHHHhCCCCcCcCcccccccCcchhhhhh--hhhhhHHHhhccchHHHHHHHHhcccc
Q psy5435         143 TGAEDDLKKVTQSAYAQVAHFGMNEKVGKSESKLVDHREVLVQQV--LALEGLDVLGRSQDGVAQRSALECGGV  214 (245)
Q Consensus       143 ~g~~~DL~~at~~a~~~v~~~Gm~~~~g~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~d~e~~~~~~~~~~~  214 (245)
                      +|+++||++|+++|+.|+..|||++.+|++.+.... .+.....+  .....++.....+|.++++++++||++
T Consensus        85 ~Ga~~Dl~~At~lA~~~v~~~Gm~~~~g~~~~~~~~-~~~~~~~~~~~~~~~s~~~~~~id~ev~~ll~~a~~~  157 (193)
T d2ce7a1          85 SGAANDIERATEIARNMVCQLGMSEELGPLAWGKEE-QEVFLGKEITRLRNYSEEVASKIDEEVKKIVTNCYER  157 (193)
T ss_dssp             GGGHHHHHHHHHHHHHHHHTSCCCTTTCSCCCCC--------------CCCSCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCccCcHHHHHHHHHHHHHhhCcCCCcCceeeccCC-ccccccccccccccccHHHHHHHHHHHHHHHHHHHHH
Confidence            999999999999999999999999999998875432 22222221  111234455666799999999999983
>d2di4a1 a.269.1.1 (A:406-607) Cell division protein FtsH, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ppjb1 d.185.1.1 (B:17-235) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hr6a1 d.185.1.1 (A:14-233) Mitochondrial processing peptidase (MPP) alpha chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ppja1 d.185.1.1 (A:2-233) Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3cx5a1 d.185.1.1 (A:27-239) Cytochrome bc1 core subunit 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hr6b1 d.185.1.1 (B:24-245) Mitochondrial processing peptidase (MPP) beta chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q2la4 d.185.1.1 (A:24-263) Protease III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3cx5b1 d.185.1.1 (B:17-218) Cytochrome bc1 core subunit 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fgea4 d.185.1.1 (A:15-271) Presequence protease 1, PREP1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1q2la1 d.185.1.1 (A:504-732) Protease III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure