Psyllid ID: psy5649

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-----
MDYALQSNGMKKCNGILIYGVNGTGKTSLIHSLASHMKVHTVVIQVADMFSKFYGEAEFRLKAAFDAALDHAPSLLLLDNLDVLCTGRNRSDQERRLLSCLVTQVDRLHELQACVVLLAVTTSLDNVDVSLRTPGRLDQEIELPVPSRDQRAAILHCLLTKVPHSLSTDQIQQVAFITHGFVGGDLATLLSNATSALLVETEGTGQVLSYDGVMRALDHVKPSAMRQVLVEVPNVKWSDIGGQDEVKLKLRQSVEWPLKHPEAFARLGIKPPRGILMFGPPGCSKTMIAKALATESKLNFISVKI
cHHHHHHcccccccEEEEEcccccHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccccHHHHHHHHHHHHccccccccEEEEEEccccccccccccccccccEEEEcccccHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccccEEEcccccccccccHHHHHHHHHHHHHHHcccHHHHHHcccccccEEEEEccccccHHHHHHHHHcccccEEEEEEc
cHHHHHHHccccccEEEEEccccccHHHHHHHHHHHcccEEEEEccHHHHHHHHcHcHHHHHHHHHHHHHcccEEEEEccHHHHccccccccccHHHHHHHHHHHccHHHHcccEEEEEEccccccccHHHcccccccEEEEEccccHHHHHHHHHHHHccccccccHHHHHHHHHHHccccHHcHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccccccEEEEcccccHHHcccHHHHHHHHHHHHccccccHHHHHHHccccccEEEEEccccccHHHHHHHHHHHcccEEEEEEc
mdyalqsngmkkcngiliygvngtgKTSLIHSLASHMKVHTVVIQVADMFSKFYGEAEFRLKAAFDAALdhapslllldnldvlctgrnrsdQERRLLSCLVTQVDRLHELQACVVLLAVTTsldnvdvslrtpgrldqeielpvpsrDQRAAILHCLLtkvphslstdQIQQVAFIthgfvggdLATLLSNATSALLVEtegtgqvlsydGVMRALDHVKPSAMRQVLvevpnvkwsdiggqdeVKLKLRQsvewplkhpeafarlgikpprgilmfgppgcsKTMIAKALATESKLNFISVKI
MDYALQSNGMKKCNGILIYGVNGTGKTSLIHSLASHMKVHTVVIQVADMFSKFYGEAEFRLKAAFDAALDHAPSLLLLDNLDVLCTGRNRSDQERRLLSCLVTQVDRLHELQACVVLLAVttsldnvdvslrtpgrldqeielpvpsRDQRAAILHCLLTKVPHSLSTDQIQQVAFITHGFVGGDLATLLSNATSALLVETEGTGQVLSYDGVMRALDHVKPSAMRQVLVevpnvkwsdiggqDEVKLKLRQSVEWPLKHPEafarlgikpprGILMFGPPGCSKTMIAKALAtesklnfisvki
MDYALQSNGMKKCNGILIYGVNGTGKTSLIHSLASHMKVHTVVIQVADMFSKFYGEAEFRLKAAFdaaldhapslllldnldvlCTGRNRSDQERRLLSCLVTQVDRLHELQACVVLLAVTTSLDNVDVSLRTPGRLDQEIELPVPSRDQRAAILHCLLTKVPHSLSTDQIQQVAFITHGFVGGDlatllsnatsallVETEGTGQVLSYDGVMRALDHVKPSAMRQVLVEVPNVKWSDIGGQDEVKLKLRQSVEWPLKHPEAFARLGIKPPRGILMFGPPGCSKTMIAKALATESKLNFISVKI
**********KKCNGILIYGVNGTGKTSLIHSLASHMKVHTVVIQVADMFSKFYGEAEFRLKAAFDAALDHAPSLLLLDNLDVLCTGRNRSDQERRLLSCLVTQVDRLHELQACVVLLAVTTSLDNVDVSLRTPGRLDQEIELPV***DQRAAILHCLLTKVPHSLSTDQIQQVAFITHGFVGGDLATLLSNATSALLVETEGTGQVLSYDGVMRALDHVKPSAMRQVLVEVPNVKWSDIGGQDEVKLKLRQSVEWPLKHPEAFARLGIKPPRGILMFGPPGCSKTMIAKALATESKLNF*****
*DYALQSNGMKKCNGILIYGVNGTGKTSLIHSLASHMKVHTVVIQVADMFSKFYGEAEFRLKAAFDAALDHAPSLLLLDNLDVL***************CLVTQVDRLHELQACVVLLAVTTSLDNVDVSLRTPGRLDQEIELPVPSRDQRAAILHCLLTKVPHSLSTDQIQQVAFITHGFVGGDLATLLSNATSAL*********VLSYDGVMRALDHVKPSAMRQVLVEVPNVKWSDIGGQDEVKLKLRQSVEWPLKHPEAFARLGIKPPRGILMFGPPGCSKTMIAKALATESKLNFISVKI
MDYALQSNGMKKCNGILIYGVNGTGKTSLIHSLASHMKVHTVVIQVADMFSKFYGEAEFRLKAAFDAALDHAPSLLLLDNLDVLCTGRNRSDQERRLLSCLVTQVDRLHELQACVVLLAVTTSLDNVDVSLRTPGRLDQEIELPVPSRDQRAAILHCLLTKVPHSLSTDQIQQVAFITHGFVGGDLATLLSNATSALLVETEGTGQVLSYDGVMRALDHVKPSAMRQVLVEVPNVKWSDIGGQDEVKLKLRQSVEWPLKHPEAFARLGIKPPRGILMFGPPGCSKTMIAKALATESKLNFISVKI
MDYALQSNGMKKCNGILIYGVNGTGKTSLIHSLASHMKVHTVVIQVADMFSKFYGEAEFRLKAAFDAALDHAPSLLLLDNLDVLCTGR**SDQERRLLSCLVTQVDRLHELQACVVLLAVTTSLDNVDVSLRTPGRLDQEIELPVPSRDQRAAILHCLLTKVPHSLSTDQIQQVAFITHGFVGGDLATLLSNATSALLVETEGTGQVLSYDGVMRALDHVKPSAMRQVLVEVPNVKWSDIGGQDEVKLKLRQSVEWPLKHPEAFARLGIKPPRGILMFGPPGCSKTMIAKALATESKLNFISVKI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDYALQSNGMKKCNGILIYGVNGTGKTSLIHSLASHMKVHTVVIQVADMFSKFYGEAEFRLKAAFDAALDHAPSLLLLDNLDVLCTGRNRSDQERRLLSCLVTQVDRLHELQACVVLLAVTTSLDNVDVSLRTPGRLDQEIELPVPSRDQRAAILHCLLTKVPHSLSTDQIQQVAFITHGFVGGDLATLLSNATSALLVETEGTGQVLSYDGVMRALDHVKPSAMRQVLVEVPNVKWSDIGGQDEVKLKLRQSVEWPLKHPEAFARLGIKPPRGILMFGPPGCSKTMIAKALATESKLNFISVKI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query305 2.2.26 [Sep-21-2011]
Q3UMC0 893 Spermatogenesis-associate yes N/A 0.983 0.335 0.419 5e-70
Q8NB90 893 Spermatogenesis-associate yes N/A 0.980 0.334 0.424 5e-70
O28972 733 Cell division cycle prote yes N/A 0.977 0.406 0.420 3e-66
O60058 809 ATPase family gene 2 prot yes N/A 0.947 0.357 0.421 5e-66
Q58556 903 Cell division cycle prote yes N/A 0.963 0.325 0.423 1e-62
O05209 745 VCP-like ATPase OS=Thermo yes N/A 0.967 0.395 0.377 2e-59
Q07590 780 Protein SAV OS=Sulfolobus no N/A 0.977 0.382 0.380 6e-59
P32794 780 ATPase family gene 2 prot yes N/A 0.980 0.383 0.383 2e-58
Q9HPF0 742 Protein CdcH OS=Halobacte yes N/A 0.973 0.400 0.388 1e-57
Q8SSJ5 780 Cell division control pro yes N/A 0.957 0.374 0.369 3e-55
>sp|Q3UMC0|SPAT5_MOUSE Spermatogenesis-associated protein 5 OS=Mus musculus GN=Spata5 PE=2 SV=2 Back     alignment and function desciption
 Score =  265 bits (676), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 132/315 (41%), Positives = 204/315 (64%), Gaps = 15/315 (4%)

Query: 5   LQSNGMKKCNGILIYGVNGTGKTSLIHSLASHMKVHTVVIQVADMFSKFYGEAEFRLKAA 64
            +S G+    G+L+YG  GTGKT +  ++A+ +  +  VI   ++ SKFYGE E RL+  
Sbjct: 379 FKSYGIPAPRGLLLYGPPGTGKTMIARAVANEVGAYVSVINGPEIISKFYGETEARLRQI 438

Query: 65  FDAALDHAPSLLLLDNLDVLCTGRN--RSDQERRLLSCLVTQVDRL--HELQACVVLLAV 120
           F  A    PS++ +D LD LC  R   +S+ E+R+++ L+T +D +     +  V++L  
Sbjct: 439 FAEATLRHPSIIFIDELDALCPKREGAQSEVEKRVVASLLTLMDGIGSEGSEGRVLVLGA 498

Query: 121 TTSLDNVDVSLRTPGRLDQEIELPVPSRDQRAAILHCLLTKVPHSLSTDQIQQVAFITHG 180
           T     +D +LR PGR D+EIE+ +P+   R  IL  LL +VPH L+  ++ ++A   HG
Sbjct: 499 TNRPQALDAALRRPGRFDKEIEIGIPNAQDRLDILQKLLRRVPHLLTKAELLRLANNAHG 558

Query: 181 FVGGDLATLLSNA----------TSALLVETEGTGQV-LSYDGVMRALDHVKPSAMRQVL 229
           +VG DL  L + A              L +++  G V ++ +  ++ ++ ++PSAMR+V 
Sbjct: 559 YVGADLKALCNEAGLHALRRVLRKQPNLPDSKVAGMVKITLNDFLQGMNDIRPSAMREVA 618

Query: 230 VEVPNVKWSDIGGQDEVKLKLRQSVEWPLKHPEAFARLGIKPPRGILMFGPPGCSKTMIA 289
           ++VPNV WSDIGG + +KLKL+Q+VEWPLKHP++F R+GI+PP+G+L++GPPGCSKTMIA
Sbjct: 619 IDVPNVSWSDIGGLENIKLKLKQAVEWPLKHPKSFNRMGIQPPKGVLLYGPPGCSKTMIA 678

Query: 290 KALATESKLNFISVK 304
           KALA ES LNF+++K
Sbjct: 679 KALANESGLNFLAIK 693
May be involved in morphological and functional mitochondrial transformations during spermatogenesis.
Mus musculus (taxid: 10090)
>sp|Q8NB90|SPAT5_HUMAN Spermatogenesis-associated protein 5 OS=Homo sapiens GN=SPATA5 PE=1 SV=3 Back     alignment and function description
>sp|O28972|Y1297_ARCFU Cell division cycle protein 48 homolog AF_1297 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1297 PE=3 SV=1 Back     alignment and function description
>sp|O60058|AFG2_SCHPO ATPase family gene 2 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=afg2 PE=3 SV=1 Back     alignment and function description
>sp|Q58556|Y1156_METJA Cell division cycle protein 48 homolog MJ1156 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1156 PE=3 SV=1 Back     alignment and function description
>sp|O05209|VAT_THEAC VCP-like ATPase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=vat PE=1 SV=1 Back     alignment and function description
>sp|Q07590|SAV_SULAC Protein SAV OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=sav PE=3 SV=2 Back     alignment and function description
>sp|P32794|AFG2_YEAST ATPase family gene 2 protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AFG2 PE=1 SV=1 Back     alignment and function description
>sp|Q9HPF0|CDCH_HALSA Protein CdcH OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=cdcH PE=3 SV=1 Back     alignment and function description
>sp|Q8SSJ5|CDC48_ENCCU Cell division control protein 48 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC48 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query305
321478758 501 hypothetical protein DAPPUDRAFT_40651 [D 0.950 0.578 0.518 3e-82
332028592 796 Spermatogenesis-associated protein 5 [Ac 0.947 0.363 0.496 4e-82
350403271 797 PREDICTED: spermatogenesis-associated pr 0.950 0.363 0.496 2e-81
322792852 825 hypothetical protein SINV_10130 [Solenop 0.950 0.351 0.52 2e-81
340728362 797 PREDICTED: spermatogenesis-associated pr 0.950 0.363 0.5 3e-81
380011891 792 PREDICTED: spermatogenesis-associated pr 0.950 0.366 0.503 2e-80
328787695 793 PREDICTED: spermatogenesis-associated pr 0.947 0.364 0.508 2e-80
307188304 803 Spermatogenesis-associated protein 5 [Ca 0.940 0.357 0.493 8e-80
345488604 783 PREDICTED: spermatogenesis-associated pr 0.950 0.370 0.506 5e-78
383865969 796 PREDICTED: spermatogenesis-associated pr 0.970 0.371 0.485 5e-77
>gi|321478758|gb|EFX89715.1| hypothetical protein DAPPUDRAFT_40651 [Daphnia pulex] Back     alignment and taxonomy information
 Score =  311 bits (796), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 156/301 (51%), Positives = 216/301 (71%), Gaps = 11/301 (3%)

Query: 14  NGILIYGVNGTGKTSLIHSLASHMKVHTVVIQVADMFSKFYGEAEFRLKAAFDAALDHAP 73
            G+L+YG  GTGK+ L+ ++A H KV  + IQ  ++FSK+YGE E RL+  F+ A+    
Sbjct: 2   RGMLLYGPPGTGKSLLVRAVAGHFKVPMITIQGPELFSKYYGETEARLREKFEEAIKKDC 61

Query: 74  SLLLLDNLDVLCTGRN-----RSDQERRLLSCLVTQVDRLHELQACVVLLAVTTSLDNVD 128
            ++ LD +D LC  R+      SDQERR+++ L++ +D +   QA VV++ V++  D +D
Sbjct: 62  CIIYLDEIDSLCPKRDSGSSSHSDQERRVVATLLSMIDSVPP-QARVVIIGVSSRPDALD 120

Query: 129 VSLRTPGRLDQEIELPVPSRDQRAAILHCLLTKVPHSLSTDQIQQVAFITHGFVGGDLAT 188
            ++R PGRLD+E+E+  P+  +R  IL+ LL K+PH L T +I  +A ITHGFVG DL+ 
Sbjct: 121 SAMRRPGRLDRELEIRAPTVAERKDILNVLLRKIPHRLETKEIDHLASITHGFVGADLSL 180

Query: 189 LLSNATSA----LLVETEGTGQV-LSYDGVMRALDHVKPSAMRQVLVEVPNVKWSDIGGQ 243
           L + A+ A    ++     TG+V L  +   +AL  VKPSAMR+VLVEVPNV+W+DIGGQ
Sbjct: 181 LCAEASLAAAKRIISGPASTGEVFLLAEDTKQALHLVKPSAMREVLVEVPNVRWTDIGGQ 240

Query: 244 DEVKLKLRQSVEWPLKHPEAFARLGIKPPRGILMFGPPGCSKTMIAKALATESKLNFISV 303
            E+KLKL+Q+VEWPL++PEAF RLG++PPRG+LMFGPPGCSKTMIAKALATES LNFI+V
Sbjct: 241 AELKLKLKQAVEWPLRYPEAFQRLGVEPPRGLLMFGPPGCSKTMIAKALATESGLNFIAV 300

Query: 304 K 304
           K
Sbjct: 301 K 301

Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|332028592|gb|EGI68629.1| Spermatogenesis-associated protein 5 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|350403271|ref|XP_003486751.1| PREDICTED: spermatogenesis-associated protein 5-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|322792852|gb|EFZ16685.1| hypothetical protein SINV_10130 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|340728362|ref|XP_003402494.1| PREDICTED: spermatogenesis-associated protein 5-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380011891|ref|XP_003690027.1| PREDICTED: spermatogenesis-associated protein 5-like [Apis florea] Back     alignment and taxonomy information
>gi|328787695|ref|XP_625214.3| PREDICTED: spermatogenesis-associated protein 5-like [Apis mellifera] Back     alignment and taxonomy information
>gi|307188304|gb|EFN73096.1| Spermatogenesis-associated protein 5 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|345488604|ref|XP_001602720.2| PREDICTED: spermatogenesis-associated protein 5-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383865969|ref|XP_003708444.1| PREDICTED: spermatogenesis-associated protein 5-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query305
UNIPROTKB|F1NLN4704 SPATA5 "Uncharacterized protei 0.980 0.424 0.410 3.9e-60
DICTYBASE|DDB_G0278435 886 DDB_G0278435 "AAA ATPase domai 0.318 0.109 0.639 1.5e-58
FB|FBgn0032450 799 CG5776 [Drosophila melanogaste 0.977 0.372 0.403 4.6e-57
UNIPROTKB|F1MFP1771 SPATA5 "Uncharacterized protei 0.980 0.387 0.394 5.9e-57
UNIPROTKB|F1RQN5778 SPATA5 "Uncharacterized protei 0.980 0.384 0.388 7.5e-57
RGD|1310478 838 Spata5 "spermatogenesis associ 0.980 0.356 0.385 7.6e-57
UNIPROTKB|E2RC37 893 SPATA5 "Uncharacterized protei 0.980 0.334 0.391 1.7e-56
UNIPROTKB|Q8NB90 893 SPATA5 "Spermatogenesis-associ 0.977 0.333 0.393 2.3e-56
TAIR|locus:2103555 1022 CIP111 "Cam interacting protei 0.318 0.094 0.567 3.3e-56
MGI|MGI:1927170 893 Spata5 "spermatogenesis associ 0.980 0.334 0.385 3.8e-56
UNIPROTKB|F1NLN4 SPATA5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 616 (221.9 bits), Expect = 3.9e-60, P = 3.9e-60
 Identities = 129/314 (41%), Positives = 191/314 (60%)

Query:     6 QSNGMKKCNGILIYGVNGTGKTSLIHSLASHMKVHTVVIQVADMFSKFYGEAEFRLKAAF 65
             +S G+    G+L+YG  GTGKT +  ++A+ +  H  VI   ++ SKFYGE+E RL+  F
Sbjct:   345 KSYGISPPRGVLLYGPPGTGKTLIAKAIANEVGAHVTVINGPEIISKFYGESESRLRQIF 404

Query:    66 XXXXXXXXXXXXXXXXXXXCTGRN--RSDQERRLLSCLVTQVDRLHE--LQACVVLLAVT 121
                                C  R   +++ E+R+++ L+T +D +     +  +V+L  T
Sbjct:   405 AEASLRRPSIIFIDELDALCPKREGAQNEVEKRVVASLLTLMDGIGSEGSEGQLVVLGAT 464

Query:   122 TSLDNVDVSLRTPGRLDQEIELPVPSRDQRAAILHCLLTKVPHSLSTDQIQQVAFITHGF 181
                  +D +LR PGR D+EIE+ +P+   R  IL  LL KVPHSL+  ++ Q+A   HG+
Sbjct:   465 NRPHALDAALRRPGRFDKEIEIGIPNAQDRLDILQKLLKKVPHSLTAAEMMQLADSAHGY 524

Query:   182 VGGDXXXXXXXXXXXXX----------VETEGTGQVL-SYDGVMRALDHVKPSAMRQVLV 230
             VG D                        +TE  G V+ +++  ++ +  V+PSAMR+V V
Sbjct:   525 VGADLAALCKEAGLYALRRALGKRAHPSDTEVAGSVMIAFNDFLQGMKDVRPSAMREVAV 584

Query:   231 EVPNVKWSDIGGQDEVKLKLRQSVEWPLKHPEAFARLGIKPPRGILMFGPPGCSKTMIAK 290
             +VP V WSDIGG ++VKLKL+Q+VEWPLKHP++F R+GI+PP+G+L++GPPGCSKTMIAK
Sbjct:   585 DVPKVSWSDIGGLEDVKLKLKQAVEWPLKHPDSFIRMGIQPPKGVLLYGPPGCSKTMIAK 644

Query:   291 ALATESKLNFISVK 304
             ALA ES LNF++VK
Sbjct:   645 ALAHESGLNFLAVK 658
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
DICTYBASE|DDB_G0278435 DDB_G0278435 "AAA ATPase domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
FB|FBgn0032450 CG5776 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1MFP1 SPATA5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RQN5 SPATA5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1310478 Spata5 "spermatogenesis associated 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RC37 SPATA5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NB90 SPATA5 "Spermatogenesis-associated protein 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2103555 CIP111 "Cam interacting protein 111" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:1927170 Spata5 "spermatogenesis associated 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query305
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 5e-83
COG0464 494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 8e-56
PRK03992 389 PRK03992, PRK03992, proteasome-activating nucleoti 1e-28
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 7e-28
COG1222 406 COG1222, RPT1, ATP-dependent 26S proteasome regula 3e-27
pfam00004131 pfam00004, AAA, ATPase family associated with vari 8e-27
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 7e-25
TIGR01242 364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 8e-24
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 1e-23
PTZ00454 398 PTZ00454, PTZ00454, 26S protease regulatory subuni 1e-23
TIGR03689 512 TIGR03689, pup_AAA, proteasome ATPase 1e-20
PRK10733 644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 4e-19
PTZ00454398 PTZ00454, PTZ00454, 26S protease regulatory subuni 1e-18
COG1223368 COG1223, COG1223, Predicted ATPase (AAA+ superfami 6e-18
TIGR01242364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 1e-17
TIGR01241 495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 3e-17
PTZ00361 438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 3e-17
COG1222406 COG1222, RPT1, ATP-dependent 26S proteasome regula 6e-16
COG1223 368 COG1223, COG1223, Predicted ATPase (AAA+ superfami 2e-14
TIGR01241 495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 2e-14
PTZ00361438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 7e-14
COG0465 596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 2e-13
CHL00176 638 CHL00176, ftsH, cell division protein; Validated 8e-13
CHL00176 638 CHL00176, ftsH, cell division protein; Validated 9e-13
PRK10733 644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 3e-12
COG0465 596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 2e-11
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 2e-11
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleoti 1e-09
pfam00004131 pfam00004, AAA, ATPase family associated with vari 3e-08
TIGR03689512 TIGR03689, pup_AAA, proteasome ATPase 9e-08
smart00382148 smart00382, AAA, ATPases associated with a variety 1e-07
CHL00195489 CHL00195, ycf46, Ycf46; Provisional 3e-07
COG0464 494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 5e-07
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 4e-06
CHL00195 489 CHL00195, ycf46, Ycf46; Provisional 4e-05
PRK04195 482 PRK04195, PRK04195, replication factor C large sub 3e-04
CHL00206 2281 CHL00206, ycf2, Ycf2; Provisional 6e-04
pfam01078 207 pfam01078, Mg_chelatase, Magnesium chelatase, subu 8e-04
PRK08116268 PRK08116, PRK08116, hypothetical protein; Validate 0.001
COG1484254 COG1484, DnaC, DNA replication protein [DNA replic 0.001
COG0593408 COG0593, DnaA, ATPase involved in DNA replication 0.001
COG0552340 COG0552, FtsY, Signal recognition particle GTPase 0.002
smart00382 148 smart00382, AAA, ATPases associated with a variety 0.003
PRK14974336 PRK14974, PRK14974, cell division protein FtsY; Pr 0.003
pfam13481154 pfam13481, AAA_25, AAA domain 0.004
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information 
 Score =  264 bits (676), Expect = 5e-83
 Identities = 130/314 (41%), Positives = 196/314 (62%), Gaps = 20/314 (6%)

Query: 9   GMKKCNGILIYGVNGTGKTSLIHSLASHMKVHTVVIQVADMFSKFYGEAEFRLKAAFDAA 68
           G++   G+L+YG  GTGKT L  ++A+    + + I   ++ SK+YGE+E RL+  F  A
Sbjct: 208 GIEPPKGVLLYGPPGTGKTLLAKAVANEAGAYFISINGPEIMSKYYGESEERLREIFKEA 267

Query: 69  LDHAPSLLLLDNLDVLCTGRNR--SDQERRLLSCLVTQVDRLHELQACVVLLAVTTSLDN 126
            ++APS++ +D +D +   R     + E+R+++ L+T +D L   +  V+++  T   D 
Sbjct: 268 EENAPSIIFIDEIDAIAPKREEVTGEVEKRVVAQLLTLMDGLKG-RGRVIVIGATNRPDA 326

Query: 127 VDVSLRTPGRLDQEIELPVPSRDQRAAILHCLLTKVPHSLSTDQIQQVAFITHGFVGGDL 186
           +D +LR PGR D+EI + VP +  R  IL      +P +   D + ++A +THGFVG DL
Sbjct: 327 LDPALRRPGRFDREIVIRVPDKRARKEILKVHTRNMPLAEDVD-LDKLAEVTHGFVGADL 385

Query: 187 ATLLSNATSALLVETEGTGQV----------------LSYDGVMRALDHVKPSAMRQVLV 230
           A L   A  A L      G++                ++    M AL  V+PSA+R+VLV
Sbjct: 386 AALAKEAAMAALRRFIREGKINFEAEEIPAEVLKELKVTMKDFMEALKMVEPSAIREVLV 445

Query: 231 EVPNVKWSDIGGQDEVKLKLRQSVEWPLKHPEAFARLGIKPPRGILMFGPPGCSKTMIAK 290
           EVPNV+WSDIGG +EVK +LR++VEWPLKHPE F ++GI+PP+G+L+FGPPG  KT++AK
Sbjct: 446 EVPNVRWSDIGGLEEVKQELREAVEWPLKHPEIFEKMGIRPPKGVLLFGPPGTGKTLLAK 505

Query: 291 ALATESKLNFISVK 304
           A+ATES  NFI+V+
Sbjct: 506 AVATESGANFIAVR 519

This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus. Length = 733
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|177094 CHL00195, ycf46, Ycf46; Provisional Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|177094 CHL00195, ycf46, Ycf46; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|214396 CHL00206, ycf2, Ycf2; Provisional Back     alignment and domain information
>gnl|CDD|144608 pfam01078, Mg_chelatase, Magnesium chelatase, subunit ChlI Back     alignment and domain information
>gnl|CDD|236153 PRK08116, PRK08116, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|224401 COG1484, DnaC, DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223666 COG0593, DnaA, ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223626 COG0552, FtsY, Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|237875 PRK14974, PRK14974, cell division protein FtsY; Provisional Back     alignment and domain information
>gnl|CDD|222165 pfam13481, AAA_25, AAA domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 305
KOG0733|consensus 802 100.0
KOG0730|consensus 693 100.0
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 100.0
KOG0735|consensus 952 100.0
KOG0736|consensus 953 100.0
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 100.0
KOG0730|consensus693 100.0
KOG0733|consensus802 100.0
KOG0741|consensus 744 100.0
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 100.0
KOG0734|consensus 752 100.0
KOG0738|consensus491 100.0
CHL00195489 ycf46 Ycf46; Provisional 100.0
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 100.0
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 100.0
KOG0731|consensus 774 100.0
KOG0739|consensus439 100.0
KOG0736|consensus953 100.0
KOG0727|consensus408 100.0
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 100.0
PRK03992389 proteasome-activating nucleotidase; Provisional 100.0
KOG0728|consensus404 100.0
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 100.0
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 100.0
KOG0735|consensus952 100.0
CHL00206 2281 ycf2 Ycf2; Provisional 100.0
KOG0652|consensus424 100.0
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 100.0
KOG0726|consensus440 100.0
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 99.98
KOG0737|consensus386 99.98
CHL00176 638 ftsH cell division protein; Validated 99.97
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.97
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.97
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.97
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.97
KOG0729|consensus435 99.97
KOG0732|consensus 1080 99.97
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 99.97
KOG0740|consensus428 99.96
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 99.96
KOG0651|consensus388 99.96
CHL00095 821 clpC Clp protease ATP binding subunit 99.94
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.93
PRK10865 857 protein disaggregation chaperone; Provisional 99.92
KOG0742|consensus630 99.91
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.91
CHL00195 489 ycf46 Ycf46; Provisional 99.91
PF00004132 AAA: ATPase family associated with various cellula 99.91
KOG0743|consensus457 99.88
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 99.87
COG1222 406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.85
CHL00181287 cbbX CbbX; Provisional 99.84
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.83
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.81
COG2884223 FtsE Predicted ATPase involved in cell division [C 99.8
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.8
COG1123 539 ATPase components of various ABC-type transport sy 99.8
COG1126240 GlnQ ABC-type polar amino acid transport system, A 99.78
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 99.78
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 99.78
KOG0744|consensus423 99.78
PRK10938 490 putative molybdenum transport ATP-binding protein 99.78
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 99.77
COG0488 530 Uup ATPase components of ABC transporters with dup 99.77
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.77
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 99.76
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 99.75
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 99.75
PRK10261 623 glutathione transporter ATP-binding protein; Provi 99.75
KOG0727|consensus 408 99.75
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 99.75
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 99.74
COG1117253 PstB ABC-type phosphate transport system, ATPase c 99.73
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 99.72
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 99.72
COG2256 436 MGS1 ATPase related to the helicase subunit of the 99.72
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.71
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 99.71
COG1136226 SalX ABC-type antimicrobial peptide transport syst 99.71
KOG0737|consensus 386 99.7
COG3842352 PotA ABC-type spermidine/putrescine transport syst 99.7
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 99.69
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 99.69
KOG0729|consensus 435 99.69
KOG0739|consensus 439 99.69
PRK15064 530 ABC transporter ATP-binding protein; Provisional 99.68
PRK13409 590 putative ATPase RIL; Provisional 99.68
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 99.68
PTZ00454 398 26S protease regulatory subunit 6B-like protein; P 99.68
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 99.68
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.67
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 99.67
KOG0738|consensus 491 99.67
PLN03073 718 ABC transporter F family; Provisional 99.67
COG1127263 Ttg2A ABC-type transport system involved in resist 99.66
PRK11147 635 ABC transporter ATPase component; Reviewed 99.66
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.66
KOG0927|consensus 614 99.65
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 99.65
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 99.64
KOG0731|consensus 774 99.63
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.63
PRK03992 389 proteasome-activating nucleotidase; Provisional 99.62
COG3638258 ABC-type phosphate/phosphonate transport system, A 99.62
KOG0728|consensus 404 99.62
KOG0652|consensus 424 99.62
KOG0726|consensus 440 99.62
PRK06893229 DNA replication initiation factor; Validated 99.61
COG4619223 ABC-type uncharacterized transport system, ATPase 99.61
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 99.6
COG4172 534 ABC-type uncharacterized transport system, duplica 99.6
PTZ00361 438 26 proteosome regulatory subunit 4-like protein; P 99.6
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 99.6
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.6
PRK04195 482 replication factor C large subunit; Provisional 99.59
PRK00149450 dnaA chromosomal replication initiation protein; R 99.59
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.58
KOG2028|consensus 554 99.58
PRK13342 413 recombination factor protein RarA; Reviewed 99.57
TIGR00362405 DnaA chromosomal replication initiator protein Dna 99.57
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.57
KOG0734|consensus 752 99.56
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 99.56
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 99.56
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 99.55
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.55
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 99.55
TIGR01242 364 26Sp45 26S proteasome subunit P45 family. Many pro 99.54
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 99.54
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 99.54
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 99.54
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 99.54
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 99.54
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.54
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.54
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 99.54
PRK14088440 dnaA chromosomal replication initiation protein; P 99.53
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 99.53
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 99.53
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 99.52
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 99.52
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 99.52
PRK12402337 replication factor C small subunit 2; Reviewed 99.52
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.51
KOG0651|consensus 388 99.51
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 99.51
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 99.51
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 99.5
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 99.5
PRK12422445 chromosomal replication initiation protein; Provis 99.5
COG1223 368 Predicted ATPase (AAA+ superfamily) [General funct 99.5
PTZ001121164 origin recognition complex 1 protein; Provisional 99.5
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 99.5
COG1123539 ATPase components of various ABC-type transport sy 99.5
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.49
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 99.49
PRK08084235 DNA replication initiation factor; Provisional 99.49
PRK10908222 cell division protein FtsE; Provisional 99.49
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 99.49
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.49
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 99.49
PRK14086617 dnaA chromosomal replication initiation protein; P 99.48
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 99.48
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 99.48
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 99.48
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 99.48
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 99.47
COG4175386 ProV ABC-type proline/glycine betaine transport sy 99.47
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 99.47
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.47
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 99.47
TIGR01186 363 proV glycine betaine/L-proline transport ATP bindi 99.47
PLN03025319 replication factor C subunit; Provisional 99.47
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 99.47
PHA02544316 44 clamp loader, small subunit; Provisional 99.46
PRK11000 369 maltose/maltodextrin transporter ATP-binding prote 99.46
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.46
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 99.46
PRK11607377 potG putrescine transporter ATP-binding subunit; P 99.46
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 99.46
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 99.46
COG0410237 LivF ABC-type branched-chain amino acid transport 99.46
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 99.46
PRK08727233 hypothetical protein; Validated 99.46
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 99.46
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 99.45
PRK13537306 nodulation ABC transporter NodI; Provisional 99.45
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 99.45
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 99.45
PRK11153343 metN DL-methionine transporter ATP-binding subunit 99.45
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 99.45
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 99.45
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 99.45
PRK13341 725 recombination factor protein RarA/unknown domain f 99.45
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 99.45
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 99.45
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 99.45
KOG0989|consensus346 99.45
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 99.44
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 99.44
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 99.44
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 99.44
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.44
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 99.44
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 99.44
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 99.43
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 99.43
PRK06620214 hypothetical protein; Validated 99.43
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 99.43
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 99.43
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 99.43
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.43
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 99.43
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 99.43
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 99.43
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 99.43
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 99.43
KOG0062|consensus 582 99.42
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 99.42
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 99.42
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 99.42
KOG1969|consensus 877 99.42
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 99.42
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 99.42
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 99.42
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 99.42
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 99.42
PRK13536340 nodulation factor exporter subunit NodI; Provision 99.42
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 99.42
PRK09087226 hypothetical protein; Validated 99.41
cd03269210 ABC_putative_ATPase This subfamily is involved in 99.41
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 99.41
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 99.41
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 99.41
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 99.41
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 99.41
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 99.41
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 99.41
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.41
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 99.4
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 99.4
COG4181228 Predicted ABC-type transport system involved in ly 99.4
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 99.4
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.4
COG4525259 TauB ABC-type taurine transport system, ATPase com 99.4
PRK10070 400 glycine betaine transporter ATP-binding subunit; P 99.4
PRK10619257 histidine/lysine/arginine/ornithine transporter su 99.4
COG1129 500 MglA ABC-type sugar transport system, ATPase compo 99.4
COG4161242 ArtP ABC-type arginine transport system, ATPase co 99.4
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 99.4
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 99.4
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 99.4
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 99.4
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 99.4
KOG0740|consensus 428 99.39
PRK05642234 DNA replication initiation factor; Validated 99.39
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 99.39
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 99.39
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 99.39
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 99.39
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 99.39
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 99.39
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 99.38
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 99.38
PRK09536 402 btuD corrinoid ABC transporter ATPase; Reviewed 99.38
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 99.38
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 99.38
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 99.38
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 99.38
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 99.38
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 99.38
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.37
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 99.37
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 99.37
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 99.37
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 99.37
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 99.37
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 99.37
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 99.37
PRK07940394 DNA polymerase III subunit delta'; Validated 99.37
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 99.37
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 99.37
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 99.36
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 99.36
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 99.36
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 99.36
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 99.36
PRK00440319 rfc replication factor C small subunit; Reviewed 99.36
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 99.36
KOG2004|consensus 906 99.36
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.36
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 99.36
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 99.36
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 99.36
KOG0058|consensus716 99.36
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 99.36
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 99.36
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 99.35
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 99.35
cd03216163 ABC_Carb_Monos_I This family represents the domain 99.35
cd03299235 ABC_ModC_like Archeal protein closely related to M 99.35
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 99.35
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 99.35
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 99.35
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 99.35
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 99.35
KOG0055|consensus 1228 99.35
COG4148352 ModC ABC-type molybdate transport system, ATPase c 99.34
cd03246173 ABCC_Protease_Secretion This family represents the 99.34
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 99.34
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.34
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 99.34
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 99.34
CHL00176 638 ftsH cell division protein; Validated 99.34
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 99.34
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 99.34
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 99.34
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 99.34
PRK14087450 dnaA chromosomal replication initiation protein; P 99.34
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 99.33
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 99.33
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 99.33
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.33
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 99.33
PRK10261623 glutathione transporter ATP-binding protein; Provi 99.33
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 99.33
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 99.33
COG4987573 CydC ABC-type transport system involved in cytochr 99.32
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 99.32
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 99.32
cd03215182 ABC_Carb_Monos_II This family represents domain II 99.32
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 99.32
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 99.32
COG4618580 ArpD ABC-type protease/lipase transport system, AT 99.32
COG4988559 CydD ABC-type transport system involved in cytochr 99.32
PRK09473330 oppD oligopeptide transporter ATP-binding componen 99.32
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 99.32
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 99.32
PRK09984262 phosphonate/organophosphate ester transporter subu 99.32
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 99.32
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 99.31
smart00382148 AAA ATPases associated with a variety of cellular 99.31
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 99.31
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 99.31
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 99.31
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 99.31
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 99.31
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 99.31
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 99.31
COG3845 501 ABC-type uncharacterized transport systems, ATPase 99.31
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 99.3
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 99.3
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 99.3
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 99.3
KOG1051|consensus 898 99.3
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 99.3
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 99.3
PRK14242253 phosphate transporter ATP-binding protein; Provisi 99.3
PRK14235267 phosphate transporter ATP-binding protein; Provisi 99.3
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 99.3
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 99.3
PRK10253265 iron-enterobactin transporter ATP-binding protein; 99.3
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 99.29
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 99.29
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 99.29
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 99.29
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 99.29
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 99.29
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 99.29
PRK00635 1809 excinuclease ABC subunit A; Provisional 99.29
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 99.29
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 99.29
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 99.29
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 99.29
PRK14241258 phosphate transporter ATP-binding protein; Provisi 99.28
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 99.28
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 99.28
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 99.28
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 99.28
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 99.28
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 99.28
PRK14237267 phosphate transporter ATP-binding protein; Provisi 99.28
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 99.28
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 99.28
PRK13546264 teichoic acids export protein ATP-binding subunit; 99.28
PRK14243264 phosphate transporter ATP-binding protein; Provisi 99.28
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 99.28
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 99.28
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 99.28
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 99.27
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 99.27
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 99.27
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 99.27
PRK14240250 phosphate transporter ATP-binding protein; Provisi 99.27
KOG0743|consensus 457 99.27
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 99.27
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 99.27
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 99.27
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 99.27
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 99.27
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 99.27
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 99.27
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 99.27
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 99.26
cd03234226 ABCG_White The White subfamily represents ABC tran 99.26
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 99.26
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 99.26
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 99.26
COG0593408 DnaA ATPase involved in DNA replication initiation 99.26
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 99.26
PRK14238271 phosphate transporter ATP-binding protein; Provisi 99.25
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 99.25
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 99.25
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 99.25
COG4559259 ABC-type hemin transport system, ATPase component 99.25
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 99.25
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 99.25
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 99.25
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 99.25
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 99.25
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 99.25
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 99.25
KOG0732|consensus 1080 99.24
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 99.24
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 99.24
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 99.24
PRK09700510 D-allose transporter ATP-binding protein; Provisio 99.24
TIGR01187325 potA spermidine/putrescine ABC transporter ATP-bin 99.24
PRK14239252 phosphate transporter ATP-binding protein; Provisi 99.24
PF05496 233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.24
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 99.24
KOG0741|consensus744 99.24
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 99.23
COG1119257 ModF ABC-type molybdenum transport system, ATPase 99.23
PRK03695248 vitamin B12-transporter ATPase; Provisional 99.23
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 99.23
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 99.23
PRK14236272 phosphate transporter ATP-binding protein; Provisi 99.23
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 99.23
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 99.23
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.22
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 99.22
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 99.22
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 99.22
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 99.22
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 99.22
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 99.22
PRK10790592 putative multidrug transporter membrane\ATP-bindin 99.22
PRK09580248 sufC cysteine desulfurase ATPase component; Review 99.22
PRK11288501 araG L-arabinose transporter ATP-binding protein; 99.22
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 99.22
COG4172534 ABC-type uncharacterized transport system, duplica 99.21
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 99.21
KOG0066|consensus 807 99.21
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 99.21
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 99.21
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 99.21
COG4598256 HisP ABC-type histidine transport system, ATPase c 99.21
KOG0057|consensus591 99.21
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 99.2
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 99.2
PRK13409590 putative ATPase RIL; Provisional 99.2
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 99.2
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 99.2
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.2
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 99.2
COG4136213 ABC-type uncharacterized transport system, ATPase 99.19
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 99.19
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 99.19
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 99.19
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 99.19
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 99.19
PLN00020 413 ribulose bisphosphate carboxylase/oxygenase activa 99.18
COG0411250 LivG ABC-type branched-chain amino acid transport 99.18
COG4133209 CcmA ABC-type transport system involved in cytochr 99.18
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 99.18
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 99.17
PTZ002651466 multidrug resistance protein (mdr1); Provisional 99.17
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 99.17
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 99.17
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 99.17
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 99.17
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 99.17
PRK10789569 putative multidrug transporter membrane\ATP-bindin 99.17
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.16
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 99.16
COG4152300 ABC-type uncharacterized transport system, ATPase 99.16
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 99.16
PRK10762501 D-ribose transporter ATP binding protein; Provisio 99.16
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 99.16
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 99.15
PRK04132846 replication factor C small subunit; Provisional 99.14
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 99.14
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 99.14
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 99.14
PRK10535 648 macrolide transporter ATP-binding /permease protei 99.14
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 99.14
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 99.14
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 99.14
>KOG0733|consensus Back     alignment and domain information 
Probab=100.00  E-value=9.3e-71  Score=474.40  Aligned_cols=302  Identities=36%  Similarity=0.611  Sum_probs=278.7

Q ss_pred             hhhHHhcCCCCcceEEEEcCCCCcHHHHHHHHHhhcCCeEEEEecccccccccchHHHHHHHHHHHHHhCCCeEEEEccc
Q psy5649           2 DYALQSNGMKKCNGILIYGVNGTGKTSLIHSLASHMKVHTVVIQVADMFSKFYGEAEFRLKAAFDAALDHAPSLLLLDNL   81 (305)
Q Consensus         2 ~~~~~~~~~~~~~~vll~Gp~G~GKTtl~~~la~~l~~~~~~v~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~vl~ide~   81 (305)
                      .+.|.++|+.+++++||+||||||||.||+++|++++.+|+.|++..+.+.+.|+.|++++++|+.|...+|||+||||+
T Consensus       212 Pe~~~~lGv~PprGvLlHGPPGCGKT~lA~AiAgel~vPf~~isApeivSGvSGESEkkiRelF~~A~~~aPcivFiDeI  291 (802)
T KOG0733|consen  212 PEVFSSLGVRPPRGVLLHGPPGCGKTSLANAIAGELGVPFLSISAPEIVSGVSGESEKKIRELFDQAKSNAPCIVFIDEI  291 (802)
T ss_pred             chhHhhcCCCCCCceeeeCCCCccHHHHHHHHhhhcCCceEeecchhhhcccCcccHHHHHHHHHHHhccCCeEEEeecc
Confidence            46789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccCCCCCc--hhHHHHHHHHHHHHhhhccc---CCeEEEEEEecCCCCCCccccCCCCcceEEEccCCCHHHHHHHHH
Q psy5649          82 DVLCTGRNRS--DQERRLLSCLVTQVDRLHEL---QACVVLLAVTTSLDNVDVSLRTPGRLDQEIELPVPSRDQRAAILH  156 (305)
Q Consensus        82 d~l~~~~~~~--~~~~~~~~~l~~~~~~~~~~---~~~~~~i~~t~~~~~l~~~l~~~~r~~~~i~~~~p~~~~r~~i~~  156 (305)
                      |.+.+++...  +.+++.+++|+..|+.+...   ..+|+||++||+++.++++|||.|||+++|++.+|+..+|..|++
T Consensus       292 DAI~pkRe~aqreMErRiVaQLlt~mD~l~~~~~~g~~VlVIgATnRPDslDpaLRRaGRFdrEI~l~vP~e~aR~~IL~  371 (802)
T KOG0733|consen  292 DAITPKREEAQREMERRIVAQLLTSMDELSNEKTKGDPVLVIGATNRPDSLDPALRRAGRFDREICLGVPSETAREEILR  371 (802)
T ss_pred             cccccchhhHHHHHHHHHHHHHHHhhhcccccccCCCCeEEEecCCCCcccCHHHhccccccceeeecCCchHHHHHHHH
Confidence            9999998765  56789999999999988764   478999999999999999999999999999999999999999999


Q ss_pred             HHHhcCCCCCCHHhHHHHHHHcCCCcHHhHHHHHHHHHHHHhhhhc----------------------------------
Q psy5649         157 CLLTKVPHSLSTDQIQQVAFITHGFVGGDLATLLSNATSALLVETE----------------------------------  202 (305)
Q Consensus       157 ~~l~~~~~~ls~~~~~~la~~t~g~~~~di~~l~~~~~~~~~~~~~----------------------------------  202 (305)
                      ..++.......- +..++|..|+||+|+|+.+|+..|...++++..                                  
T Consensus       372 ~~~~~lrl~g~~-d~~qlA~lTPGfVGADL~AL~~~Aa~vAikR~ld~~~~p~~~~~~~ed~~~~~~~~d~S~i~~~~~~  450 (802)
T KOG0733|consen  372 IICRGLRLSGDF-DFKQLAKLTPGFVGADLMALCREAAFVAIKRILDQSSSPLTKVPISEDSSNKDAEEDQSSIKITSNA  450 (802)
T ss_pred             HHHhhCCCCCCc-CHHHHHhcCCCccchhHHHHHHHHHHHHHHHHhhcccCccccCCccccccCCCccchhhhhhcCCcc
Confidence            888876655533 788999999999999999999999887764311                                  


Q ss_pred             -------------------------CCCccccHHHHHHHhhhcCCchhhhhhccCCCCCcccccchHHHHHHHHHHhhcc
Q psy5649         203 -------------------------GTGQVLSYDGVMRALDHVKPSAMRQVLVEVPNVKWSDIGGQDEVKLKLRQSVEWP  257 (305)
Q Consensus       203 -------------------------~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~~l~~~~~~~  257 (305)
                                               .+.-.+..+||.+|+..++|+..+..+.+.|++.|+|||++++++.++...+.||
T Consensus       451 ~~~~~ld~v~~~~i~~~~d~~S~E~~~~L~i~~eDF~~Al~~iQPSakREGF~tVPdVtW~dIGaL~~vR~eL~~aI~~P  530 (802)
T KOG0733|consen  451 ERPLELDRVVQDAILNNPDPLSKELLEGLSIKFEDFEEALSKIQPSAKREGFATVPDVTWDDIGALEEVRLELNMAILAP  530 (802)
T ss_pred             cccccHHHHHHHHHHhCCCCcChHHhccceecHHHHHHHHHhcCcchhcccceecCCCChhhcccHHHHHHHHHHHHhhh
Confidence                                     0011245788999999999999999999999999999999999999999999999


Q ss_pred             CCCHHHHHhcCCCCCcceeeecCCCchHHHHHHHHhhhcCceeEEee
Q psy5649         258 LKHPEAFARLGIKPPRGILMFGPPGCSKTMIAKALATESKLNFISVK  304 (305)
Q Consensus       258 ~~~~~~~~~~~~~~~~gill~GppG~GKT~la~~lA~~~~~~~~~v~  304 (305)
                      +++++.|+++|++.|.|+||+||||||||+||||+|+|.|+|||+||
T Consensus       531 iK~pd~~k~lGi~~PsGvLL~GPPGCGKTLlAKAVANEag~NFisVK  577 (802)
T KOG0733|consen  531 IKRPDLFKALGIDAPSGVLLCGPPGCGKTLLAKAVANEAGANFISVK  577 (802)
T ss_pred             ccCHHHHHHhCCCCCCceEEeCCCCccHHHHHHHHhhhccCceEeec
Confidence            99999999999999999999999999999999999999999999997

>KOG0730|consensus Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0731|consensus Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>KOG0727|consensus Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>KOG0728|consensus Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>KOG0652|consensus Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>KOG0726|consensus Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0737|consensus Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>KOG0729|consensus Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>KOG0740|consensus Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0651|consensus Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>KOG0742|consensus Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>KOG0743|consensus Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0727|consensus Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>KOG0737|consensus Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0729|consensus Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>KOG0927|consensus Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0731|consensus Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0728|consensus Back     alignment and domain information
>KOG0652|consensus Back     alignment and domain information
>KOG0726|consensus Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0651|consensus Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>KOG0062|consensus Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>KOG1969|consensus Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>KOG0740|consensus Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>KOG2004|consensus Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>KOG0058|consensus Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>KOG0055|consensus Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>KOG1051|consensus Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0743|consensus Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0066|consensus Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0057|consensus Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query305
1r7r_A 816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 1e-44
1r7r_A 816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 8e-14
3cf1_A 806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 1e-44
3cf1_A 806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 5e-14
3cf0_A 301 Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH 6e-23
3hu1_A489 Structure Of P97 N-D1 R95g Mutant In Complex With A 9e-23
3hu1_A 489 Structure Of P97 N-D1 R95g Mutant In Complex With A 4e-14
3hu3_A489 Structure Of P97 N-D1 R155h Mutant In Complex With 9e-23
3hu3_A 489 Structure Of P97 N-D1 R155h Mutant In Complex With 4e-14
3hu2_A489 Structure Of P97 N-D1 R86a Mutant In Complex With A 9e-23
3hu2_A 489 Structure Of P97 N-D1 R86a Mutant In Complex With A 4e-14
3h4m_A 285 Aaa Atpase Domain Of The Proteasome- Activating Nuc 3e-20
2x8a_A 274 Human Nuclear Valosin Containing Protein Like (Nvl) 7e-18
4b4t_H 467 Near-Atomic Resolution Structural Model Of The Yeas 6e-17
1e32_A458 Structure Of The N-Terminal Domain And The D1 Aaa D 1e-16
1e32_A 458 Structure Of The N-Terminal Domain And The D1 Aaa D 6e-14
4b4t_K 428 Near-Atomic Resolution Structural Model Of The Yeas 2e-16
4b4t_L 437 Near-Atomic Resolution Structural Model Of The Yeas 3e-15
4b4t_I 437 Near-Atomic Resolution Structural Model Of The Yeas 4e-15
2qz4_A 262 Human Paraplegin, Aaa Domain In Complex With Adp Le 2e-14
2r62_A 268 Crystal Structure Of Helicobacter Pylori Atp Depend 1e-13
2qp9_X 355 Crystal Structure Of S.Cerevisiae Vps4 Length = 355 3e-13
3eih_A 340 Crystal Structure Of S.Cerevisiae Vps4 In The Prese 3e-13
3eie_A 322 Crystal Structure Of S.Cerevisiae Vps4 In The So4-B 3e-13
3d8b_A 357 Crystal Structure Of Human Fidgetin-Like Protein 1 4e-13
2rko_A 331 Crystal Structure Of The Vps4p-Dimer Length = 331 4e-13
2zam_A 444 Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt 1e-12
4b4t_J 405 Near-Atomic Resolution Structural Model Of The Yeas 2e-12
1xwi_A 322 Crystal Structure Of Vps4b Length = 322 2e-12
1lv7_A 257 Crystal Structure Of The Aaa Domain Of Ftsh Length 1e-11
4b4t_M 434 Near-Atomic Resolution Structural Model Of The Yeas 1e-11
3vfd_A 389 Human Spastin Aaa Domain Length = 389 2e-11
3b9p_A 297 Spastin Length = 297 3e-11
2ce7_A 476 Edta Treated Length = 476 5e-11
3kds_E 465 Apo-ftsh Crystal Structure Length = 465 2e-10
4eiw_A 508 Whole Cytosolic Region Of Atp-Dependent Metalloprot 5e-10
2dhr_A 499 Whole Cytosolic Region Of Atp-Dependent Metalloprot 5e-10
1iy2_A 278 Crystal Structure Of The Ftsh Atpase Domain From Th 5e-10
1ixz_A 254 Crystal Structure Of The Ftsh Atpase Domain From Th 8e-10
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure 
Iteration: 1

 Score =  176 bits (446), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 103/312 (33%), Positives = 167/312 (53%), Gaps = 18/312 (5%)
Query: 9   GMKKCNGILIYGVNGTGKTSLIHSLASHMKVHTVVIQVADMFSKFYGEAEFRLKAAFXXX 68
           G+K   GIL+YG  GTGKT +  ++A+       +I   ++ SK  GE+E  L+ AF   
Sbjct: 234 GVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEA 293
Query: 69  XXXXXXXXXXXXXXXXCTGRNRS--DQERRLLSCLVTQVDRLHELQACVVLLAVTTSLDN 126
                              R ++  + ERR++S L+T +D L + +A V+++A T   ++
Sbjct: 294 EKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQ-RAHVIVMAATNRPNS 352
Query: 127 VDVSLRTPGRLDQEIELPVPSRDQRAAILHCLLTKVPHSLSTDQIQQVAFITHGFVGGDX 186
           +D +LR  GR D+E+++ +P    R  IL      +  +   D ++QVA  THG VG D 
Sbjct: 353 IDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVD-LEQVANETHGHVGADL 411
Query: 187 XXXXXXXX-------------XXXXVETEGTGQV-LSYDGVMRALDHVKPSAMRQVLVEV 232
                                    ++ E    + ++ D    AL    PSA+R+ +VEV
Sbjct: 412 AALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEV 471
Query: 233 PNVKWSDIGGQDEVKLKLRQSVEWPLKHPEAFARLGIKPPRGILMFGPPGCSKTMIAKAL 292
           P V W DIGG ++VK +L++ V++P++HP+ F + G+ P +G+L +GPPGC KT++AKA+
Sbjct: 472 PQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAI 531
Query: 293 ATESKLNFISVK 304
           A E + NFIS+K
Sbjct: 532 ANECQANFISIK 543
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure
>pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 Back     alignment and structure
>pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 Back     alignment and structure
>pdb|2X8A|A Chain A, Human Nuclear Valosin Containing Protein Like (Nvl), C- Terminal Aaa-Atpase Domain Length = 274 Back     alignment and structure
>pdb|4B4T|H Chain H, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 467 Back     alignment and structure
>pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 Back     alignment and structure
>pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 Back     alignment and structure
>pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 Back     alignment and structure
>pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|4B4T|I Chain I, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|2QZ4|A Chain A, Human Paraplegin, Aaa Domain In Complex With Adp Length = 262 Back     alignment and structure
>pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 Back     alignment and structure
>pdb|2QP9|X Chain X, Crystal Structure Of S.Cerevisiae Vps4 Length = 355 Back     alignment and structure
>pdb|3EIH|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The Presence Of Atpgammas Length = 340 Back     alignment and structure
>pdb|3EIE|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The So4-Bound State Length = 322 Back     alignment and structure
>pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357 Back     alignment and structure
>pdb|2RKO|A Chain A, Crystal Structure Of The Vps4p-Dimer Length = 331 Back     alignment and structure
>pdb|2ZAM|A Chain A, Crystal Structure Of Mouse Skd1VPS4B APO-Form Length = 444 Back     alignment and structure
>pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 Back     alignment and structure
>pdb|1XWI|A Chain A, Crystal Structure Of Vps4b Length = 322 Back     alignment and structure
>pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 Back     alignment and structure
>pdb|4B4T|M Chain M, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 Back     alignment and structure
>pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 Back     alignment and structure
>pdb|3B9P|A Chain A, Spastin Length = 297 Back     alignment and structure
>pdb|2CE7|A Chain A, Edta Treated Length = 476 Back     alignment and structure
>pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 Back     alignment and structure
>pdb|4EIW|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 508 Back     alignment and structure
>pdb|2DHR|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 499 Back     alignment and structure
>pdb|1IY2|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 278 Back     alignment and structure
>pdb|1IXZ|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 254 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query305
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 1e-117
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 2e-52
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 3e-30
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 3e-64
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 5e-34
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 1e-52
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 2e-33
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 2e-48
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 1e-31
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 4e-36
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 1e-31
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 1e-35
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 3e-30
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 2e-35
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 2e-29
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 9e-35
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 2e-31
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 1e-34
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 9e-30
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 9e-34
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 1e-30
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 1e-33
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 5e-33
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 4e-33
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 6e-32
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 1e-22
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 1e-19
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 1e-21
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 1e-20
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 7e-18
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 4e-15
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 1e-17
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 3e-17
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 2e-17
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 3e-17
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 2e-17
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 2e-17
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 2e-17
2r62_A268 Cell division protease FTSH homolog; ATPase domain 6e-17
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 2e-16
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 2e-09
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 2e-15
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 2e-08
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 2e-05
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 1e-06
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 7e-06
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 9e-04
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 1e-05
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 2e-05
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 7e-05
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 3e-04
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 384 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 386 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Length = 456 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Length = 389 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Length = 202 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query305
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 100.0
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 100.0
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 100.0
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 100.0
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 100.0
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 100.0
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 100.0
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 100.0
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 100.0
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 100.0
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 100.0
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 100.0
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 100.0
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.98
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 99.98
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 99.97
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.97
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.97
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 99.97
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.97
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.96
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.96
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.96
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.96
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.96
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.96
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 99.96
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 99.95
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.95
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.94
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.94
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 99.93
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 99.86
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 99.85
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.83
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.83
4b4t_I 437 26S protease regulatory subunit 4 homolog; hydrola 99.83
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.83
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 99.82
4b4t_H 467 26S protease regulatory subunit 7 homolog; hydrola 99.82
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 99.81
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.78
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.77
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.76
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 99.76
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 99.74
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 99.73
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 99.72
3bos_A242 Putative DNA replication factor; P-loop containing 99.71
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 99.71
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 99.71
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 99.7
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 99.7
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 99.7
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 99.7
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.69
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.69
2v1u_A387 Cell division control protein 6 homolog; DNA repli 99.69
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 99.69
3pvs_A 447 Replication-associated recombination protein A; ma 99.69
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 99.65
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 99.65
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.65
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.65
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.64
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 99.64
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 99.64
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 99.64
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 99.64
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 99.63
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 99.62
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 99.62
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.61
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 99.61
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 99.61
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.6
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.59
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 99.59
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 99.59
2r44_A331 Uncharacterized protein; putative ATPase, structur 99.58
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 99.58
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 99.58
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 99.58
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 99.58
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 99.57
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 99.57
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 99.56
2chq_A319 Replication factor C small subunit; DNA-binding pr 99.56
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 99.54
1g6h_A257 High-affinity branched-chain amino acid transport 99.54
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 99.53
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.53
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 99.53
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 99.53
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 99.52
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 99.52
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 99.52
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 99.52
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 99.51
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 99.51
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 99.5
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 99.5
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 99.5
1b0u_A262 Histidine permease; ABC transporter, transport pro 99.49
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 99.49
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 99.49
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.48
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 99.48
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 99.48
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 99.48
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 99.47
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 99.46
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 99.46
1sgw_A214 Putative ABC transporter; structural genomics, P p 99.46
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.44
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.44
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 99.44
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 99.43
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 99.43
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.43
1ji0_A240 ABC transporter; ATP binding protein, structural g 99.43
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.42
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.42
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 99.42
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 99.42
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 99.42
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 99.41
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 99.41
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 99.41
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.41
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 99.4
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 99.39
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.38
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 99.38
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 99.38
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 99.37
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 99.36
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 99.36
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 99.36
2ghi_A260 Transport protein; multidrug resistance protein, M 99.35
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 99.35
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.34
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 99.34
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 99.34
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 99.33
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 99.33
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 99.32
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.32
1ojl_A304 Transcriptional regulatory protein ZRAR; response 99.31
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 99.3
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 99.3
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 99.25
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 99.23
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 99.23
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 99.23
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 99.23
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 99.23
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 99.23
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 99.2
2kjq_A149 DNAA-related protein; solution structure, NESG, st 99.19
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 99.19
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 99.19
3co5_A143 Putative two-component system transcriptional RES 99.14
2gno_A305 DNA polymerase III, gamma subunit-related protein; 99.14
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 99.14
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 99.13
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.12
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.12
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 99.11
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 99.09
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 99.07
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 99.04
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 99.03
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 99.03
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 99.02
3kw6_A78 26S protease regulatory subunit 8; structural geno 99.01
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 98.97
2krk_A86 26S protease regulatory subunit 8; structural geno 98.96
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 98.96
2fna_A357 Conserved hypothetical protein; structural genomic 98.93
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 98.91
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 98.91
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 98.89
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 98.84
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 98.82
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 98.79
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 98.79
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 98.78
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 98.78
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 98.77
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 98.76
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 98.76
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 98.75
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 98.74
1tue_A212 Replication protein E1; helicase, replication, E1E 98.73
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 98.73
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 98.71
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 98.69
2cvh_A220 DNA repair and recombination protein RADB; filamen 98.69
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 98.67
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 98.66
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 98.66
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 98.64
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 98.64
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 98.63
2qgz_A308 Helicase loader, putative primosome component; str 98.63
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 98.61
4a74_A231 DNA repair and recombination protein RADA; hydrola 98.6
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 98.58
1jbk_A 195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 98.57
2eyu_A261 Twitching motility protein PILT; pilus retraction 98.57
3ec2_A 180 DNA replication protein DNAC; helicase loader, rep 98.57
3pvs_A 447 Replication-associated recombination protein A; ma 98.56
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 98.55
2p65_A 187 Hypothetical protein PF08_0063; CLPB, malaria, str 98.54
2r44_A 331 Uncharacterized protein; putative ATPase, structur 98.54
3co5_A143 Putative two-component system transcriptional RES 98.53
3pih_A 916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 98.52
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 98.5
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 98.48
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 98.47
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 98.46
4aby_A415 DNA repair protein RECN; hydrolase, double strand 98.45
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 98.45
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 98.44
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 98.44
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 98.42
2chg_A 226 Replication factor C small subunit; DNA-binding pr 98.42
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 98.41
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 98.41
3pih_A916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 98.41
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 98.4
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 98.38
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 98.38
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 98.37
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 98.37
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 98.36
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 98.36
3vaa_A199 Shikimate kinase, SK; structural genomics, center 98.36
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 98.35
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 98.35
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 98.34
2ygr_A993 Uvrabc system protein A; hydrolase, nucleotide exc 98.33
2chq_A 319 Replication factor C small subunit; DNA-binding pr 98.33
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 98.31
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 98.31
1svm_A 377 Large T antigen; AAA+ fold, viral protein; HET: AT 98.31
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 98.31
2ewv_A372 Twitching motility protein PILT; pilus retraction 98.31
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 98.3
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 98.3
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 98.29
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 98.28
2z43_A324 DNA repair and recombination protein RADA; archaea 98.28
1xp8_A366 RECA protein, recombinase A; recombination, radior 98.27
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 98.27
2vf7_A842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 98.27
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 98.27
2r6f_A972 Excinuclease ABC subunit A; UVRA, nucleotide excis 98.26
1tue_A 212 Replication protein E1; helicase, replication, E1E 98.25
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 98.25
3f8t_A506 Predicted ATPase involved in replication control, 98.25
3bos_A 242 Putative DNA replication factor; P-loop containing 98.24
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 98.22
1kag_A173 SKI, shikimate kinase I; transferase, structural g 98.21
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 98.21
2w58_A 202 DNAI, primosome component (helicase loader); ATP-b 98.21
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 98.2
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 98.2
1njg_A 250 DNA polymerase III subunit gamma; rossman-like fol 98.19
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 98.19
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 98.19
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 98.17
3umf_A 217 Adenylate kinase; rossmann fold, transferase; 2.05 98.16
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 98.16
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 98.15
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 98.15
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 98.15
3io5_A333 Recombination and repair protein; storage dimer, i 98.14
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 98.14
1u0j_A 267 DNA replication protein; AAA+ protein, P-loop atpa 98.13
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 98.13
1u94_A356 RECA protein, recombinase A; homologous recombinat 98.12
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.12
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 98.11
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 98.1
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 98.1
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 98.1
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 98.09
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 98.09
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 98.09
3nwj_A 250 ATSK2; P loop, shikimate, nucleoside monophosphate 98.09
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 98.07
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 98.07
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 98.07
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 98.07
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 98.06
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 98.05
4eun_A 200 Thermoresistant glucokinase; putative sugar kinase 98.05
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 98.04
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 98.03
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 98.03
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 98.02
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 98.01
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 98.01
2qgz_A 308 Helicase loader, putative primosome component; str 98.0
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 97.99
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 97.99
1via_A175 Shikimate kinase; structural genomics, transferase 97.99
1e69_A322 Chromosome segregation SMC protein; structural mai 97.98
3tlx_A 243 Adenylate kinase 2; structural genomics, structura 97.98
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 97.98
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 97.97
2r6a_A454 DNAB helicase, replicative helicase; replication, 97.97
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 97.97
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 97.97
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 97.96
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 97.96
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 97.96
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 97.95
1p9r_A418 General secretion pathway protein E; bacterial typ 97.95
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 97.94
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 97.93
2bbw_A 246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 97.93
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 97.93
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 97.93
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 97.92
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 97.92
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 97.92
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 97.92
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 97.91
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 97.9
2oap_1511 GSPE-2, type II secretion system protein; hexameri 97.9
1vma_A306 Cell division protein FTSY; TM0570, structural gen 97.9
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 97.9
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 97.89
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 97.89
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 97.89
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 97.89
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 97.88
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 97.88
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 97.88
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 97.88
4e22_A 252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 97.88
2p5t_B 253 PEZT; postsegregational killing system, phosphoryl 97.87
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 97.87
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 97.86
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 97.86
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 97.86
2v9p_A 305 Replication protein E1; AAA+ molecular motor, DNA 97.85
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 97.85
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 97.84
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 97.84
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 97.83
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 97.82
2og2_A359 Putative signal recognition particle receptor; nuc 97.82
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 97.81
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 97.81
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 97.81
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 97.81
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 97.81
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 97.8
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 97.8
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 97.8
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 97.79
3tif_A 235 Uncharacterized ABC transporter ATP-binding prote; 97.79
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 97.79
2vli_A183 Antibiotic resistance protein; transferase, tunica 97.79
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 97.78
3r20_A233 Cytidylate kinase; structural genomics, seattle st 97.78
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 97.78
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 97.78
1g6h_A 257 High-affinity branched-chain amino acid transport 97.77
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 97.77
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 97.77
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 97.77
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 97.76
1b0u_A 262 Histidine permease; ABC transporter, transport pro 97.76
3tlx_A243 Adenylate kinase 2; structural genomics, structura 97.76
2pcj_A 224 ABC transporter, lipoprotein-releasing system ATP- 97.75
2cbz_A 237 Multidrug resistance-associated protein 1; ABC pro 97.75
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 97.75
3b9q_A 302 Chloroplast SRP receptor homolog, alpha subunit CP 97.75
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 97.74
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 97.74
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 97.74
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 97.74
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 97.74
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 97.74
2olj_A 263 Amino acid ABC transporter; ABC domain, ATPase, hy 97.74
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 97.73
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 97.73
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 97.73
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 97.73
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 97.72
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 97.72
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 97.72
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 97.72
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 97.71
1ji0_A 240 ABC transporter; ATP binding protein, structural g 97.71
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 97.71
2zu0_C 267 Probable ATP-dependent transporter SUFC; iron-sulf 97.7
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 97.7
1sgw_A 214 Putative ABC transporter; structural genomics, P p 97.7
1vpl_A 256 ABC transporter, ATP-binding protein; TM0544, stru 97.7
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 97.69
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 97.69
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 97.69
2vhj_A 331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 97.69
4g1u_C 266 Hemin import ATP-binding protein HMUV; membrane tr 97.68
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 97.67
2ghi_A 260 Transport protein; multidrug resistance protein, M 97.67
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 97.67
2pze_A 229 Cystic fibrosis transmembrane conductance regulat; 97.67
2qmh_A 205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 97.66
2og2_A 359 Putative signal recognition particle receptor; nuc 97.66
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 97.66
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 97.66
2d2e_A 250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 97.65
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 97.65
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 97.64
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 97.64
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 97.64
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 97.64
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 97.64
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 97.64
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 97.64
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 97.63
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 97.63
2ff7_A 247 Alpha-hemolysin translocation ATP-binding protein 97.63
3kta_A182 Chromosome segregation protein SMC; structural mai 97.63
2nq2_C 253 Hypothetical ABC transporter ATP-binding protein H 97.63
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 97.62
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 97.62
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 97.61
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 97.59
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 97.59
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 97.59
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 97.59
2ehv_A 251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 97.59
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 97.59
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 97.58
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 97.58
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 97.58
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 97.58
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 97.58
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 97.58
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 97.57
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 97.57
2f6r_A 281 COA synthase, bifunctional coenzyme A synthase; 18 97.57
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 97.56
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 97.56
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 97.56
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 97.56
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 97.56
2bbs_A 290 Cystic fibrosis transmembrane conductance regulato 97.55
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 97.55
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 97.54
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 97.54
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 97.54
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 97.53
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 97.53
1mv5_A 243 LMRA, multidrug resistance ABC transporter ATP-bin 97.53
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 97.53
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 97.52
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 97.52
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 97.49
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 97.48
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 97.47
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 97.46
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 97.44
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 97.44
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 97.43
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 97.43
3lnc_A 231 Guanylate kinase, GMP kinase; ALS collaborative cr 97.42
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 97.42
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 97.41
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 97.41
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 97.39
1pzn_A 349 RAD51, DNA repair and recombination protein RAD51, 97.39
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 97.39
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 97.39
3aez_A 312 Pantothenate kinase; transferase, homodimer, COA b 97.38
1sq5_A 308 Pantothenate kinase; P-loop, transferase; HET: PAU 97.36
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 97.36
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 97.35
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 97.35
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 97.35
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 97.34
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 97.34
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 97.33
2yhs_A 503 FTSY, cell division protein FTSY; cell cycle, prot 97.33
2fna_A 357 Conserved hypothetical protein; structural genomic 97.33
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 97.32
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 97.32
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 97.3
3tqc_A 321 Pantothenate kinase; biosynthesis of cofactors, pr 97.29
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 97.29
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 97.29
2ewv_A 372 Twitching motility protein PILT; pilus retraction 97.28
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
Probab=100.00  E-value=5.1e-60  Score=439.97  Aligned_cols=300  Identities=37%  Similarity=0.672  Sum_probs=273.0

Q ss_pred             hhHHhcCCCCcceEEEEcCCCCcHHHHHHHHHhhcCCeEEEEecccccccccchHHHHHHHHHHHHHhCCCeEEEEcccc
Q psy5649           3 YALQSNGMKKCNGILIYGVNGTGKTSLIHSLASHMKVHTVVIQVADMFSKFYGEAEFRLKAAFDAALDHAPSLLLLDNLD   82 (305)
Q Consensus         3 ~~~~~~~~~~~~~vll~Gp~G~GKTtl~~~la~~l~~~~~~v~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~vl~ide~d   82 (305)
                      +.|+.+++.+++++|||||||||||++++++|++++.+++.++++++.+++.|+.+..++.+|+.|..++||||||||+|
T Consensus       228 ~~f~~~g~~~p~GILL~GPPGTGKT~LAraiA~elg~~~~~v~~~~l~sk~~gese~~lr~lF~~A~~~~PsIIfIDEiD  307 (806)
T 3cf2_A          228 ALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELD  307 (806)
T ss_dssp             GGGTSCCCCCCCEEEEECCTTSCHHHHHHHHHTTTTCEEEEEEHHHHHSSCTTHHHHHHHHHHHHHTTSCSEEEEEESGG
T ss_pred             HHHhhcCCCCCCeEEEECCCCCCHHHHHHHHHHHhCCeEEEEEhHHhhcccchHHHHHHHHHHHHHHHcCCeEEEEehhc
Confidence            56888999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccCCCCCc--hhHHHHHHHHHHHHhhhcccCCeEEEEEEecCCCCCCccccCCCCcceEEEccCCCHHHHHHHHHHHHh
Q psy5649          83 VLCTGRNRS--DQERRLLSCLVTQVDRLHELQACVVLLAVTTSLDNVDVSLRTPGRLDQEIELPVPSRDQRAAILHCLLT  160 (305)
Q Consensus        83 ~l~~~~~~~--~~~~~~~~~l~~~~~~~~~~~~~~~~i~~t~~~~~l~~~l~~~~r~~~~i~~~~p~~~~r~~i~~~~l~  160 (305)
                      .+++.++..  +..++.+++++..++.+.. ...+++|++||.++.++++++|+|||+.+|+++.|+..+|.+|++.+++
T Consensus       308 al~~~r~~~~~~~~~riv~~LL~~mdg~~~-~~~V~VIaaTN~~d~LD~ALrR~GRFd~~I~i~~Pd~~~R~~IL~~~l~  386 (806)
T 3cf2_A          308 AIAPKREKTHGEVERRIVSQLLTLMDGLKQ-RAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTK  386 (806)
T ss_dssp             GTCCTTTTCCCTTHHHHHHHHHTHHHHCCG-GGCEEEEEECSSTTTSCTTTTSTTSSCEEEECCCCCHHHHHHHHHHTCS
T ss_pred             ccccccCCCCChHHHHHHHHHHHHHhcccc-cCCEEEEEecCChhhcCHHHhCCcccceEEecCCCCHHHHHHHHHHHhc
Confidence            999876543  4556788899999998876 5679999999999999999999999999999999999999999998777


Q ss_pred             cCCCCCCHHhHHHHHHHcCCCcHHhHHHHHHHHHHHHhhhhcC--------------CCccccHHHHHHHhhhcCCchhh
Q psy5649         161 KVPHSLSTDQIQQVAFITHGFVGGDLATLLSNATSALLVETEG--------------TGQVLSYDGVMRALDHVKPSAMR  226 (305)
Q Consensus       161 ~~~~~ls~~~~~~la~~t~g~~~~di~~l~~~~~~~~~~~~~~--------------~~~~~~~~~~~~~l~~~~~~~~~  226 (305)
                      +.+..-+ -++..+|..|+||+++||..++++|...++.+...              ....++.+||..++...+|+..+
T Consensus       387 ~~~~~~d-vdl~~lA~~T~GfsgaDL~~Lv~eA~~~A~~r~~~~i~~~~~~~~~e~~~~~~v~~~Df~~Al~~~~ps~~r  465 (806)
T 3cf2_A          387 NMKLADD-VDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALR  465 (806)
T ss_dssp             SSEECTT-CCHHHHHHHCCSCCHHHHHHHHHHHHHHHHHHHHHHGGGTCCCCSHHHHHHCEECTTHHHHHHSSSSCCCCC
T ss_pred             CCCCCcc-cCHHHHHHhcCCCCHHHHHHHHHHHHHHHHHhccccccccccccchhhhccceeeHHHHHHHHHhCCCcccc
Confidence            6554433 36899999999999999999999998877643210              11246678999999999999888


Q ss_pred             hhhccCCCCCcccccchHHHHHHHHHHhhccCCCHHHHHhcCCCCCcceeeecCCCchHHHHHHHHhhhcCceeEEee
Q psy5649         227 QVLVEVPNVKWSDIGGQDEVKLKLRQSVEWPLKHPEAFARLGIKPPRGILMFGPPGCSKTMIAKALATESKLNFISVK  304 (305)
Q Consensus       227 ~~~~~~~~~~~~~i~g~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~gill~GppG~GKT~la~~lA~~~~~~~~~v~  304 (305)
                      ....+.+...|++++|++++|+.+.+.+.||+++++.|.++|+.+++|+|||||||||||++|+++|++++.+|++|+
T Consensus       466 ~~~~~~p~v~w~diggl~~~k~~l~e~v~~p~~~p~~f~~~g~~~~~gvLl~GPPGtGKT~lAkaiA~e~~~~f~~v~  543 (806)
T 3cf2_A          466 ETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIK  543 (806)
T ss_dssp             CCCCBCCCCCSTTCCSCHHHHHHHTTTTTTTTTCSGGGSSSCCCCCSCCEEESSTTSSHHHHHHHHHHTTTCEEEECC
T ss_pred             cccccCCCCCHHHhCCHHHHHHHHHHHHHhhhhCHHHHHhcCCCCCceEEEecCCCCCchHHHHHHHHHhCCceEEec
Confidence            888889999999999999999999999999999999999999999999999999999999999999999999999986
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 305
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 3e-43
d1ixza_ 247 c.37.1.20 (A:) AAA domain of cell division protein 7e-28
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 4e-42
d1lv7a_ 256 c.37.1.20 (A:) AAA domain of cell division protein 7e-26
d1r7ra3 265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 1e-27
d1r7ra3265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 2e-27
d1e32a2 258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 3e-27
d1e32a2258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 4e-21
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 1e-19
d1w44a_ 321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 3e-14
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 4e-19
d1gvnb_ 273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 2e-10
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 9e-16
d1svma_ 362 c.37.1.20 (A:) Papillomavirus large T antigen heli 5e-09
d1d2na_246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 1e-15
d1d2na_ 246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 6e-07
d1ixsb2 239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 8e-11
d1ixsb2239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 4e-06
d1sxja2 253 c.37.1.20 (A:295-547) Replication factor C1 {Baker 8e-10
d1ofha_ 309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 7e-09
d1ofha_309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 1e-05
d1in4a2 238 c.37.1.20 (A:17-254) Holliday junction helicase Ru 4e-07
d1in4a2238 c.37.1.20 (A:17-254) Holliday junction helicase Ru 0.004
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 5e-07
d1fnna2 276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 0.003
d1g8pa_ 333 c.37.1.20 (A:) ATPase subunit of magnesium chelata 7e-06
d1g41a_ 443 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 2e-05
d1zaka1 189 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Mai 2e-04
d3adka_ 194 c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [ 4e-04
d1qf9a_ 194 c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoi 6e-04
d1rkba_ 173 c.37.1.1 (A:) Adenylate kinase {Human (Homo sapien 7e-04
d1ak2a1 190 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Co 8e-04
d1akya1 180 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Bak 0.001
d1um8a_ 364 c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 2 0.001
d1e4va1 179 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Esc 0.002
d2ak3a1 189 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow 0.002
d1zina1 182 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bac 0.003
d1yj5a2 172 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' p 0.003
d2cdna1 181 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium 0.003
d1sxje2 252 c.37.1.20 (E:4-255) Replication factor C5 {Baker's 0.004
d1ukza_ 196 c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Sac 0.004
d1y63a_ 174 c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishma 0.004
d1zp6a1 176 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { 0.004
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Thermus thermophilus [TaxId: 274]

 Score =  146 bits (370), Expect = 3e-43
 Identities = 61/208 (29%), Positives = 99/208 (47%), Gaps = 9/208 (4%)

Query: 5   LQSNGMKKCNGILIYGVNGTGKTSLIHSLASHMKVHTVVIQVADMFSKFYGEAEFRLKAA 64
               G +   G+L+ G  G GKT L  ++A   +V  +    +D    F G    R++  
Sbjct: 34  FHEMGARIPKGVLLVGPPGVGKTHLARAVAGEARVPFITASGSDFVEMFVGVGAARVRDL 93

Query: 65  FDAALDHAPSLLLLDNLDVLCTGRNR-----SDQERRLLSCLVTQVDRLHELQACVVLLA 119
           F+ A  HAP ++ +D +D +   R       +D+  + L+ L+ ++D   +  A +V++A
Sbjct: 94  FETAKRHAPCIVFIDEIDAVGRKRGSGVGGGNDEREQTLNQLLVEMDGFEKDTA-IVVMA 152

Query: 120 VTTSLDNVDVSLRTPGRLDQEIELPVPSRDQRAAILHCLLTKVPHSLSTDQIQQVAFITH 179
            T   D +D +L  PGR D++I +  P    R  IL       P +   D +  +A  T 
Sbjct: 153 ATNRPDILDPALLRPGRFDRQIAIDAPDVKGREQILRIHARGKPLAEDVD-LALLAKRTP 211

Query: 180 GFVGGDLATLLSNATSALLVETEGTGQV 207
           GFVG DL  LL+ A  ALL   EG  ++
Sbjct: 212 GFVGADLENLLNEA--ALLAAREGRRKI 237
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Length = 189 Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Length = 194 Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Length = 194 Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Length = 190 Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 180 Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Length = 364 Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Length = 189 Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Length = 182 Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 172 Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 252 Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 196 Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Length = 174 Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query305
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 100.0
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 100.0
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.93
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.9
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.81
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.79
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.76
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.75
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.74
d1ixza_ 247 AAA domain of cell division protein FtsH {Thermus 99.74
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 99.71
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 99.71
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 99.7
d2awna2232 Maltose transport protein MalK, N-terminal domain 99.7
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.69
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.69
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 99.68
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.68
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 99.68
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.68
d1g2912240 Maltose transport protein MalK, N-terminal domain 99.66
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.64
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 99.64
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 99.63
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.6
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.59
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.58
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 99.57
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.57
d1svma_362 Papillomavirus large T antigen helicase domain {Si 99.57
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.56
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 99.54
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 99.53
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 99.5
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 99.5
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 99.5
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 99.49
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.49
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.49
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 99.48
d2hyda1255 Putative multidrug export ATP-binding/permease pro 99.46
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 99.45
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 99.4
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.4
d1in4a2 238 Holliday junction helicase RuvB {Thermotoga mariti 99.36
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 99.35
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 99.33
d1ixsb2 239 Holliday junction helicase RuvB {Thermus thermophi 99.33
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 99.32
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.26
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.2
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 99.19
d1d2na_ 246 Hexamerization domain of N-ethylmalemide-sensitive 99.17
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 99.15
d1sxja2 253 Replication factor C1 {Baker's yeast (Saccharomyce 99.14
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 99.07
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 99.02
d1w44a_ 321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 98.99
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 98.98
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 98.95
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 98.94
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.93
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 98.92
d1svma_ 362 Papillomavirus large T antigen helicase domain {Si 98.82
d1iqpa2 231 Replication factor C {Archaeon Pyrococcus furiosus 98.82
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.72
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 98.69
d1sxjb2 224 Replication factor C4 {Baker's yeast (Saccharomyce 98.69
d1sxjc2 227 Replication factor C3 {Baker's yeast (Saccharomyce 98.66
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 98.6
d1njfa_ 239 delta prime subunit of DNA polymerase III, N-domai 98.6
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.59
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 98.56
d1sxjd2 237 Replication factor C2 {Baker's yeast (Saccharomyce 98.52
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 98.44
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 98.44
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 98.39
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 98.37
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 98.36
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 98.32
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.32
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 98.31
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 98.3
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 98.29
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 98.28
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 98.25
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 98.25
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 98.23
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 98.22
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 98.19
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 98.17
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 98.16
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 98.16
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 98.16
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 98.14
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 98.11
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 98.1
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 98.1
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 98.09
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 98.08
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 98.08
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 98.07
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 98.07
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 98.02
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 98.02
d1j8yf2211 GTPase domain of the signal sequence recognition p 98.01
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 98.01
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 98.01
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 97.98
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.97
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 97.97
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 97.96
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 97.95
d2qy9a2211 GTPase domain of the signal recognition particle r 97.93
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.9
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 97.89
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 97.88
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 97.88
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 97.86
d1l2ta_ 230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 97.84
d1v43a3 239 Hypothetical protein PH0022, N-terminal domain {Py 97.82
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.81
d1jbka_ 195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 97.8
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 97.79
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.79
d1vmaa2213 GTPase domain of the signal recognition particle r 97.78
d1g2912 240 Maltose transport protein MalK, N-terminal domain 97.77
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 97.77
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 97.76
d1r0wa_ 281 Cystic fibrosis transmembrane conductance regulato 97.75
d1okkd2207 GTPase domain of the signal recognition particle r 97.75
d3b60a1 253 Multidrug resistance ABC transporter MsbA, C-termi 97.75
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 97.74
d3dhwc1 240 Methionine import ATP-binding protein MetN {Escher 97.72
d1l8qa2 213 Chromosomal replication initiation factor DnaA {Aq 97.72
d1sgwa_ 200 Putative ABC transporter PF0895 {Pyrococcus furios 97.72
d1oxxk2 242 Glucose transport protein GlcV, N-terminal domain 97.71
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.7
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 97.69
d1jj7a_ 251 Peptide transporter Tap1, C-terminal ABC domain {H 97.68
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 97.66
d1g6ha_ 254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 97.64
d1ji0a_ 240 Branched chain aminoacid ABC transporter {Thermoto 97.63
d2pmka1 241 Haemolysin B ATP-binding protein {Escherichia coli 97.6
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.6
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 97.6
d2hyda1 255 Putative multidrug export ATP-binding/permease pro 97.56
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 97.52
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 97.5
d1b0ua_ 258 ATP-binding subunit of the histidine permease {Sal 97.47
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 97.47
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 97.47
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 97.43
d1vpla_ 238 Putative ABC transporter TM0544 {Thermotoga mariti 97.42
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 97.41
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 97.4
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 97.39
d1mv5a_ 242 Multidrug resistance ABC transporter LmrA, C-termi 97.39
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 97.38
d1szpa2 251 DNA repair protein Rad51, catalytic domain {Baker' 97.37
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 97.37
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 97.35
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 97.34
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 97.34
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 97.3
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 97.29
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 97.24
d1v5wa_ 258 Meiotic recombination protein DMC1/LIM15 homolog { 97.21
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 97.2
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 97.18
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 97.18
d1tuea_ 205 Replication protein E1 helicase domain {Human papi 97.16
d1tuea_205 Replication protein E1 helicase domain {Human papi 97.14
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 97.14
d1nrjb_209 Signal recognition particle receptor beta-subunit 97.12
d1pzna2 254 DNA repair protein Rad51, catalytic domain {Archae 97.11
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 97.08
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.08
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 97.08
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 97.08
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 97.07
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 97.05
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 97.05
d2fh5b1207 Signal recognition particle receptor beta-subunit 97.05
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 97.03
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 97.0
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 96.98
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.98
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.95
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.88
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 96.87
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 96.85
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 96.84
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 96.81
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 96.78
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 96.77
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 96.76
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 96.76
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 96.75
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 96.73
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 96.71
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 96.7
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 96.69
d1sq5a_ 308 Pantothenate kinase PanK {Escherichia coli [TaxId: 96.68
d2i1qa2 258 DNA repair protein Rad51, catalytic domain {Archae 96.66
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 96.66
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 96.63
d1u94a1 263 RecA protein, ATPase-domain {Escherichia coli [Tax 96.62
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 96.62
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 96.57
d2a5yb3 277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 96.53
d1g6oa_ 323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.52
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 96.49
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 96.48
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 96.47
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 96.46
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 96.44
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 96.44
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 96.42
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 96.41
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 96.37
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 96.36
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 96.35
d1mo6a1 269 RecA protein, ATPase-domain {Mycobacterium tubercu 96.35
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 96.34
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 96.33
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 96.3
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 96.28
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 96.27
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 96.24
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 96.24
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 96.24
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 96.22
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 96.2
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 96.2
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 96.19
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 96.19
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 96.19
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 96.19
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 96.18
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 96.18
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 96.18
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 96.17
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 96.17
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 96.16
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 96.15
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 96.12
d1w36d1 359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 96.1
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 96.09
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 96.06
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 96.06
d1u0ja_ 267 Rep 40 protein helicase domain {Adeno-associated v 96.06
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 96.04
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 96.03
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 96.03
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 96.02
d1xp8a1 268 RecA protein, ATPase-domain {Deinococcus radiodura 95.99
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 95.99
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 95.98
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 95.98
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 95.96
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 95.96
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 95.93
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 95.92
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 95.89
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 95.87
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 95.86
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 95.83
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 95.83
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 95.83
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 95.82
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 95.8
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 95.8
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 95.79
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 95.79
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 95.77
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 95.76
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 95.73
d1xpua3289 Transcription termination factor Rho, ATPase domai 95.7
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 95.63
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 95.62
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 95.61
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 95.61
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 95.55
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 95.54
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 95.51
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 95.5
d1xpua3 289 Transcription termination factor Rho, ATPase domai 95.47
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 95.42
d1wb9a2 234 DNA repair protein MutS, the C-terminal domain {Es 95.4
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 95.22
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 95.14
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 95.06
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 94.89
d1h65a_ 257 Chloroplast protein translocon GTPase Toc34 {Garde 94.88
d1t9ha2 231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 94.88
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 94.72
d1ewqa2 224 DNA repair protein MutS, the C-terminal domain {Th 94.6
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 94.46
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 94.4
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 94.29
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 94.23
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 94.13
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 94.07
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 93.97
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 93.89
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 93.84
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 93.82
d1j3ba1318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 93.79
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 93.58
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 93.56
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 93.47
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 93.42
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 93.32
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 93.28
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 93.24
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 93.21
d2jdid3 276 Central domain of beta subunit of F1 ATP synthase 93.17
d2olra1313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 93.12
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 92.94
d1ii2a1323 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 92.79
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 92.66
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 92.63
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 92.33
d1c9ka_180 Adenosylcobinamide kinase/adenosylcobinamide phosp 92.3
d2p6ra3 202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 91.92
d2eyqa3 233 Transcription-repair coupling factor, TRCF {Escher 91.1
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 91.05
d1gkub1 237 Helicase-like "domain" of reverse gyrase {Archaeon 90.85
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 90.84
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 90.81
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 90.5
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 90.49
d1fx0a3 276 Central domain of alpha subunit of F1 ATP synthase 90.48
d2jdia3 285 Central domain of alpha subunit of F1 ATP synthase 90.36
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 90.26
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 90.1
d1qdea_ 212 Initiation factor 4a {Baker's yeast (Saccharomyces 90.02
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 89.92
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 89.64
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 89.42
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 89.41
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 89.39
d1gm5a3 264 RecG helicase domain {Thermotoga maritima [TaxId: 89.39
d1t6na_ 207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 89.22
d1q0ua_ 209 Probable DEAD box RNA helicase YqfR {Bacillus stea 89.12
d1lkxa_ 684 Myosin S1, motor domain {Dictyostelium discoideum, 88.99
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 88.96
d2g9na1 218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 88.88
d1hv8a1 208 Putative DEAD box RNA helicase {Archaeon Methanoco 88.83
d1d0xa2 712 Myosin S1, motor domain {Dictyostelium discoideum 88.68
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 88.6
d1s2ma1 206 Putative ATP-dependent RNA helicase DHH1 {Baker's 88.42
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 88.33
d1br2a2 710 Myosin S1, motor domain {Chicken (Gallus gallus), 87.92
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 87.84
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 87.76
d2mysa2 794 Myosin S1, motor domain {Chicken (Gallus gallus), 87.66
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 87.49
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 87.22
d2j0sa1 222 Probable ATP-dependent RNA helicase DDX48 {Human ( 87.1
d1kk8a2 789 Myosin S1, motor domain {Bay scallop (Aequipecten 86.81
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 86.6
d1w7ja2 730 Myosin S1, motor domain {Chicken (Gallus gallus), 86.59
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 86.58
d1veca_ 206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 86.45
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 86.1
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 86.03
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 85.57
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 85.33
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 85.19
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 84.89
d1oywa2 206 RecQ helicase domain {Escherichia coli [TaxId: 562 84.83
d1t5la1 413 Nucleotide excision repair enzyme UvrB {Bacillus c 84.5
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 83.57
d1w36b1 485 Exodeoxyribonuclease V beta chain (RecB), N-termin 83.15
d1bg2a_323 Kinesin {Human (Homo sapiens) [TaxId: 9606]} 83.15
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 82.22
d1c4oa1 408 Nucleotide excision repair enzyme UvrB {Thermus th 82.21
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 82.17
d1goja_354 Kinesin {Neurospora crassa [TaxId: 5141]} 81.97
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 80.86
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=4.4e-40  Score=268.49  Aligned_cols=214  Identities=28%  Similarity=0.423  Sum_probs=184.7

Q ss_pred             hhHHhcCCCCcceEEEEcCCCCcHHHHHHHHHhhcCCeEEEEecccccccccchHHHHHHHHHHHHHhCCCeEEEEcccc
Q psy5649           3 YALQSNGMKKCNGILIYGVNGTGKTSLIHSLASHMKVHTVVIQVADMFSKFYGEAEFRLKAAFDAALDHAPSLLLLDNLD   82 (305)
Q Consensus         3 ~~~~~~~~~~~~~vll~Gp~G~GKTtl~~~la~~l~~~~~~v~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~vl~ide~d   82 (305)
                      +.|+++++..++++||+||||||||++++++|++++.+++.++++++.+.+.|+++..++.+|+.|+.++||||+|||+|
T Consensus        35 ~~~~~~g~~~~~~iLL~GppGtGKT~la~~iA~~~~~~~~~i~~~~l~~~~~g~~~~~l~~~f~~A~~~~P~il~iDeiD  114 (256)
T d1lv7a_          35 SRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEID  114 (256)
T ss_dssp             GGC-----CCCCEEEEECCTTSCHHHHHHHHHHHHTCCEEEECSCSSTTSCCCCCHHHHHHHHHHHHTTCSEEEEETTHH
T ss_pred             HHHHHcCCCCCCeEEeeCCCCCCccHHHHHHHHHcCCCEEEEEhHHhhhcchhHHHHHHHHHHHHHHHcCCEEEEEEChh
Confidence            34677889999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccCCCCCc-----hhHHHHHHHHHHHHhhhcccCCeEEEEEEecCCCCCCccccCCCCcceEEEccCCCHHHHHHHHHH
Q psy5649          83 VLCTGRNRS-----DQERRLLSCLVTQVDRLHELQACVVLLAVTTSLDNVDVSLRTPGRLDQEIELPVPSRDQRAAILHC  157 (305)
Q Consensus        83 ~l~~~~~~~-----~~~~~~~~~l~~~~~~~~~~~~~~~~i~~t~~~~~l~~~l~~~~r~~~~i~~~~p~~~~r~~i~~~  157 (305)
                      .++.+++..     +...+.++.++..++.... ++.+++|+|||.++.++++++|+|||+.+++++.|+..+|.+|++.
T Consensus       115 ~l~~~r~~~~~~~~~~~~~~~~~ll~~~d~~~~-~~~v~vIatTn~~~~ld~al~R~gRfd~~i~i~~P~~~~R~~il~~  193 (256)
T d1lv7a_         115 AVGRQRGAGLGGGHDEREQTLNQMLVEMDGFEG-NEGIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKV  193 (256)
T ss_dssp             HHTCCCSTTSCCTTCHHHHHHHHHHHHHHTCCS-SSCEEEEEEESCTTTSCGGGGSTTSSCEEEECCCCCHHHHHHHHHH
T ss_pred             hhCccCCCCCCCCcHHHHHHHHHHHHHhhCCCC-CCCEEEEEeCCCcccCCHhHcCCCCCCEEEECCCcCHHHHHHHHHH
Confidence            998765432     2334667888888887655 6779999999999999999999999999999999999999999999


Q ss_pred             HHhcCCCCCCHHhHHHHHHHcCCCcHHhHHHHHHHHHHHHhhhhcCCCccccHHHHHHHhhhcC
Q psy5649         158 LLTKVPHSLSTDQIQQVAFITHGFVGGDLATLLSNATSALLVETEGTGQVLSYDGVMRALDHVK  221 (305)
Q Consensus       158 ~l~~~~~~ls~~~~~~la~~t~g~~~~di~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~  221 (305)
                      ++.+.+.. .+.++..++..|+||+++||..++++|...++++   ....++.+|+.+|++++.
T Consensus       194 ~l~~~~~~-~~~~~~~la~~t~G~s~adi~~l~~~A~~~a~~~---~~~~i~~~d~~~Al~rv~  253 (256)
T d1lv7a_         194 HMRRVPLA-PDIDAAIIARGTPGFSGADLANLVNEAALFAARG---NKRVVSMVEFEKAKDKIM  253 (256)
T ss_dssp             HHTTSCBC-TTCCHHHHHHTCTTCCHHHHHHHHHHHHHHHHHT---TCSSBCHHHHHHHHHHHT
T ss_pred             hccCCCcC-cccCHHHHHHhCCCCCHHHHHHHHHHHHHHHHHc---CCCccCHHHHHHHHHHHh
Confidence            98877655 3447899999999999999999999998877765   344678899999988763
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure