6-O-sulfation enzyme which catalyzes the transfer of sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to position 6 of the N-sulfoglucosamine residue (GlcNS) of heparan sulfate. Homo sapiens (taxid: 9606) EC: 2EC: .EC: 8EC: .EC: 2EC: .EC: -
6-O-sulfation enzyme which catalyzes the transfer of sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to position 6 of the N-sulfoglucosamine residue (GlcNS) of heparan sulfate. May prefer iduronic acid.
6-O-sulfation enzyme which catalyzes the transfer of sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to position 6 of the N-sulfoglucosamine residue (GlcNS) of heparan sulfate. Also transfers sulfate to CDSNS-heparin and performs the crucial step modification in the biosynthesis of anticoagulant heparan sulfate (HSact).
Cricetulus griseus (taxid: 10029)
EC: 2
EC: .
EC: 8
EC: .
EC: 2
EC: .
EC: -
>sp|Q56UJ5|H6S1A_DANRE Heparan-sulfate 6-O-sulfotransferase 1-A OS=Danio rerio GN=hs6st1a PE=2 SV=2
6-O-sulfation enzyme which catalyzes the transfer of sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to position 6 of the N-sulfoglucosamine residue (GlcNS) of heparan sulfate.
6-O-sulfation enzyme which catalyzes the transfer of sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to position 6 of the N-sulfoglucosamine residue (GlcNS) of heparan sulfate.
6-O-sulfation enzyme which catalyzes the transfer of sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to position 6 of the N-sulfoglucosamine residue (GlcNS) of heparan sulfate.
6-O-sulfation enzyme which catalyzes the transfer of sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to position 6 of the N-sulfoglucosamine residue (GlcNS) of heparan sulfate.
6-O-sulfation enzyme which catalyzes the transfer of sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to position 6 of the N-sulfoglucosamine residue (GlcNS) of heparan sulfate.
6-O-sulfation enzyme which catalyzes the transfer of sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to position 6 of the N-sulfoglucosamine residue (GlcNS) of heparan sulfate.
6-O-sulfation enzyme which catalyzes the transfer of sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to position 6 of the N-sulfoglucosamine residue (GlcNS) of heparan sulfate.
Homo sapiens (taxid: 9606)
EC: 2
EC: .
EC: 8
EC: .
EC: 2
EC: .
EC: -
Close Homologs in the Non-Redundant Database Detected by BLAST
Score = 60.5 bits (147), Expect = 2e-12
Identities = 19/82 (23%), Positives = 32/82 (39%), Gaps = 10/82 (12%)
Query: 23 HDVMVFLHIQKTGGTSFGRHLVSDLDLQRPCSCQRKKKRCYCFRPNRHEVWLFSRYSTGW 82
+V+ + K TS+ R L L + + + ++ W S+ S GW
Sbjct: 3 DHKIVYCRVPKVASTSWKRILC---VLY-------GENKFLADNRSINDTWAHSKRSCGW 52
Query: 83 KCGLHADWTELTSCVHSELDKN 104
G D +ELTSC + +
Sbjct: 53 SHGSFRDLSELTSCEIRKRLRK 74
This family includes a variety of sulfotransferase enzymes. Chondroitin 6-sulfotransferase catalyzes the transfer of sulfate to position 6 of the N-acetylgalactosamine residue of chondroitin. This family also includes Heparan sulfate 2-O-sulfotransferase (HS2ST) and Heparan sulfate 6-sulfotransferase (HS6ST). Heparan sulfate (HS) is a co-receptor for a number of growth factors, morphogens, and adhesion proteins. HS biosynthetic modifications may determine the strength and outcome of HS-ligand interactions. Mice that lack HS2ST undergo developmental failure only after midgestation,the most dramatic effect being the complete failure of kidney development. Heparan sulphate 6- O -sulfotransferase (HS6ST) catalyzes the transfer of sulphate from adenosine 3'-phosphate, 5'-phosphosulphate to the 6th position of the N -sulphoglucosamine residue in heparan sulphate. Length = 238
Probab=98.70 E-value=5.4e-09 Score=88.10 Aligned_cols=77 Identities=5% Similarity=-0.236 Sum_probs=71.3
Q ss_pred eeeecCCCcEEEEEEeeccCCceeeeeeeccCCCCCCcccccCceeeeecCCCCCCeeEEE-eeeceeeeccccchhhhh
Q psy6018 16 QRFDINAHDVMVFLHIQKTGGTSFGRHLVSDLDLQRPCSCQRKKKRCYCFRPNRHEVWLFS-RYSTGWKCGLHADWTELT 94 (111)
Q Consensus 16 ~~Fdi~~~dViVfLHIQKTgGTtFgrhLV~~l~l~~pC~c~~~~Krc~C~rP~~~etWLFS-RyStGW~CGLHADwTELt 94 (111)
.++++.+ |++|+||+++++|+ |.+|+.......+|.|..+.+.|+|.++...+.|+++ +.+++|.|+.|+||++++
T Consensus 38 ~~~~~~~--~~~~~~~~~~~~~~-~~~~~~~~~~~i~~~~~~~~~~tt~~~~~~r~y~~~~p~~~~~~~~~~~~~~~~~~ 114 (361)
T KOG3955|consen 38 EDESSAR--FVPRYNFTRGDLLR-KVDFDIKGDDLIVFLHIQKTGGTTFGRHLVRNIQLEQPCECRVGQKKCTCHRPGKR 114 (361)
T ss_pred hhccccc--eeeEEEEEEecccc-cccccccCCCccccccccccCCCCCcchhhhhhhhcchhhhhhcccccCCCcccee
Confidence 3444444 99999999999999 9999999999999999999999999999999999999 999999999999999997
Q ss_pred h
Q psy6018 95 S 95 (111)
Q Consensus 95 ~ 95 (111)
+
T Consensus 115 ~ 115 (361)
T KOG3955|consen 115 E 115 (361)
T ss_pred e
Confidence 6
>PF03567 Sulfotransfer_2: Sulfotransferase family; InterPro: IPR005331 This entry consists of a number of carbohydrate sulphotransferases that transfer sulphate to carbohydrate groups in glycoproteins and glycolipids
These include: Carbohydrate sulphotransferases 8 and 9, which transfer sulphate to position 4 of non-reducing N-acetylgalactosamine (GalNAc) residues in both N-glycans and O-glycans []. They function in the biosynthesis of glycoprotein hormones lutropin and thyrotropin, by mediating sulphation of their carbohydrate structures. Carbohydrate sulphotransferase 10, which transfers sulphate to position 3 of the terminal glucuronic acid in both protein- and lipid-linked oligosaccharides []. It directs the biosynthesis of the HNK-1 carbohydrate structure, a sulphated glucuronyl-lactosaminyl residue carried by many neural recognition molecules, which is involved in cell interactions during ontogenetic development and in synaptic plasticity in the adult. Carbohydrate sulphotransferases 11 - 13, which catalyze the transfer of sulphate to position 4 of the GalNAc residue of chondroitin []. Chondroitin sulphate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. Some, thought not all, of these enzymes also transfer sulphate to dermatan. Carbohydrate sulphotransferase D4ST1, which transfers sulphate to position 4 of the GalNAc residue of dermatan sulphate []. Heparan sulphate 2-O-sulphotransferase (HS2ST). Heparan sulphate (HS) is a co-receptor for a number of growth factors, morphogens, and adhesion proteins. HS biosynthetic modifications may determine the strength and outcome of HS-ligand interactions. Mice that lack HS2ST undergo developmental failure only after midgestation,the most dramatic effect being the complete failure of kidney development []. Heparan-sulphate 6-O-sulphotransferase (HS6ST), which catalyses the transfer of sulphate from adenosine 3'-phosphate, 5'-phosphosulphate to the 6th position of the N -sulphoglucosamine residue in heparan sulphate []. Chondroitin 6-sulphotransferase catalyses the transfer of sulphate to position 6 of the N-acetylgalactosamine residue of chondroitin []. ; GO: 0008146 sulfotransferase activity, 0016021 integral to membrane; PDB: 3F5F_A.
