Psyllid ID: psy6098

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------38
YLKPLHPTWIVSGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMARCKGSSRGTEFFTMDVDEAIKSSEGFKPYYVTKIEELQLIVAEKEQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDNQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMASLKKLAFAHHPLLFWSLLTILTNTIVCNFREHAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLNQLDGFEATK
ccccccccccccHHHHHHHHHHHccccEEEEEEHHHHHHHHccccHHHHHHHHHHHHHcccccccccccccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEccccEEEEEEccccEEEEEccccccccccccccEEEEEcccccccccccccccccccccEEEcccccccccccccHHHHHHHHHHHHcccccHHHHHHcccccccEEEEEccccccHHHHHHHHHHHcccEEEEEEccHHHHHHccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccccccccccccEEEEEEcccccccccccccccccHHHHHHHHHHHHHcccccccc
ccccccccEEEccHHHHHHHHHHHcccEEEEEccHHHHHHHHcHcHHHHHHHHHHHHHHccccccEEEEEcHHHHHccccccccccEEHHHHEEEEHHcccHHHcccccccEEEEEcccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHccccHHHHHHHHHHcccccccccccEEEEEEcccccHcHcccHHHHHHHHHHHHccccccHHHHHHcccccccEEEEEcccccHHHHHHHHHHHHcccEEEEEccHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcHHHHHHHHcccEEEEEEcHHHHcccccccccccccHHHHHHHHHHHHHccHHccc
ylkplhptwivsGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMARckgssrgtefftMDVDEAikssegfkpyyVTKIEELQLIVAEKEQNLRRLQAQRNELNAKVRMLREELQLLQEQGSyvgevvkpmdkkKVLVKvhpegkfvvdidknidindvtpncRVALRnesytlhkilpnkvdpLVSLMMVekvpdstyemvGGLDNQIKEIKEVIelpvkhpelfdalgiaqpkgvllygppgtgkTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMASLKKLAFAHHPLLFWSLLTILTNTIVcnfrehapsiifmDEIDsigssriesgsggdSEVQRTMLELLNQldgfeatk
ylkplhptwivSGKTLLARAVAHHTEctfirvsgseLVQKFIGEGSRMVRELFVMARCkgssrgtefftMDVDEAIKSSEGFKPYYVTKIEELQLIVAEKEQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGEVVKPMDKKKVLVKVhpegkfvvdidknidindvTPNCRVALRnesytlhkilpnkvdplVSLMMVEKVPDSTYEMVGGLDNQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTEctfirvsgseLVQKFIGEGSRMVRELFVMASLKKLAFAHHPLLFWSLLTILTNTIVCNFREHAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELlnqldgfeatk
YLKPLHPTWIVSGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMARCKGSSRGTEFFTMDVDEAIKSSEGFKPYYVTKIEELQLIVAEKEQNLRRLQAQRNELNAKVRMLReelqllqeqGSYVGEVVKPMDKKKVLVKVHPEGKFvvdidknidindvTPNCRVALRNESYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDNQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMASLKKLAFAHHPLLFWSLLTILTNTIVCNFREHAPSIIFMdeidsigssriesgsggdseVQRTMLELLNQLDGFEATK
*****HPTWIVSGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMARCKGSSRGTEFFTMDVDEAIKSSEGFKPYYVTKIEELQLIVAEKE**************AKVRMLREELQLLQEQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDNQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMASLKKLAFAHHPLLFWSLLTILTNTIVCNFREHAPSIIFMDEID***********************************
**KPLHPTWIVSGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFV*********************************TKIEELQLIVAEKEQNLRRLQAQRNELNA************QEQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDNQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMASLKKLAFAHHPLLFWSLLTILTNTIVCNFREHAPSIIFMDEIDSI*****************TMLELLNQLDGF****
YLKPLHPTWIVSGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMARCKGSSRGTEFFTMDVDEAIKSSEGFKPYYVTKIEELQLIVAEKEQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDNQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMASLKKLAFAHHPLLFWSLLTILTNTIVCNFREHAPSIIFMDEIDSIGSSR*********EVQRTMLELLNQLDGFEATK
YLKPLHPTWIVSGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMARCKGSSRGTEFFTMDVDEAIKSSEGFKPYYVTKIEELQLIVAEKEQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDNQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMASLKKLAFAHHPLLFWSLLTILTNTIVCNFREHAPSIIFMDEIDSIGSS**********EVQRTMLELL***DG*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YLKPLHPTWIVSGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMARCKGSSRGTEFFTMDVDEAIKSSEGFKPYYVTKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGSYVGEVVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDNQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMASLKKLAFAHHPLLFWSLLTILTNTIVCNFREHAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLNQLDGFEATK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query378 2.2.26 [Sep-21-2011]
O18413 405 26S protease regulatory s yes N/A 0.740 0.691 0.854 1e-149
P54814 402 26S protease regulatory s N/A N/A 0.735 0.691 0.860 1e-149
P62198 406 26S protease regulatory s yes N/A 0.738 0.687 0.815 1e-134
P62197 406 26S protease regulatory s yes N/A 0.738 0.687 0.815 1e-134
P62196 406 26S protease regulatory s yes N/A 0.738 0.687 0.815 1e-134
P62195 406 26S protease regulatory s yes N/A 0.738 0.687 0.815 1e-134
P62194 406 26S protease regulatory s yes N/A 0.738 0.687 0.815 1e-134
P46470 461 26S protease regulatory s N/A N/A 0.735 0.603 0.802 1e-130
Q9C5U3 419 26S protease regulatory s yes N/A 0.724 0.653 0.740 1e-125
Q94BQ2 419 26S protease regulatory s yes N/A 0.724 0.653 0.736 1e-124
>sp|O18413|PRS8_DROME 26S protease regulatory subunit 8 OS=Drosophila melanogaster GN=Pros45 PE=1 SV=2 Back     alignment and function desciption
 Score =  528 bits (1361), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 264/309 (85%), Positives = 271/309 (87%), Gaps = 29/309 (9%)

Query: 70  MDVDEAIKSSEGFKPYYVTKIEELQLIVAEKEQNLRRLQAQRNELNAKVRMLREELQLLQ 129
           M+++ A    EGF+ YY+ KIEELQL+VAEK QNLRRLQAQRNELNAKVRMLREELQLLQ
Sbjct: 7   MEIESAYHKGEGFRSYYIQKIEELQLVVAEKHQNLRRLQAQRNELNAKVRMLREELQLLQ 66

Query: 130 EQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNCRVALRNESYTLHKIL 189
           EQGSYVGEVVKPMDKKKVLVKVHPEGKFVVD+DKNIDINDVTPNCRVALRNESYTLHKIL
Sbjct: 67  EQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDLDKNIDINDVTPNCRVALRNESYTLHKIL 126

Query: 190 PNKVDPLVSLMMVEKVPDSTYEMVGGLDNQIKEIKEVIELPVKHPELFDALGIAQPKGVL 249
           PNKVDPLVSLMMVEKVPDSTYEMVGGLD QIKEIKEVIELPVKHPELFDALGIAQPKGVL
Sbjct: 127 PNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVL 186

Query: 250 LYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMASLKKLAFAH 309
           LYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMA         
Sbjct: 187 LYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMA--------- 237

Query: 310 HPLLFWSLLTILTNTIVCNFREHAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLN 369
                               REHAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLN
Sbjct: 238 --------------------REHAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLN 277

Query: 370 QLDGFEATK 378
           QLDGFEATK
Sbjct: 278 QLDGFEATK 286
The 26S protease is involved in the ATP-dependent degradation of ubiquitinated proteins. The regulatory (or ATPase) complex confers ATP dependency and substrate specificity to the 26S complex.
Drosophila melanogaster (taxid: 7227)
>sp|P54814|PRS8_MANSE 26S protease regulatory subunit 8 OS=Manduca sexta PE=2 SV=1 Back     alignment and function description
>sp|P62198|PRS8_RAT 26S protease regulatory subunit 8 OS=Rattus norvegicus GN=Psmc5 PE=1 SV=1 Back     alignment and function description
>sp|P62197|PRS8_PIG 26S protease regulatory subunit 8 OS=Sus scrofa GN=PSMC5 PE=2 SV=1 Back     alignment and function description
>sp|P62196|PRS8_MOUSE 26S protease regulatory subunit 8 OS=Mus musculus GN=Psmc5 PE=1 SV=1 Back     alignment and function description
>sp|P62195|PRS8_HUMAN 26S protease regulatory subunit 8 OS=Homo sapiens GN=PSMC5 PE=1 SV=1 Back     alignment and function description
>sp|P62194|PRS8_BOVIN 26S protease regulatory subunit 8 OS=Bos taurus GN=PSMC5 PE=2 SV=1 Back     alignment and function description
>sp|P46470|PRS8_XENLA 26S protease regulatory subunit 8 OS=Xenopus laevis GN=psmc5 PE=2 SV=2 Back     alignment and function description
>sp|Q9C5U3|PRS8A_ARATH 26S protease regulatory subunit 8 homolog A OS=Arabidopsis thaliana GN=RPT6A PE=2 SV=1 Back     alignment and function description
>sp|Q94BQ2|PRS8B_ARATH 26S protease regulatory subunit 8 homolog B OS=Arabidopsis thaliana GN=RPT6B PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query378
383853890405 PREDICTED: 26S protease regulatory subun 0.740 0.691 0.873 1e-150
340721148405 PREDICTED: 26S protease regulatory subun 0.740 0.691 0.870 1e-149
332030480427 26S protease regulatory subunit 8 [Acrom 0.740 0.655 0.873 1e-149
307212064405 26S protease regulatory subunit 8 [Harpe 0.740 0.691 0.870 1e-149
380029623414 PREDICTED: 26S protease regulatory subun 0.740 0.676 0.870 1e-149
66520165405 PREDICTED: 26S protease regulatory subun 0.740 0.691 0.870 1e-149
307175717 694 26S protease regulatory subunit 8 [Campo 0.740 0.403 0.870 1e-148
312372820389 hypothetical protein AND_19657 [Anophele 0.746 0.724 0.859 1e-148
195044618405 GH11847 [Drosophila grimshawi] gi|193901 0.740 0.691 0.860 1e-148
194769924405 GF21725 [Drosophila ananassae] gi|190622 0.740 0.691 0.857 1e-148
>gi|383853890|ref|XP_003702455.1| PREDICTED: 26S protease regulatory subunit 8-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  538 bits (1385), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 270/309 (87%), Positives = 273/309 (88%), Gaps = 29/309 (9%)

Query: 70  MDVDEAIKSSEGFKPYYVTKIEELQLIVAEKEQNLRRLQAQRNELNAKVRMLREELQLLQ 129
           M++DE I   EGFKPYY+TKIEELQLIVAEK QNLRRLQAQRNELNAKVRMLREELQLLQ
Sbjct: 7   MEIDEKIAKGEGFKPYYITKIEELQLIVAEKSQNLRRLQAQRNELNAKVRMLREELQLLQ 66

Query: 130 EQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNCRVALRNESYTLHKIL 189
           EQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPN RVALRNESYTLHKIL
Sbjct: 67  EQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNSRVALRNESYTLHKIL 126

Query: 190 PNKVDPLVSLMMVEKVPDSTYEMVGGLDNQIKEIKEVIELPVKHPELFDALGIAQPKGVL 249
           PNKVDPLVSLMMVEKVPDSTYEMVGGLD QIKEIKEVIELPVKHPELFDALGIAQPKGVL
Sbjct: 127 PNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVL 186

Query: 250 LYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMASLKKLAFAH 309
           LYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMA         
Sbjct: 187 LYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMA--------- 237

Query: 310 HPLLFWSLLTILTNTIVCNFREHAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLN 369
                               REHAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLN
Sbjct: 238 --------------------REHAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLN 277

Query: 370 QLDGFEATK 378
           QLDGFEATK
Sbjct: 278 QLDGFEATK 286

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|340721148|ref|XP_003398987.1| PREDICTED: 26S protease regulatory subunit 8-like [Bombus terrestris] gi|350399415|ref|XP_003485515.1| PREDICTED: 26S protease regulatory subunit 8-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|332030480|gb|EGI70168.1| 26S protease regulatory subunit 8 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307212064|gb|EFN87947.1| 26S protease regulatory subunit 8 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|380029623|ref|XP_003698467.1| PREDICTED: 26S protease regulatory subunit 8-like [Apis florea] Back     alignment and taxonomy information
>gi|66520165|ref|XP_623053.1| PREDICTED: 26S protease regulatory subunit 8 isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|307175717|gb|EFN65582.1| 26S protease regulatory subunit 8 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|312372820|gb|EFR20697.1| hypothetical protein AND_19657 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|195044618|ref|XP_001991849.1| GH11847 [Drosophila grimshawi] gi|193901607|gb|EDW00474.1| GH11847 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|194769924|ref|XP_001967051.1| GF21725 [Drosophila ananassae] gi|190622846|gb|EDV38370.1| GF21725 [Drosophila ananassae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query378
FB|FBgn0020369405 Rpt6 "Regulatory particle trip 0.611 0.570 0.839 3.9e-110
UNIPROTKB|F1NU79412 PSMC5 "Uncharacterized protein 0.608 0.558 0.800 4.5e-105
UNIPROTKB|Q6AZU7414 Q6AZU7 "Putative uncharacteriz 0.640 0.584 0.759 5.8e-105
ZFIN|ZDB-GENE-030131-6547406 psmc5 "proteasome (prosome, ma 0.608 0.566 0.796 5.8e-105
UNIPROTKB|P62194406 PSMC5 "26S protease regulatory 0.608 0.566 0.796 7.3e-105
UNIPROTKB|P62195406 PSMC5 "26S protease regulatory 0.608 0.566 0.796 7.3e-105
UNIPROTKB|P62197406 PSMC5 "26S protease regulatory 0.608 0.566 0.796 7.3e-105
MGI|MGI:105047406 Psmc5 "protease (prosome, macr 0.608 0.566 0.796 7.3e-105
RGD|708376406 Psmc5 "proteasome (prosome, ma 0.608 0.566 0.796 7.3e-105
UNIPROTKB|Q4RG45406 GSTENG00035021001 "Chromosome 0.608 0.566 0.800 2.5e-104
FB|FBgn0020369 Rpt6 "Regulatory particle triple-A ATPase 6" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 977 (349.0 bits), Expect = 3.9e-110, Sum P(2) = 3.9e-110
 Identities = 194/231 (83%), Positives = 200/231 (86%)

Query:    70 MDVDEAIKSSEGFKPYYVTKIEELQLIVAEKEQNLRRLQAQRNELNAKVRMLRXXXXXXX 129
             M+++ A    EGF+ YY+ KIEELQL+VAEK QNLRRLQAQRNELNAKVRMLR       
Sbjct:     7 MEIESAYHKGEGFRSYYIQKIEELQLVVAEKHQNLRRLQAQRNELNAKVRMLREELQLLQ 66

Query:   130 XXGSYVGEVVKPMDKKKVLVKVHPEGKFXXXXXXXXXXXXXTPNCRVALRNESYTLHKIL 189
               GSYVGEVVKPMDKKKVLVKVHPEGKF             TPNCRVALRNESYTLHKIL
Sbjct:    67 EQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDLDKNIDINDVTPNCRVALRNESYTLHKIL 126

Query:   190 PNKVDPLVSLMMVEKVPDSTYEMVGGLDNQIKEIKEVIELPVKHPELFDALGIAQPKGVL 249
             PNKVDPLVSLMMVEKVPDSTYEMVGGLD QIKEIKEVIELPVKHPELFDALGIAQPKGVL
Sbjct:   127 PNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVL 186

Query:   250 LYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMA 300
             LYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMA
Sbjct:   187 LYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMA 237
GO:0005634 "nucleus" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0004175 "endopeptidase activity" evidence=IDA;NAS
GO:0008540 "proteasome regulatory particle, base subcomplex" evidence=ISS;NAS
GO:0005838 "proteasome regulatory particle" evidence=ISS;IDA;NAS
GO:0000502 "proteasome complex" evidence=NAS
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=NAS
GO:0006508 "proteolysis" evidence=ISS;IDA;NAS
GO:0016887 "ATPase activity" evidence=NAS
GO:0005524 "ATP binding" evidence=IEA
GO:0030163 "protein catabolic process" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0006974 "response to DNA damage stimulus" evidence=IMP
UNIPROTKB|F1NU79 PSMC5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q6AZU7 Q6AZU7 "Putative uncharacterized protein" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-6547 psmc5 "proteasome (prosome, macropain) 26S subunit, ATPase, 5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P62194 PSMC5 "26S protease regulatory subunit 8" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P62195 PSMC5 "26S protease regulatory subunit 8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P62197 PSMC5 "26S protease regulatory subunit 8" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:105047 Psmc5 "protease (prosome, macropain) 26S subunit, ATPase 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|708376 Psmc5 "proteasome (prosome, macropain) 26S subunit, ATPase, 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q4RG45 GSTENG00035021001 "Chromosome 2 SCAF15106, whole genome shotgun sequence." [Tetraodon nigroviridis (taxid:99883)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A4G0S4PAN_METM5No assigned EC number0.40130.68780.6388yesN/A
Q0W257PAN_UNCMANo assigned EC number0.41190.70100.6354yesN/A
Q9C5U3PRS8A_ARATHNo assigned EC number0.74010.72480.6539yesN/A
P34124PRS8_DICDINo assigned EC number0.70430.71690.6724yesN/A
O28303PAN_ARCFUNo assigned EC number0.44980.63490.6030yesN/A
O57940PAN_PYRHONo assigned EC number0.40810.70100.6641yesN/A
Q25544PRS8_NAEFONo assigned EC number0.71230.71160.6497N/AN/A
Q9V287PAN_PYRABNo assigned EC number0.40130.70100.6691yesN/A
B6YXR2PAN_THEONNo assigned EC number0.40580.71160.6758yesN/A
B8GGN4PAN_METPENo assigned EC number0.42950.66400.6092yesN/A
P41836PRS8_SCHPONo assigned EC number0.68880.74600.6997yesN/A
Q8SQK0PRS8_ENCCUNo assigned EC number0.62120.71690.5982yesN/A
Q6LWR0PAN_METMPNo assigned EC number0.39720.66400.6167yesN/A
Q01939PRS8_YEASTNo assigned EC number0.68120.71160.6641yesN/A
Q8U4H3PAN_PYRFUNo assigned EC number0.40470.70100.6691yesN/A
Q5JHS5PAN_PYRKONo assigned EC number0.39540.72220.6876yesN/A
P54814PRS8_MANSENo assigned EC number0.86080.73540.6915N/AN/A
O18413PRS8_DROMENo assigned EC number0.85430.74070.6913yesN/A
Q94BQ2PRS8B_ARATHNo assigned EC number0.73680.72480.6539yesN/A
P46470PRS8_XENLANo assigned EC number0.80250.73540.6030N/AN/A
P62198PRS8_RATNo assigned EC number0.81550.73800.6871yesN/A
P62194PRS8_BOVINNo assigned EC number0.81550.73800.6871yesN/A
P62195PRS8_HUMANNo assigned EC number0.81550.73800.6871yesN/A
P62196PRS8_MOUSENo assigned EC number0.81550.73800.6871yesN/A
P62197PRS8_PIGNo assigned EC number0.81550.73800.6871yesN/A
A6VHR1PAN_METM7No assigned EC number0.40410.66400.6167yesN/A
A9A916PAN_METM6No assigned EC number0.40130.68780.6388yesN/A
C5A6P8PAN_THEGJNo assigned EC number0.41030.69040.6574yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query378
COG1222 406 COG1222, RPT1, ATP-dependent 26S proteasome regula 1e-138
PRK03992 389 PRK03992, PRK03992, proteasome-activating nucleoti 1e-112
TIGR01242 364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 1e-88
PTZ00361 438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 9e-79
PTZ00454 398 PTZ00454, PTZ00454, 26S protease regulatory subuni 2e-77
COG0464 494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 5e-42
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 3e-38
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 7e-37
TIGR01241 495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 3e-36
TIGR03689 512 TIGR03689, pup_AAA, proteasome ATPase 5e-36
pfam00004131 pfam00004, AAA, ATPase family associated with vari 2e-33
CHL00176 638 CHL00176, ftsH, cell division protein; Validated 2e-31
COG0465 596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 4e-30
PRK10733 644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 5e-27
COG1222406 COG1222, RPT1, ATP-dependent 26S proteasome regula 6e-24
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleoti 4e-23
COG1223 368 COG1223, COG1223, Predicted ATPase (AAA+ superfami 2e-21
PTZ00454398 PTZ00454, PTZ00454, 26S protease regulatory subuni 1e-16
TIGR01242364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 2e-16
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 3e-15
COG0464 494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 2e-14
PTZ00361438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 6e-13
pfam00004131 pfam00004, AAA, ATPase family associated with vari 2e-11
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 1e-08
smart00382148 smart00382, AAA, ATPases associated with a variety 3e-08
TIGR01241495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 2e-07
PRK13342 413 PRK13342, PRK13342, recombination factor protein R 2e-07
COG1223368 COG1223, COG1223, Predicted ATPase (AAA+ superfami 4e-07
CHL00176638 CHL00176, ftsH, cell division protein; Validated 5e-07
COG0465596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 9e-07
PRK10733644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 2e-05
COG2256 436 COG2256, MGS1, ATPase related to the helicase subu 2e-05
PRK13341 725 PRK13341, PRK13341, recombination factor protein R 2e-05
TIGR03689512 TIGR03689, pup_AAA, proteasome ATPase 3e-05
pfam07726131 pfam07726, AAA_3, ATPase family associated with va 9e-05
COG0714 329 COG0714, COG0714, MoxR-like ATPases [General funct 2e-04
PRK04195 482 PRK04195, PRK04195, replication factor C large sub 3e-04
pfam13191154 pfam13191, AAA_16, AAA ATPase domain 3e-04
pfam07728135 pfam07728, AAA_5, AAA domain (dynein-related subfa 7e-04
TIGR03922 557 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPas 8e-04
CHL00195489 CHL00195, ycf46, Ycf46; Provisional 8e-04
COG1224 450 COG1224, TIP49, DNA helicase TIP49, TBP-interactin 0.001
pfam07724168 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) 0.002
PRK00080 328 PRK00080, ruvB, Holliday junction DNA helicase Ruv 0.002
COG0606 490 COG0606, COG0606, Predicted ATPase with chaperone 0.003
TIGR00635 305 TIGR00635, ruvB, Holliday junction DNA helicase, R 0.003
TIGR02928 365 TIGR02928, TIGR02928, orc1/cdc6 family replication 0.003
COG1484254 COG1484, DnaC, DNA replication protein [DNA replic 0.003
pfam06068 395 pfam06068, TIP49, TIP49 C-terminus 0.004
COG2255 332 COG2255, RuvB, Holliday junction resolvasome, heli 0.004
TIGR00678188 TIGR00678, holB, DNA polymerase III, delta' subuni 0.004
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score =  400 bits (1030), Expect = e-138
 Identities = 154/304 (50%), Positives = 202/304 (66%), Gaps = 34/304 (11%)

Query: 77  KSSEGFKPYYVTKIEELQLIVAEKEQNLRRLQAQR-----NELNAKVRMLREELQLLQEQ 131
                    Y+ K+E+ +L + EKE+ L  L+ QR       L  +V  LREE++ L+E 
Sbjct: 12  DLESYEPQEYLNKLEDTKLKLLEKEKRLLLLEEQRLEAEGLRLKREVDRLREEIERLKEP 71

Query: 132 GSYVGEVVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNCRVALRNESYTLHKILPN 191
              VG V++ +D  + +VK     KFVV+I   +D + + P  RVAL  +SY++ ++LP 
Sbjct: 72  PLIVGTVLEVLDDGRAIVKSSTGPKFVVNILSFVDRDLLEPGMRVALNRDSYSIVRVLPP 131

Query: 192 KVDPLVSLMMVEKVPDSTYEMVGGLDNQIKEIKEVIELPVKHPELFDALGIAQPKGVLLY 251
           +VDP VS+M VE+ PD TYE +GGLD QI+EI+EV+ELP+K+PELF+ LGI  PKGVLLY
Sbjct: 132 EVDPRVSVMEVEEKPDVTYEDIGGLDEQIQEIREVVELPLKNPELFEELGIDPPKGVLLY 191

Query: 252 GPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMASLKKLAFAHHP 311
           GPPGTGKTLLA+AVA+ T+ TFIRV GSELVQK+IGEG+R+VRELF +A           
Sbjct: 192 GPPGTGKTLLAKAVANQTDATFIRVVGSELVQKYIGEGARLVRELFELA----------- 240

Query: 312 LLFWSLLTILTNTIVCNFREHAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLNQL 371
                             RE APSIIF+DEID+IG+ R +SG+ GD EVQRTMLELLNQL
Sbjct: 241 ------------------REKAPSIIFIDEIDAIGAKRFDSGTSGDREVQRTMLELLNQL 282

Query: 372 DGFE 375
           DGF+
Sbjct: 283 DGFD 286

Length = 406
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed Back     alignment and domain information
>gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|237354 PRK13341, PRK13341, recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|116340 pfam07726, AAA_3, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain Back     alignment and domain information
>gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
>gnl|CDD|188437 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPase EccA Back     alignment and domain information
>gnl|CDD|177094 CHL00195, ycf46, Ycf46; Provisional Back     alignment and domain information
>gnl|CDD|224145 COG1224, TIP49, DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>gnl|CDD|219536 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) Back     alignment and domain information
>gnl|CDD|234619 PRK00080, ruvB, Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>gnl|CDD|223679 COG0606, COG0606, Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|129721 TIGR00635, ruvB, Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>gnl|CDD|234063 TIGR02928, TIGR02928, orc1/cdc6 family replication initiation protein Back     alignment and domain information
>gnl|CDD|224401 COG1484, DnaC, DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|147949 pfam06068, TIP49, TIP49 C-terminus Back     alignment and domain information
>gnl|CDD|225164 COG2255, RuvB, Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233087 TIGR00678, holB, DNA polymerase III, delta' subunit Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 378
KOG0733|consensus 802 100.0
KOG0730|consensus 693 100.0
KOG0728|consensus 404 100.0
COG1222 406 RPT1 ATP-dependent 26S proteasome regulatory subun 100.0
KOG0736|consensus 953 100.0
KOG0727|consensus 408 100.0
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 100.0
KOG0726|consensus 440 100.0
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 100.0
KOG0735|consensus 952 100.0
KOG0741|consensus 744 100.0
PTZ00454 398 26S protease regulatory subunit 6B-like protein; P 100.0
KOG0729|consensus 435 100.0
KOG0652|consensus 424 100.0
PTZ00361 438 26 proteosome regulatory subunit 4-like protein; P 99.98
KOG0651|consensus 388 99.97
PRK03992 389 proteasome-activating nucleotidase; Provisional 99.97
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.96
TIGR01242 364 26Sp45 26S proteasome subunit P45 family. Many pro 99.96
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.94
KOG0736|consensus953 99.94
KOG0739|consensus 439 99.93
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 99.93
KOG0738|consensus 491 99.93
KOG0733|consensus 802 99.93
KOG0734|consensus 752 99.93
KOG0730|consensus693 99.93
KOG0738|consensus491 99.93
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.93
KOG0731|consensus 774 99.91
KOG0734|consensus752 99.91
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 99.9
CHL00095 821 clpC Clp protease ATP binding subunit 99.9
KOG0728|consensus404 99.89
COG1223 368 Predicted ATPase (AAA+ superfamily) [General funct 99.89
KOG0739|consensus439 99.88
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 99.88
KOG0727|consensus408 99.87
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.87
PRK10865 857 protein disaggregation chaperone; Provisional 99.86
KOG0729|consensus435 99.86
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 99.86
KOG0735|consensus952 99.86
KOG0731|consensus774 99.85
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.84
KOG0726|consensus440 99.84
KOG0652|consensus424 99.84
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.84
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.83
KOG0737|consensus 386 99.83
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.83
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 99.81
KOG0732|consensus 1080 99.81
KOG0651|consensus388 99.81
CHL00195 489 ycf46 Ycf46; Provisional 99.81
CHL00176 638 ftsH cell division protein; Validated 99.8
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 99.8
KOG0741|consensus 744 99.8
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.8
COG1126240 GlnQ ABC-type polar amino acid transport system, A 99.79
PLN00020 413 ribulose bisphosphate carboxylase/oxygenase activa 99.78
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 99.77
KOG0740|consensus 428 99.77
KOG0737|consensus386 99.76
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 99.75
COG2884223 FtsE Predicted ATPase involved in cell division [C 99.75
KOG0732|consensus 1080 99.75
KOG0740|consensus428 99.75
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 99.74
CHL00195489 ycf46 Ycf46; Provisional 99.73
CHL00206 2281 ycf2 Ycf2; Provisional 99.73
COG1131 293 CcmA ABC-type multidrug transport system, ATPase c 99.72
COG1127263 Ttg2A ABC-type transport system involved in resist 99.71
COG1136226 SalX ABC-type antimicrobial peptide transport syst 99.71
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 99.71
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.71
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 99.7
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.7
COG4152 300 ABC-type uncharacterized transport system, ATPase 99.7
PRK03992389 proteasome-activating nucleotidase; Provisional 99.69
KOG2004|consensus 906 99.68
PRK13537 306 nodulation ABC transporter NodI; Provisional 99.68
TIGR01188 302 drrA daunorubicin resistance ABC transporter ATP-b 99.68
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 99.67
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 99.67
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 99.67
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 99.67
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.67
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.67
KOG1051|consensus 898 99.67
COG1135 339 AbcC ABC-type metal ion transport system, ATPase c 99.66
PRK13536 340 nodulation factor exporter subunit NodI; Provision 99.66
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 99.66
COG1117253 PstB ABC-type phosphate transport system, ATPase c 99.65
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 99.65
COG1125 309 OpuBA ABC-type proline/glycine betaine transport s 99.65
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 99.65
COG1118 345 CysA ABC-type sulfate/molybdate transport systems, 99.65
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 99.64
cd03269210 ABC_putative_ATPase This subfamily is involved in 99.64
COG3638258 ABC-type phosphate/phosphonate transport system, A 99.64
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 99.64
TIGR02314 343 ABC_MetN D-methionine ABC transporter, ATP-binding 99.64
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 99.64
COG0410237 LivF ABC-type branched-chain amino acid transport 99.63
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 99.63
PRK11650 356 ugpC glycerol-3-phosphate transporter ATP-binding 99.63
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 99.63
TIGR01288 303 nodI ATP-binding ABC transporter family nodulation 99.63
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 99.63
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 99.63
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 99.63
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 99.62
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 99.62
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 99.62
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 99.62
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 99.62
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 99.62
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 99.62
TIGR03522 301 GldA_ABC_ATP gliding motility-associated ABC trans 99.61
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 99.61
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 99.61
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 99.61
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 99.61
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 99.61
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provi 99.61
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 99.61
PF00004132 AAA: ATPase family associated with various cellula 99.61
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 99.61
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 99.61
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 99.61
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 99.61
PRK11153 343 metN DL-methionine transporter ATP-binding subunit 99.6
CHL00176638 ftsH cell division protein; Validated 99.6
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 99.6
TIGR01186 363 proV glycine betaine/L-proline transport ATP bindi 99.6
PRK10908222 cell division protein FtsE; Provisional 99.6
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 99.6
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 99.6
PRK11000 369 maltose/maltodextrin transporter ATP-binding prote 99.6
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 99.6
PRK09536 402 btuD corrinoid ABC transporter ATPase; Reviewed 99.6
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 99.6
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 99.6
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 99.6
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, 99.6
COG4559259 ABC-type hemin transport system, ATPase component 99.6
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 99.6
PRK09452 375 potA putrescine/spermidine ABC transporter ATPase 99.6
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 99.59
COG4619223 ABC-type uncharacterized transport system, ATPase 99.59
CHL00181 287 cbbX CbbX; Provisional 99.59
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 99.59
COG4525259 TauB ABC-type taurine transport system, ATPase com 99.59
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 99.59
COG0488530 Uup ATPase components of ABC transporters with dup 99.59
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 99.59
cd03246173 ABCC_Protease_Secretion This family represents the 99.59
cd03216163 ABC_Carb_Monos_I This family represents the domain 99.59
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 99.59
PRK10851 353 sulfate/thiosulfate transporter subunit; Provision 99.59
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 99.59
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 99.59
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 99.59
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 99.59
cd03215182 ABC_Carb_Monos_II This family represents domain II 99.59
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 99.58
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 99.58
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 99.58
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 99.58
TIGR02880 284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.58
PRK11607 377 potG putrescine transporter ATP-binding subunit; P 99.58
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 99.58
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 99.58
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 99.58
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 99.58
TIGR02881 261 spore_V_K stage V sporulation protein K. Members o 99.58
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 99.58
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 99.58
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 99.58
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 99.58
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 99.58
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 99.58
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 99.58
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 99.58
TIGR02142 354 modC_ABC molybdenum ABC transporter, ATP-binding p 99.58
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 99.57
PRK11144 352 modC molybdate transporter ATP-binding protein; Pr 99.57
PRK10070 400 glycine betaine transporter ATP-binding subunit; P 99.57
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 99.57
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 99.57
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 99.57
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 99.57
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 99.57
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 99.57
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 99.57
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 99.56
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 99.56
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 99.56
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 99.56
COG4608 268 AppF ABC-type oligopeptide transport system, ATPas 99.56
PF00004132 AAA: ATPase family associated with various cellula 99.56
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 99.56
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 99.56
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 99.56
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 99.56
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 99.56
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 99.56
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 99.56
PRK13546264 teichoic acids export protein ATP-binding subunit; 99.56
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 99.56
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 99.56
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 99.56
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 99.55
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 99.55
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 99.55
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 99.55
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 99.55
PRK10619257 histidine/lysine/arginine/ornithine transporter su 99.55
KOG0744|consensus 423 99.55
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 99.55
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 99.55
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 99.55
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 99.55
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 99.55
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 99.55
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 99.55
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 99.55
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 99.54
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 99.54
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 99.54
cd03234226 ABCG_White The White subfamily represents ABC tran 99.54
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 99.54
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 99.54
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 99.54
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 99.54
PRK10253265 iron-enterobactin transporter ATP-binding protein; 99.54
COG4586 325 ABC-type uncharacterized transport system, ATPase 99.54
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 99.54
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 99.54
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 99.54
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 99.54
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 99.54
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 99.54
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.54
COG0411250 LivG ABC-type branched-chain amino acid transport 99.54
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 99.54
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 99.54
CHL00206 2281 ycf2 Ycf2; Provisional 99.54
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 99.54
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 99.54
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 99.54
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 99.53
cd03299235 ABC_ModC_like Archeal protein closely related to M 99.53
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 99.53
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 99.53
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 99.53
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 99.53
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 99.53
PRK09984262 phosphonate/organophosphate ester transporter subu 99.53
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 99.53
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 99.53
PRK10938 490 putative molybdenum transport ATP-binding protein 99.53
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 99.53
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 99.52
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 99.52
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 99.52
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 99.52
PRK03695248 vitamin B12-transporter ATPase; Provisional 99.52
COG4133209 CcmA ABC-type transport system involved in cytochr 99.52
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 99.52
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 99.52
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 99.51
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 99.51
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 99.51
PRK15079 331 oligopeptide ABC transporter ATP-binding protein O 99.51
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 99.51
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 99.51
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 99.51
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 99.51
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 99.5
COG1119257 ModF ABC-type molybdenum transport system, ATPase 99.5
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 99.5
COG4148 352 ModC ABC-type molybdate transport system, ATPase c 99.5
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 99.5
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 99.5
COG1123539 ATPase components of various ABC-type transport sy 99.5
COG4161242 ArtP ABC-type arginine transport system, ATPase co 99.5
PRK11308 327 dppF dipeptide transporter ATP-binding subunit; Pr 99.5
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 99.49
PRK09700510 D-allose transporter ATP-binding protein; Provisio 99.49
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 99.49
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 99.49
PRK11288501 araG L-arabinose transporter ATP-binding protein; 99.49
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 99.49
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 99.49
PRK14241258 phosphate transporter ATP-binding protein; Provisi 99.49
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 99.49
PRK14242253 phosphate transporter ATP-binding protein; Provisi 99.48
PRK11022 326 dppD dipeptide transporter ATP-binding subunit; Pr 99.48
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 99.48
PRK14235267 phosphate transporter ATP-binding protein; Provisi 99.48
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 99.48
KOG0744|consensus423 99.48
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 99.48
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 99.48
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 99.48
PRK10762501 D-ribose transporter ATP binding protein; Provisio 99.47
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 99.47
COG4598256 HisP ABC-type histidine transport system, ATPase c 99.47
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 99.47
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.47
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 99.47
PRK13409590 putative ATPase RIL; Provisional 99.47
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 99.46
PRK15093 330 antimicrobial peptide ABC transporter ATP-binding 99.46
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 99.46
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 99.46
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 99.46
PRK09473 330 oppD oligopeptide transporter ATP-binding componen 99.46
COG4178604 ABC-type uncharacterized transport system, permeas 99.46
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 99.45
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 99.45
COG4175 386 ProV ABC-type proline/glycine betaine transport sy 99.45
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 99.45
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 99.45
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 99.45
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 99.45
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 99.45
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.45
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 99.45
PRK14239252 phosphate transporter ATP-binding protein; Provisi 99.45
TIGR01187 325 potA spermidine/putrescine ABC transporter ATP-bin 99.45
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 99.45
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 99.45
PRK09580248 sufC cysteine desulfurase ATPase component; Review 99.45
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.45
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 99.45
COG3845 501 ABC-type uncharacterized transport systems, ATPase 99.45
PRK10261 623 glutathione transporter ATP-binding protein; Provi 99.45
COG4988559 CydD ABC-type transport system involved in cytochr 99.45
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 99.44
PRK14243264 phosphate transporter ATP-binding protein; Provisi 99.44
COG4181228 Predicted ABC-type transport system involved in ly 99.44
CHL00181287 cbbX CbbX; Provisional 99.44
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 99.44
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 99.44
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 99.44
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 99.44
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 99.44
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 99.44
PRK14237267 phosphate transporter ATP-binding protein; Provisi 99.44
PRK13409 590 putative ATPase RIL; Provisional 99.44
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 99.44
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 99.44
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.44
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 99.44
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 99.43
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 99.43
PRK14240250 phosphate transporter ATP-binding protein; Provisi 99.43
PLN03211 659 ABC transporter G-25; Provisional 99.43
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 99.43
PRK14238271 phosphate transporter ATP-binding protein; Provisi 99.43
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.43
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 99.43
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 99.43
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 99.43
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 99.43
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 99.43
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 99.43
PRK14236272 phosphate transporter ATP-binding protein; Provisi 99.43
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 99.42
PRK15064 530 ABC transporter ATP-binding protein; Provisional 99.42
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 99.42
PRK05342 412 clpX ATP-dependent protease ATP-binding subunit Cl 99.42
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 99.42
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 99.42
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.42
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 99.42
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 99.42
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 99.42
PRK10938490 putative molybdenum transport ATP-binding protein 99.41
COG4618580 ArpD ABC-type protease/lipase transport system, AT 99.41
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 99.41
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 99.41
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 99.41
PRK11147 635 ABC transporter ATPase component; Reviewed 99.41
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.41
PRK11819556 putative ABC transporter ATP-binding protein; Revi 99.41
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 99.4
KOG0058|consensus716 99.4
PRK10261 623 glutathione transporter ATP-binding protein; Provi 99.4
COG1101263 PhnK ABC-type uncharacterized transport system, AT 99.4
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 99.4
PRK10790592 putative multidrug transporter membrane\ATP-bindin 99.4
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 99.4
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 99.4
COG4987573 CydC ABC-type transport system involved in cytochr 99.4
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 99.4
COG1129 500 MglA ABC-type sugar transport system, ATPase compo 99.39
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 99.39
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 99.39
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 99.39
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 99.39
PRK11147 635 ABC transporter ATPase component; Reviewed 99.39
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 99.39
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 99.38
COG4167267 SapF ABC-type antimicrobial peptide transport syst 99.38
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.38
COG0444 316 DppD ABC-type dipeptide/oligopeptide/nickel transp 99.38
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 99.38
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.38
TIGR00955 617 3a01204 The Eye Pigment Precursor Transporter (EPP 99.38
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 99.38
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 99.38
TIGR00382 413 clpX endopeptidase Clp ATP-binding regulatory subu 99.37
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 99.37
KOG0055|consensus 1228 99.37
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 99.37
PRK10789569 putative multidrug transporter membrane\ATP-bindin 99.36
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 99.36
COG0488 530 Uup ATPase components of ABC transporters with dup 99.36
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 99.36
PRK10522547 multidrug transporter membrane component/ATP-bindi 99.35
PF00005137 ABC_tran: ABC transporter This structure is on hol 99.35
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 99.34
KOG0061|consensus 613 99.34
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 99.33
COG1123 539 ATPase components of various ABC-type transport sy 99.33
COG4674249 Uncharacterized ABC-type transport system, ATPase 99.32
TIGR00390 441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.32
PRK10535 648 macrolide transporter ATP-binding /permease protei 99.32
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 99.32
PLN03073718 ABC transporter F family; Provisional 99.32
COG1219 408 ClpX ATP-dependent protease Clp, ATPase subunit [P 99.32
KOG0057|consensus591 99.32
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.31
PLN03140 1470 ABC transporter G family member; Provisional 99.3
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 99.3
KOG0059|consensus 885 99.29
COG4172534 ABC-type uncharacterized transport system, duplica 99.29
PTZ002651466 multidrug resistance protein (mdr1); Provisional 99.29
COG4136213 ABC-type uncharacterized transport system, ATPase 99.28
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 99.28
PLN03140 1470 ABC transporter G family member; Provisional 99.28
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 99.27
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 99.25
PLN032321495 ABC transporter C family member; Provisional 99.25
PLN03130 1622 ABC transporter C family member; Provisional 99.25
COG2255 332 RuvB Holliday junction resolvasome, helicase subun 99.24
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 99.22
KOG0055|consensus1228 99.22
PRK05201 443 hslU ATP-dependent protease ATP-binding subunit Hs 99.22
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 99.21
KOG0056|consensus790 99.21
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.21
COG2256 436 MGS1 ATPase related to the helicase subunit of the 99.21
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.2
PTZ002431560 ABC transporter; Provisional 99.2
PLN03073 718 ABC transporter F family; Provisional 99.19
COG4138248 BtuD ABC-type cobalamin transport system, ATPase c 99.17
KOG0927|consensus614 99.16
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 99.16
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 99.15
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.15
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 99.14
KOG0742|consensus 630 99.13
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 99.12
KOG0060|consensus659 99.09
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.08
KOG0065|consensus 1391 99.08
COG2256436 MGS1 ATPase related to the helicase subunit of the 99.08
PRK04195 482 replication factor C large subunit; Provisional 99.06
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 99.06
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 99.06
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 99.06
KOG0062|consensus582 99.05
KOG0927|consensus 614 99.05
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 99.05
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.05
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.04
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 99.04
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 99.03
CHL00095 821 clpC Clp protease ATP binding subunit 99.03
COG4615546 PvdE ABC-type siderophore export system, fused ATP 99.02
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.02
PLN03025 319 replication factor C subunit; Provisional 99.01
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 99.01
PRK13342 413 recombination factor protein RarA; Reviewed 99.01
KOG0745|consensus 564 99.0
KOG0743|consensus 457 99.0
KOG0989|consensus 346 99.0
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 98.99
COG4172 534 ABC-type uncharacterized transport system, duplica 98.99
PTZ00243 1560 ABC transporter; Provisional 98.99
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 98.99
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 98.98
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 98.98
PRK10865 857 protein disaggregation chaperone; Provisional 98.97
PLN03232 1495 ABC transporter C family member; Provisional 98.96
>KOG0733|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.6e-61  Score=464.22  Aligned_cols=323  Identities=33%  Similarity=0.540  Sum_probs=249.4

Q ss_pred             CCCCCCCChhHHHHHHHhhccCceEEEeccccccccccchhHHHHHHHHHHHHhcCCCCCceEEEeehhhhhhccCCCCc
Q psy6098           5 LHPTWIVSGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMARCKGSSRGTEFFTMDVDEAIKSSEGFKP   84 (378)
Q Consensus         5 ~~~~pPGtGKt~~a~~~a~~~~~~~~~v~~~~~~~~~~Gese~~~~~~f~~a~~~~~~~~~ilf~DEid~~~~~~~g~~~   84 (378)
                      |+.||||||||+||+|+|++++++|+.|++++++|++.||||+++|++|+.|+.++||   |+||||||++.+.+++-.+
T Consensus       227 LlHGPPGCGKT~lA~AiAgel~vPf~~isApeivSGvSGESEkkiRelF~~A~~~aPc---ivFiDeIDAI~pkRe~aqr  303 (802)
T KOG0733|consen  227 LLHGPPGCGKTSLANAIAGELGVPFLSISAPEIVSGVSGESEKKIRELFDQAKSNAPC---IVFIDEIDAITPKREEAQR  303 (802)
T ss_pred             eeeCCCCccHHHHHHHHhhhcCCceEeecchhhhcccCcccHHHHHHHHHHHhccCCe---EEEeecccccccchhhHHH
Confidence            6789999999999999999999999999999999999999999999999999999999   9999999999998876333


Q ss_pred             hhhhhHHHHHHHH-HHHHHHHHHHHHH--------HHHHHHHHHHHHHHHHHHHhcccccccccccccccc---ceeecc
Q psy6098          85 YYVTKIEELQLIV-AEKEQNLRRLQAQ--------RNELNAKVRMLREELQLLQEQGSYVGEVVKPMDKKK---VLVKVH  152 (378)
Q Consensus        85 ~~~~~~~~l~~~l-~~~~~~l~~l~~~--------~~~l~~~~~~l~eel~~l~~~g~~~~~i~~~l~~~~---~i~~~~  152 (378)
                      .       +++++ .++..-|..+.+.        ....+++++.++   .+|+|.|||++++-..+|++.   .|+++.
T Consensus       304 e-------MErRiVaQLlt~mD~l~~~~~~g~~VlVIgATnRPDslD---paLRRaGRFdrEI~l~vP~e~aR~~IL~~~  373 (802)
T KOG0733|consen  304 E-------MERRIVAQLLTSMDELSNEKTKGDPVLVIGATNRPDSLD---PALRRAGRFDREICLGVPSETAREEILRII  373 (802)
T ss_pred             H-------HHHHHHHHHHHhhhcccccccCCCCeEEEecCCCCcccC---HHHhccccccceeeecCCchHHHHHHHHHH
Confidence            2       22222 2332223232222        123357777777   899999999999988877743   233333


Q ss_pred             CCCceeeecCcccccc---ccCccc-------------hhhccc-------------------------chh--------
Q psy6098         153 PEGKFVVDIDKNIDIN---DVTPNC-------------RVALRN-------------------------ESY--------  183 (378)
Q Consensus       153 ~~~~~~~~l~~~i~~~---~l~~~~-------------~~~~~~-------------------------~~~--------  183 (378)
                      ..+.   .+...++..   .++|++             .+++++                         +..        
T Consensus       374 ~~~l---rl~g~~d~~qlA~lTPGfVGADL~AL~~~Aa~vAikR~ld~~~~p~~~~~~~ed~~~~~~~~d~S~i~~~~~~  450 (802)
T KOG0733|consen  374 CRGL---RLSGDFDFKQLAKLTPGFVGADLMALCREAAFVAIKRILDQSSSPLTKVPISEDSSNKDAEEDQSSIKITSNA  450 (802)
T ss_pred             HhhC---CCCCCcCHHHHHhcCCCccchhHHHHHHHHHHHHHHHHhhcccCccccCCccccccCCCccchhhhhhcCCcc
Confidence            2221   111222211   111111             000000                         000        


Q ss_pred             ----hhhhhc-------C----------------------CCCchhhhhhccccCCCCCcccccCcHHHHHHHHHHHhcc
Q psy6098         184 ----TLHKIL-------P----------------------NKVDPLVSLMMVEKVPDSTYEMVGGLDNQIKEIKEVIELP  230 (378)
Q Consensus       184 ----~l~~i~-------~----------------------~~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~~l~~~~~~~  230 (378)
                          .+.++.       +                      +.+.|...+..+..+|+++|+|||+++++..+++.+|.+|
T Consensus       451 ~~~~~ld~v~~~~i~~~~d~~S~E~~~~L~i~~eDF~~Al~~iQPSakREGF~tVPdVtW~dIGaL~~vR~eL~~aI~~P  530 (802)
T KOG0733|consen  451 ERPLELDRVVQDAILNNPDPLSKELLEGLSIKFEDFEEALSKIQPSAKREGFATVPDVTWDDIGALEEVRLELNMAILAP  530 (802)
T ss_pred             cccccHHHHHHHHHHhCCCCcChHHhccceecHHHHHHHHHhcCcchhcccceecCCCChhhcccHHHHHHHHHHHHhhh
Confidence                000000       0                      0112233445566799999999999999999999999999


Q ss_pred             ccCchhhhhcCCCCCcceeEeCCCCCchHHHHHHHhhhcCceEEEeccCcccccccchhHHHHHHHHHHhhhhhhhhccC
Q psy6098         231 VKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMASLKKLAFAHH  310 (378)
Q Consensus       231 ~~~~~~~~~~~~~~~~~~ll~Gp~G~GKTtl~~~ia~~~~~~~i~~~~~~l~~~~~~~~~~~v~~~~~~a~~~~~~~~~~  310 (378)
                      +++|+.|+.+|+..+.+++|+||||||||.|||++|++.+.+||.+.|++|..+|+||+++.||++|+.|          
T Consensus       531 iK~pd~~k~lGi~~PsGvLL~GPPGCGKTLlAKAVANEag~NFisVKGPELlNkYVGESErAVR~vFqRA----------  600 (802)
T KOG0733|consen  531 IKRPDLFKALGIDAPSGVLLCGPPGCGKTLLAKAVANEAGANFISVKGPELLNKYVGESERAVRQVFQRA----------  600 (802)
T ss_pred             ccCHHHHHHhCCCCCCceEEeCCCCccHHHHHHHHhhhccCceEeecCHHHHHHHhhhHHHHHHHHHHHh----------
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999          


Q ss_pred             chhhhhHhhhhhhhhhcccccCCCeEEEEecCccccCCCCCCCCCCChHHHHHHHHHHHhccCCC
Q psy6098         311 PLLFWSLLTILTNTIVCNFREHAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLNQLDGFE  375 (378)
Q Consensus       311 ~~~~~~~~~~~~~~~~~~~~~~~p~vl~lDEid~~~~~r~~~~~~~d~~~~~~~~~lL~~l~~~~  375 (378)
                                         |++.||||||||+|+|+++|+.   +....+.|.+++||.+|||..
T Consensus       601 -------------------R~saPCVIFFDEiDaL~p~R~~---~~s~~s~RvvNqLLtElDGl~  643 (802)
T KOG0733|consen  601 -------------------RASAPCVIFFDEIDALVPRRSD---EGSSVSSRVVNQLLTELDGLE  643 (802)
T ss_pred             -------------------hcCCCeEEEecchhhcCcccCC---CCchhHHHHHHHHHHHhcccc
Confidence                               8999999999999999999954   345677899999999999984

>KOG0730|consensus Back     alignment and domain information
>KOG0728|consensus Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>KOG0727|consensus Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0726|consensus Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0729|consensus Back     alignment and domain information
>KOG0652|consensus Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG0651|consensus Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>KOG0731|consensus Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>KOG0728|consensus Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0727|consensus Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>KOG0729|consensus Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>KOG0731|consensus Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>KOG0726|consensus Back     alignment and domain information
>KOG0652|consensus Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>KOG0737|consensus Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>KOG0651|consensus Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0740|consensus Back     alignment and domain information
>KOG0737|consensus Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>KOG0740|consensus Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>KOG2004|consensus Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>KOG1051|consensus Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>KOG0058|consensus Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>KOG0055|consensus Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>KOG0061|consensus Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0057|consensus Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0059|consensus Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>KOG0055|consensus Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>KOG0056|consensus Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>KOG0927|consensus Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>KOG0742|consensus Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>KOG0060|consensus Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>KOG0065|consensus Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>KOG0062|consensus Back     alignment and domain information
>KOG0927|consensus Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>KOG0745|consensus Back     alignment and domain information
>KOG0743|consensus Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query378
4b4t_J 405 Near-Atomic Resolution Structural Model Of The Yeas 7e-94
4b4t_I 437 Near-Atomic Resolution Structural Model Of The Yeas 3e-44
4b4t_H 467 Near-Atomic Resolution Structural Model Of The Yeas 1e-43
4b4t_K 428 Near-Atomic Resolution Structural Model Of The Yeas 1e-40
4b4t_L 437 Near-Atomic Resolution Structural Model Of The Yeas 7e-40
4b4t_M 434 Near-Atomic Resolution Structural Model Of The Yeas 6e-39
3h4m_A 285 Aaa Atpase Domain Of The Proteasome- Activating Nuc 9e-39
1r7r_A 816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 1e-22
1r7r_A 816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 6e-21
1e32_A458 Structure Of The N-Terminal Domain And The D1 Aaa D 2e-22
3cf1_A 806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 2e-22
3cf1_A 806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 6e-21
3hu2_A 489 Structure Of P97 N-D1 R86a Mutant In Complex With A 2e-22
3hu3_A 489 Structure Of P97 N-D1 R155h Mutant In Complex With 3e-22
3hu1_A 489 Structure Of P97 N-D1 R95g Mutant In Complex With A 3e-22
3cf0_A 301 Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH 3e-21
2ce7_A 476 Edta Treated Length = 476 4e-21
3kds_E 465 Apo-ftsh Crystal Structure Length = 465 2e-20
3eie_A 322 Crystal Structure Of S.Cerevisiae Vps4 In The So4-B 5e-20
2qp9_X 355 Crystal Structure Of S.Cerevisiae Vps4 Length = 355 6e-20
3eih_A 340 Crystal Structure Of S.Cerevisiae Vps4 In The Prese 8e-20
2x8a_A274 Human Nuclear Valosin Containing Protein Like (Nvl) 9e-20
2rko_A 331 Crystal Structure Of The Vps4p-Dimer Length = 331 5e-19
3vfd_A 389 Human Spastin Aaa Domain Length = 389 3e-18
3d8b_A 357 Crystal Structure Of Human Fidgetin-Like Protein 1 3e-18
1lv7_A 257 Crystal Structure Of The Aaa Domain Of Ftsh Length 2e-17
3b9p_A 297 Spastin Length = 297 4e-17
1ixz_A 254 Crystal Structure Of The Ftsh Atpase Domain From Th 3e-16
4eiw_A 508 Whole Cytosolic Region Of Atp-Dependent Metalloprot 5e-16
2dhr_A 499 Whole Cytosolic Region Of Atp-Dependent Metalloprot 5e-16
1iy2_A 278 Crystal Structure Of The Ftsh Atpase Domain From Th 5e-16
2zam_A 444 Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt 9e-16
1xwi_A 322 Crystal Structure Of Vps4b Length = 322 1e-15
2r62_A 268 Crystal Structure Of Helicobacter Pylori Atp Depend 1e-15
2qz4_A262 Human Paraplegin, Aaa Domain In Complex With Adp Le 7e-13
>pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 Back     alignment and structure 
Iteration: 1

 Score =  340 bits (872), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 177/298 (59%), Positives = 201/298 (67%), Gaps = 29/298 (9%)
Query: 81  GFKPYYVTKIEELQLIVAEKEQNLRRLQAQRNELNAKVRMLRXXXXXXXXXGSYVGEVVK 140
           G KPY+  KI+E +L +  K +N+RRL+AQRN LN KVR ++         GSYVGEV+K
Sbjct: 18  GIKPYFEQKIQETELKIRSKTENVRRLEAQRNALNDKVRFIKDELRLLQEPGSYVGEVIK 77
Query: 141 PMDKKKVLVKVHPEGKFXXXXXXXXXXXXXTPNCRVALRNESYTLHKILPNKVDPLVSLM 200
            +  KKVLVKV PEGK+               + RV LR++SY LHK+L NK DPLVSLM
Sbjct: 78  IVSDKKVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLM 137
Query: 201 MVEKVPDSTYEMVGGLDNQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTL 260
           MVEKVPDSTY+MVGGL  QIKEIKEVIELPVKHPELF++LGIAQPKGV+LYGPPGTGKTL
Sbjct: 138 MVEKVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTL 197
Query: 261 LARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMASLKKLAFAHHPLLFWSLLTI 320
           LARAVAHHT+C FIRVSG+ELVQK+IGEGSRMVRELFVMA                    
Sbjct: 198 LARAVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMA-------------------- 237
Query: 321 LTNTIVCNFREHAPSIIFMXXXXXXXXXXXXXXXXXXXXVQRTMLELLNQLDGFEATK 378
                    REHAPSIIFM                    VQRTMLELLNQLDGFE +K
Sbjct: 238 ---------REHAPSIIFMDEIDSIGSTRVEGSGGGDSEVQRTMLELLNQLDGFETSK 286
>pdb|4B4T|I Chain I, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|4B4T|H Chain H, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 467 Back     alignment and structure
>pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 Back     alignment and structure
>pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|4B4T|M Chain M, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 Back     alignment and structure
>pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 Back     alignment and structure
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure
>pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 Back     alignment and structure
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure
>pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 Back     alignment and structure
>pdb|2CE7|A Chain A, Edta Treated Length = 476 Back     alignment and structure
>pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 Back     alignment and structure
>pdb|3EIE|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The So4-Bound State Length = 322 Back     alignment and structure
>pdb|2QP9|X Chain X, Crystal Structure Of S.Cerevisiae Vps4 Length = 355 Back     alignment and structure
>pdb|3EIH|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The Presence Of Atpgammas Length = 340 Back     alignment and structure
>pdb|2X8A|A Chain A, Human Nuclear Valosin Containing Protein Like (Nvl), C- Terminal Aaa-Atpase Domain Length = 274 Back     alignment and structure
>pdb|2RKO|A Chain A, Crystal Structure Of The Vps4p-Dimer Length = 331 Back     alignment and structure
>pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 Back     alignment and structure
>pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357 Back     alignment and structure
>pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 Back     alignment and structure
>pdb|3B9P|A Chain A, Spastin Length = 297 Back     alignment and structure
>pdb|1IXZ|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 254 Back     alignment and structure
>pdb|4EIW|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 508 Back     alignment and structure
>pdb|2DHR|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 499 Back     alignment and structure
>pdb|1IY2|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 278 Back     alignment and structure
>pdb|2ZAM|A Chain A, Crystal Structure Of Mouse Skd1VPS4B APO-Form Length = 444 Back     alignment and structure
>pdb|1XWI|A Chain A, Crystal Structure Of Vps4b Length = 322 Back     alignment and structure
>pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 Back     alignment and structure
>pdb|2QZ4|A Chain A, Human Paraplegin, Aaa Domain In Complex With Adp Length = 262 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query378
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 2e-98
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 4e-23
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 1e-54
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 3e-11
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 6e-53
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 3e-11
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 7e-52
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 7e-11
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 3e-51
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 2e-14
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 7e-51
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 2e-41
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 1e-11
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 6e-08
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 1e-50
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 2e-13
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 1e-50
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 5e-14
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 3e-49
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 8e-14
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 4e-49
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 3e-14
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 8e-47
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 4e-15
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 7e-46
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 8e-13
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 4e-45
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 2e-11
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 1e-37
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 1e-07
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 2e-37
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 2e-07
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 4e-37
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 3e-08
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 5e-37
2r62_A268 Cell division protease FTSH homolog; ATPase domain 2e-07
2wg5_A109 General control protein GCN4, proteasome-activatin 2e-36
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 4e-36
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 2e-07
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 2e-35
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 6e-09
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 5e-32
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 4e-06
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 1e-31
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 6e-06
3h43_A85 Proteasome-activating nucleotidase; regulatory par 2e-25
3m9b_A251 Proteasome-associated ATPase; coil COIL with 5 bet 6e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 1e-10
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 5e-10
3pvs_A 447 Replication-associated recombination protein A; ma 4e-08
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 9e-07
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 9e-06
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 1e-05
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 1e-05
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 2e-05
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 3e-05
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 5e-05
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 5e-05
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 1e-04
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 2e-04
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 3e-04
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 4e-04
2qgz_A308 Helicase loader, putative primosome component; str 4e-04
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 4e-04
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 4e-04
2r44_A 331 Uncharacterized protein; putative ATPase, structur 4e-04
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
 Score =  293 bits (751), Expect = 2e-98
 Identities = 91/182 (50%), Positives = 125/182 (68%), Gaps = 29/182 (15%)

Query: 197 VSLMMVEKVPDSTYEMVGGLDNQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGT 256
              M V++ P+  YE +GGL+ Q++EI+EV+ELP+KHPELF+ +GI  PKG+LLYGPPGT
Sbjct: 3   AKAMEVDERPNVRYEDIGGLEKQMQEIREVVELPLKHPELFEKVGIEPPKGILLYGPPGT 62

Query: 257 GKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMASLKKLAFAHHPLLFWS 316
           GKTLLA+AVA  T  TFIRV GSELV+KFIGEG+ +V+++F +A                
Sbjct: 63  GKTLLAKAVATETNATFIRVVGSELVKKFIGEGASLVKDIFKLA---------------- 106

Query: 317 LLTILTNTIVCNFREHAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLNQLDGFEA 376
                        +E APSIIF+DEID+I + R ++ +GGD EVQRT+++LL ++DGF+A
Sbjct: 107 -------------KEKAPSIIFIDEIDAIAAKRTDALTGGDREVQRTLMQLLAEMDGFDA 153

Query: 377 TK 378
             
Sbjct: 154 RG 155
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>2wg5_A General control protein GCN4, proteasome-activating nucleotidase; transcription hydrolase complex, nucleotide-binding; 2.10A {Saccharomyces cerevisiae} PDB: 2wg6_A Length = 109 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>3h43_A Proteasome-activating nucleotidase; regulatory particle, nucleosidase, ATP-binding, cytoplasm, nucleotide-binding, hydrolase; 2.10A {Methanocaldococcus jannaschii} Length = 85 Back     alignment and structure
>3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A Length = 251 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Length = 447 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Length = 456 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Length = 525 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Length = 525 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 386 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 384 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Length = 389 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Length = 318 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Length = 193 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Length = 202 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Length = 500 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Length = 180 Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Length = 543 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Length = 308 Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Length = 350 Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Length = 247 Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Length = 331 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query378
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 100.0
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 100.0
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 100.0
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 100.0
4b4t_I 437 26S protease regulatory subunit 4 homolog; hydrola 100.0
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 100.0
4b4t_H 467 26S protease regulatory subunit 7 homolog; hydrola 100.0
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 100.0
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 99.91
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 99.9
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 99.88
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 99.88
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 99.87
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.87
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.86
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.86
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 99.86
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 99.86
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.86
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 99.85
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 99.84
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.84
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.83
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 99.82
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.81
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 99.81
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 99.79
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.79
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.79
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.77
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.77
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.76
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.76
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 99.75
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.74
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.72
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 99.71
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 99.71
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 99.71
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 99.71
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 99.71
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 99.71
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 99.7
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 99.7
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 99.7
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 99.7
1b0u_A262 Histidine permease; ABC transporter, transport pro 99.69
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 99.69
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 99.69
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 99.69
1ji0_A240 ABC transporter; ATP binding protein, structural g 99.68
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 99.68
1g6h_A257 High-affinity branched-chain amino acid transport 99.68
1sgw_A214 Putative ABC transporter; structural genomics, P p 99.67
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 99.67
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 99.67
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 99.67
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 99.66
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 99.66
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 99.66
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 99.65
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 99.65
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 99.64
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 99.64
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 99.64
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 99.64
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 99.63
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.63
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 99.62
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 99.62
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 99.61
2ghi_A260 Transport protein; multidrug resistance protein, M 99.6
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 99.6
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.6
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 99.59
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.59
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 99.59
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 99.59
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.57
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 99.56
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 99.56
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 99.56
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.55
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 99.54
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 99.54
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 99.54
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 99.53
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 99.53
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 99.52
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 99.52
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 99.5
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 99.5
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 99.5
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 99.49
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.49
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 99.49
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.49
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 99.49
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.48
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.48
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.47
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 99.47
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 99.47
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 99.47
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.46
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.46
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 99.46
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.46
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 99.46
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 99.46
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.45
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 99.42
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.4
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.38
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 99.37
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.35
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 99.33
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.32
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 99.32
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 99.3
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 99.3
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 99.29
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 99.29
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 99.27
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 99.27
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.27
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 99.25
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 99.24
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.23
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 99.23
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.23
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 99.22
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 99.21
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 99.21
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 99.21
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.2
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 99.19
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.18
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 99.17
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.17
3co5_A143 Putative two-component system transcriptional RES 99.16
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 99.14
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 99.13
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 99.1
3pvs_A 447 Replication-associated recombination protein A; ma 99.09
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 99.09
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 99.05
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 99.04
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.03
4aby_A415 DNA repair protein RECN; hydrolase, double strand 99.02
2vf7_A842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 99.02
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 99.02
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 99.02
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 99.02
3co5_A143 Putative two-component system transcriptional RES 99.01
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 99.01
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.0
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 98.99
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 98.99
2r6f_A972 Excinuclease ABC subunit A; UVRA, nucleotide excis 98.98
2ygr_A993 Uvrabc system protein A; hydrolase, nucleotide exc 98.97
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 98.95
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 98.95
2chg_A226 Replication factor C small subunit; DNA-binding pr 98.94
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.92
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 98.92
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 98.91
3pih_A916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 98.91
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 98.91
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 98.9
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 98.89
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 98.89
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 98.89
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 98.87
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 98.86
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 98.86
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 98.84
3sop_A 270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 98.83
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 98.83
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 98.82
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 98.82
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 98.82
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 98.81
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 98.81
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 98.81
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 98.8
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 98.8
1e69_A322 Chromosome segregation SMC protein; structural mai 98.79
3pvs_A447 Replication-associated recombination protein A; ma 98.78
3thx_B 918 DNA mismatch repair protein MSH3; ABC family ATPas 98.78
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 98.78
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 98.77
1ojl_A 304 Transcriptional regulatory protein ZRAR; response 98.76
2chq_A 319 Replication factor C small subunit; DNA-binding pr 98.76
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 98.75
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 98.74
3bos_A242 Putative DNA replication factor; P-loop containing 98.74
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 98.74
2og2_A359 Putative signal recognition particle receptor; nuc 98.73
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 98.73
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 98.73
2eyu_A261 Twitching motility protein PILT; pilus retraction 98.72
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 98.7
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 98.7
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 98.69
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 98.68
2r44_A 331 Uncharacterized protein; putative ATPase, structur 98.68
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 98.67
3thx_A 934 DNA mismatch repair protein MSH2; ABC family ATPas 98.67
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 98.67
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 98.66
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 98.66
4a74_A231 DNA repair and recombination protein RADA; hydrola 98.64
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 98.62
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 98.61
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 98.6
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 98.6
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 98.6
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 98.57
1ojl_A304 Transcriptional regulatory protein ZRAR; response 98.56
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 98.56
2wg5_A109 General control protein GCN4, proteasome-activatin 98.56
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 98.56
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 98.55
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 98.54
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 98.54
2v1u_A387 Cell division control protein 6 homolog; DNA repli 98.54
2cvh_A220 DNA repair and recombination protein RADB; filamen 98.52
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 98.51
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 98.51
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 98.49
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 98.49
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 98.48
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 98.47
2vhj_A 331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 98.47
2gno_A 305 DNA polymerase III, gamma subunit-related protein; 98.46
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 98.46
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 98.43
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 98.42
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.41
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 98.41
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 98.41
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 98.41
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 98.4
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 98.37
2r44_A331 Uncharacterized protein; putative ATPase, structur 98.37
2ewv_A 372 Twitching motility protein PILT; pilus retraction 98.36
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 98.36
3bos_A242 Putative DNA replication factor; P-loop containing 98.35
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 98.34
2chg_A226 Replication factor C small subunit; DNA-binding pr 98.34
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 98.33
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.33
2o8b_B 1022 DNA mismatch repair protein MSH6; DNA damage respo 98.3
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 98.29
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 98.29
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 98.28
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 98.27
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 98.27
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 98.26
2qgz_A308 Helicase loader, putative primosome component; str 98.26
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 98.25
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 98.24
1vma_A306 Cell division protein FTSY; TM0570, structural gen 98.21
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 98.21
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 98.21
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 98.21
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 98.21
2chq_A319 Replication factor C small subunit; DNA-binding pr 98.2
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 98.2
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 98.17
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 98.17
1tue_A212 Replication protein E1; helicase, replication, E1E 98.17
2qgz_A308 Helicase loader, putative primosome component; str 98.17
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 98.15
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 98.13
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 98.12
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 98.12
3h43_A85 Proteasome-activating nucleotidase; regulatory par 98.11
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 98.1
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 98.09
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 98.09
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 98.07
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 98.07
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 98.06
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 98.03
3vaa_A199 Shikimate kinase, SK; structural genomics, center 98.02
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 98.01
2qnr_A 301 Septin-2, protein NEDD5; structural genomics conso 98.0
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 98.0
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 98.0
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 97.99
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 97.99
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 97.98
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 97.97
2gno_A305 DNA polymerase III, gamma subunit-related protein; 97.96
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 97.94
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 97.92
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 97.92
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 97.9
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 97.9
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 97.89
1kag_A173 SKI, shikimate kinase I; transferase, structural g 97.87
2fna_A 357 Conserved hypothetical protein; structural genomic 97.87
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 97.82
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 97.82
1ny5_A 387 Transcriptional regulator (NTRC family); AAA+ ATPa 97.81
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 97.8
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 97.8
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 97.78
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 97.78
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 97.77
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 97.77
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 97.77
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 97.74
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 97.72
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 97.72
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 97.72
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 97.71
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 97.71
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 97.7
1xp8_A 366 RECA protein, recombinase A; recombination, radior 97.7
1p9r_A 418 General secretion pathway protein E; bacterial typ 97.7
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 97.69
3vaa_A199 Shikimate kinase, SK; structural genomics, center 97.68
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 97.68
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 97.67
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 97.67
3m9b_A251 Proteasome-associated ATPase; coil COIL with 5 bet 97.67
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 97.66
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 97.65
1u94_A 356 RECA protein, recombinase A; homologous recombinat 97.62
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 97.62
2r6a_A 454 DNAB helicase, replicative helicase; replication, 97.62
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 97.61
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 97.6
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 97.58
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 97.57
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 97.57
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 97.57
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 97.56
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 97.56
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 97.55
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 97.55
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 97.54
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 97.53
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 97.53
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 97.53
1via_A175 Shikimate kinase; structural genomics, transferase 97.51
1kag_A173 SKI, shikimate kinase I; transferase, structural g 97.51
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 97.5
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 97.5
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 97.49
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 97.49
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 97.49
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 97.49
3kta_A182 Chromosome segregation protein SMC; structural mai 97.47
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 97.46
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 97.46
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 97.46
3io5_A 333 Recombination and repair protein; storage dimer, i 97.46
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 97.45
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 97.45
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 97.44
2fna_A357 Conserved hypothetical protein; structural genomic 97.44
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 97.44
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 97.44
1via_A175 Shikimate kinase; structural genomics, transferase 97.43
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 97.43
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 97.43
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 97.42
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 97.42
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 97.41
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 97.41
2z43_A324 DNA repair and recombination protein RADA; archaea 97.4
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 97.39
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 97.37
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 97.37
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 97.37
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 97.36
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 97.35
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 97.35
2ze6_A 253 Isopentenyl transferase; crown GALL tumor, cytokin 97.35
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 97.35
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 97.35
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 97.35
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 97.34
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 97.33
3a4m_A 260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 97.33
1udx_A 416 The GTP-binding protein OBG; TGS domain, riken str 97.32
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 97.32
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 97.32
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 97.31
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 97.31
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 97.3
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 97.3
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 97.3
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 97.29
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 97.29
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 97.28
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 97.28
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 97.28
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 97.28
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 97.27
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 97.27
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 97.26
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 97.26
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 97.25
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 97.25
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 97.25
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 97.24
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 97.24
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 97.23
2vli_A183 Antibiotic resistance protein; transferase, tunica 97.23
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 97.22
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 97.22
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 97.22
2cvh_A220 DNA repair and recombination protein RADB; filamen 97.21
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 97.2
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 97.2
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 97.19
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 97.19
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 97.19
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 97.18
2vli_A183 Antibiotic resistance protein; transferase, tunica 97.18
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 97.18
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 97.18
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 97.17
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 97.16
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 97.16
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 97.16
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 97.16
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 97.15
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 97.15
3tlx_A243 Adenylate kinase 2; structural genomics, structura 97.15
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 97.15
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 97.14
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 97.14
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 97.14
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 97.14
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 97.14
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 97.13
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 97.13
3kta_B173 Chromosome segregation protein SMC; structural mai 97.13
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 97.12
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 97.12
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 97.12
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 97.11
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 97.11
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 97.11
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 97.1
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 97.1
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 97.1
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 97.1
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 97.1
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 97.09
3f8t_A 506 Predicted ATPase involved in replication control, 97.09
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 97.09
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 97.08
3r20_A233 Cytidylate kinase; structural genomics, seattle st 97.08
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 97.08
1tue_A212 Replication protein E1; helicase, replication, E1E 97.07
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 97.07
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 97.06
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 97.06
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 97.06
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 97.06
3pih_A 916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 97.04
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 97.04
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 97.03
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 97.03
2q6t_A 444 DNAB replication FORK helicase; hydrolase; 2.90A { 97.02
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 97.01
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 97.01
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 97.0
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 97.0
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 97.0
3tlx_A243 Adenylate kinase 2; structural genomics, structura 97.0
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 97.0
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 96.97
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 96.97
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 96.97
3bh0_A 315 DNAB-like replicative helicase; ATPase, replicatio 96.96
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 96.95
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 96.95
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 96.95
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 96.94
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 96.94
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 96.93
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 96.93
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 96.92
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 96.91
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 96.91
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 96.89
4a74_A231 DNA repair and recombination protein RADA; hydrola 96.89
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 96.89
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 96.89
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 96.88
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 96.88
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 96.88
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
Probab=100.00  E-value=1.3e-51  Score=426.78  Aligned_cols=323  Identities=30%  Similarity=0.511  Sum_probs=238.7

Q ss_pred             CCCCCCCChhHHHHHHHhhccCceEEEeccccccccccchhHHHHHHHHHHHHhcCCCCCceEEEeehhhhhhccCCCCc
Q psy6098           5 LHPTWIVSGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMARCKGSSRGTEFFTMDVDEAIKSSEGFKP   84 (378)
Q Consensus         5 ~~~~pPGtGKt~~a~~~a~~~~~~~~~v~~~~~~~~~~Gese~~~~~~f~~a~~~~~~~~~ilf~DEid~~~~~~~g~~~   84 (378)
                      ||.||||||||+|||++|++++++|+.|++++++++|+|++|+++|++|+.|+.++||   ||||||+|++++.+++...
T Consensus       242 LL~GPPGTGKT~LAraiA~elg~~~~~v~~~~l~sk~~gese~~lr~lF~~A~~~~Ps---IIfIDEiDal~~~r~~~~~  318 (806)
T 3cf2_A          242 LLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPA---IIFIDELDAIAPKREKTHG  318 (806)
T ss_dssp             EEECCTTSCHHHHHHHHHTTTTCEEEEEEHHHHHSSCTTHHHHHHHHHHHHHTTSCSE---EEEEESGGGTCCTTTTCCC
T ss_pred             EEECCCCCCHHHHHHHHHHHhCCeEEEEEhHHhhcccchHHHHHHHHHHHHHHHcCCe---EEEEehhcccccccCCCCC
Confidence            6789999999999999999999999999999999999999999999999999999999   9999999999988765443


Q ss_pred             hhhhhHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHhccccccccccccccc---cceeeccCCCce
Q psy6098          85 YYVTKIEELQLIVAEKEQNLRRLQAQR----NELNAKVRMLREELQLLQEQGSYVGEVVKPMDKK---KVLVKVHPEGKF  157 (378)
Q Consensus        85 ~~~~~~~~l~~~l~~~~~~l~~l~~~~----~~l~~~~~~l~eel~~l~~~g~~~~~i~~~l~~~---~~i~~~~~~~~~  157 (378)
                      ...   ..+   +.++...+..+....    ....++++.++   +++++++||+..+...+|+.   ..+++.+..+..
T Consensus       319 ~~~---~ri---v~~LL~~mdg~~~~~~V~VIaaTN~~d~LD---~ALrR~GRFd~~I~i~~Pd~~~R~~IL~~~l~~~~  389 (806)
T 3cf2_A          319 EVE---RRI---VSQLLTLMDGLKQRAHVIVMAATNRPNSID---PALRRFGRFDREVDIGIPDATGRLEILQIHTKNMK  389 (806)
T ss_dssp             TTH---HHH---HHHHHTHHHHCCGGGCEEEEEECSSTTTSC---TTTTSTTSSCEEEECCCCCHHHHHHHHHHTCSSSE
T ss_pred             hHH---HHH---HHHHHHHHhcccccCCEEEEEecCChhhcC---HHHhCCcccceEEecCCCCHHHHHHHHHHHhcCCC
Confidence            222   111   111111121111100    01123444555   67889999999999888874   456666655432


Q ss_pred             eeecCccccccccCcc------------chhhc----c--------------------------cchhhhhhhcCCCCch
Q psy6098         158 VVDIDKNIDINDVTPN------------CRVAL----R--------------------------NESYTLHKILPNKVDP  195 (378)
Q Consensus       158 ~~~l~~~i~~~~l~~~------------~~~~~----~--------------------------~~~~~l~~i~~~~~~~  195 (378)
                         +..+++...+...            ++.+.    .                          ++..++..+.|+.   
T Consensus       390 ---~~~dvdl~~lA~~T~GfsgaDL~~Lv~eA~~~A~~r~~~~i~~~~~~~~~e~~~~~~v~~~Df~~Al~~~~ps~---  463 (806)
T 3cf2_A          390 ---LADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSA---  463 (806)
T ss_dssp             ---ECTTCCHHHHHHHCCSCCHHHHHHHHHHHHHHHHHHHHHHGGGTCCCCSHHHHHHCEECTTHHHHHHSSSSCCC---
T ss_pred             ---CCcccCHHHHHHhcCCCCHHHHHHHHHHHHHHHHHhccccccccccccchhhhccceeeHHHHHHHHHhCCCcc---
Confidence               2334443332211            11110    0                          0011111111111   


Q ss_pred             hhhhhccccCCCCCcccccCcHHHHHHHHHHHhccccCchhhhhcCCCCCcceeEeCCCCCchHHHHHHHhhhcCceEEE
Q psy6098         196 LVSLMMVEKVPDSTYEMVGGLDNQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIR  275 (378)
Q Consensus       196 ~~~~~~~~~~~~~~~~~i~g~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~ll~Gp~G~GKTtl~~~ia~~~~~~~i~  275 (378)
                        .+.....+|.++|++++|+++++++|++.+.+|+++++.+..+++.++.++|||||||||||+++++||+.++.+++.
T Consensus       464 --~r~~~~~~p~v~w~diggl~~~k~~l~e~v~~p~~~p~~f~~~g~~~~~gvLl~GPPGtGKT~lAkaiA~e~~~~f~~  541 (806)
T 3cf2_A          464 --LRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFIS  541 (806)
T ss_dssp             --CCCCCCBCCCCCSTTCCSCHHHHHHHTTTTTTTTTCSGGGSSSCCCCCSCCEEESSTTSSHHHHHHHHHHTTTCEEEE
T ss_pred             --cccccccCCCCCHHHhCCHHHHHHHHHHHHHhhhhCHHHHHhcCCCCCceEEEecCCCCCchHHHHHHHHHhCCceEE
Confidence              122344678899999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eccCcccccccchhHHHHHHHHHHhhhhhhhhccCchhhhhHhhhhhhhhhcccccCCCeEEEEecCccccCCCCCCCCC
Q psy6098         276 VSGSELVQKFIGEGSRMVRELFVMASLKKLAFAHHPLLFWSLLTILTNTIVCNFREHAPSIIFMDEIDSIGSSRIESGSG  355 (378)
Q Consensus       276 ~~~~~l~~~~~~~~~~~v~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~vl~lDEid~~~~~r~~~~~~  355 (378)
                      ++++++.++|+|++++.++++|..|                             +.+.||||||||||+|+++|+...++
T Consensus       542 v~~~~l~s~~vGese~~vr~lF~~A-----------------------------r~~~P~IifiDEiDsl~~~R~~~~~~  592 (806)
T 3cf2_A          542 IKGPELLTMWFGESEANVREIFDKA-----------------------------RQAAPCVLFFDELDSIAKARGGNIGD  592 (806)
T ss_dssp             CCHHHHHTTTCSSCHHHHHHHHHHH-----------------------------HTTCSEEEECSCGGGCC---------
T ss_pred             eccchhhccccchHHHHHHHHHHHH-----------------------------HHcCCceeechhhhHHhhccCCCCCC
Confidence            9999999999999999999999999                             78899999999999999999654333


Q ss_pred             CChHHHHHHHHHHHhccCCCC
Q psy6098         356 GDSEVQRTMLELLNQLDGFEA  376 (378)
Q Consensus       356 ~d~~~~~~~~~lL~~l~~~~~  376 (378)
                      .+....+.++++|.+|||+..
T Consensus       593 ~~~~~~rv~~~lL~~mdg~~~  613 (806)
T 3cf2_A          593 GGGAADRVINQILTEMDGMST  613 (806)
T ss_dssp             -----CHHHHHHHHHHHSSCS
T ss_pred             CchHHHHHHHHHHHHHhCCCC
Confidence            444567889999999999864
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2wg5_A General control protein GCN4, proteasome-activating nucleotidase; transcription hydrolase complex, nucleotide-binding; 2.10A {Saccharomyces cerevisiae} PDB: 2wg6_A Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3h43_A Proteasome-activating nucleotidase; regulatory particle, nucleosidase, ATP-binding, cytoplasm, nucleotide-binding, hydrolase; 2.10A {Methanocaldococcus jannaschii} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 378
d1lv7a_ 256 c.37.1.20 (A:) AAA domain of cell division protein 1e-52
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 7e-12
d1ixza_ 247 c.37.1.20 (A:) AAA domain of cell division protein 2e-51
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 4e-12
d1r7ra3 265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 1e-40
d1r7ra3265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 1e-06
d1e32a2 258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 3e-29
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 2e-26
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 6e-07
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 5e-19
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 1e-05
d1ofha_ 309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 9e-14
d1d2na_246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 3e-12
d1gvnb_ 273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 1e-11
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 5e-04
d1w5sa2 287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 5e-09
d1ixsb2239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 7e-09
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 9e-09
d1sxja2253 c.37.1.20 (A:295-547) Replication factor C1 {Baker 3e-08
d1g41a_ 443 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 5e-07
d1in4a2238 c.37.1.20 (A:17-254) Holliday junction helicase Ru 1e-06
d1lw7a2192 c.37.1.1 (A:220-411) Transcriptional regulator Nad 9e-05
d1szpa2251 c.37.1.11 (A:145-395) DNA repair protein Rad51, ca 2e-04
d1g8pa_ 333 c.37.1.20 (A:) ATPase subunit of magnesium chelata 2e-04
d1tf7a2242 c.37.1.11 (A:256-497) Circadian clock protein KaiC 2e-04
d1zp6a1176 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { 2e-04
d1sxje2252 c.37.1.20 (E:4-255) Replication factor C5 {Baker's 2e-04
d1qhxa_178 c.37.1.3 (A:) Chloramphenicol phosphotransferase { 3e-04
d1n0wa_242 c.37.1.11 (A:) DNA repair protein Rad51, catalytic 4e-04
d1a5ta2207 c.37.1.20 (A:1-207) delta prime subunit of DNA pol 0.001
d1v5wa_258 c.37.1.11 (A:) Meiotic recombination protein DMC1/ 0.002
d2fnaa2 283 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfo 0.002
d2i3ba1189 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 0.003
d2gnoa2198 c.37.1.20 (A:11-208) gamma subunit of DNA polymera 0.004
d1pzna2254 c.37.1.11 (A:96-349) DNA repair protein Rad51, cat 0.004
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]

 Score =  173 bits (440), Expect = 1e-52
 Identities = 63/179 (35%), Positives = 96/179 (53%), Gaps = 30/179 (16%)

Query: 200 MMVEKVPDSTYEMVGGLDNQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKT 259
           M+ E    +T+  V G D   +E+ E++E  ++ P  F  LG   PKGVL+ GPPGTGKT
Sbjct: 1   MLTEDQIKTTFADVAGCDEAKEEVAELVEY-LREPSRFQKLGGKIPKGVLMVGPPGTGKT 59

Query: 260 LLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMASLKKLAFAHHPLLFWSLLT 319
           LLA+A+A   +  F  +SGS+ V+ F+G G+  VR++F  A                   
Sbjct: 60  LLAKAIAGEAKVPFFTISGSDFVEMFVGVGASRVRDMFEQA------------------- 100

Query: 320 ILTNTIVCNFREHAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLNQLDGFEATK 378
                     ++ AP IIF+DEID++G  R     GG  E ++T+ ++L ++DGFE  +
Sbjct: 101 ----------KKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFEGNE 149
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253 Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Length = 192 Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 251 Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Length = 242 Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 252 Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Length = 178 Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 207 Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Length = 283 Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Length = 198 Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 254 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query378
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 99.93
d1ixza_ 247 AAA domain of cell division protein FtsH {Thermus 99.93
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.9
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.89
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.84
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.81
d2awna2232 Maltose transport protein MalK, N-terminal domain 99.8
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 99.78
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 99.78
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 99.78
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 99.77
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 99.77
d1g2912240 Maltose transport protein MalK, N-terminal domain 99.77
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.77
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 99.76
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 99.76
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 99.76
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.75
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 99.74
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 99.73
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.73
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 99.73
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.7
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 99.68
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 99.68
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.68
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 99.67
d1d2na_ 246 Hexamerization domain of N-ethylmalemide-sensitive 99.66
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 99.66
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 99.66
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 99.65
d2hyda1255 Putative multidrug export ATP-binding/permease pro 99.64
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.59
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 99.56
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.48
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.46
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.31
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.25
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.23
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.22
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.22
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 99.22
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.16
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.11
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.06
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.06
d1svma_362 Papillomavirus large T antigen helicase domain {Si 99.05
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 99.04
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.01
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.0
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 98.96
d1svma_362 Papillomavirus large T antigen helicase domain {Si 98.96
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 98.93
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 98.88
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 98.86
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.86
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 98.79
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.76
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 98.74
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 98.73
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 98.67
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 98.65
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 98.64
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.58
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.57
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 98.56
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.55
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 98.53
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 98.52
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.51
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 98.39
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 98.38
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 98.34
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 98.33
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 98.32
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 98.3
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 98.19
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 98.17
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 98.16
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 98.15
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 98.15
d1ny5a2 247 Transcriptional activator sigm54 (NtrC1), C-termin 98.13
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 98.11
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 98.1
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 98.09
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 98.08
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 98.08
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 98.07
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.06
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 98.04
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 98.01
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 98.01
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.98
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 97.98
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 97.94
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 97.92
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.9
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.9
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.9
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.86
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.86
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.84
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.83
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 97.8
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.78
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.78
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.77
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 97.76
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.74
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.73
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.73
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.72
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.71
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 97.71
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 97.71
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.7
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.7
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.69
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 97.68
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.67
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.67
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.67
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.67
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.66
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.66
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 97.65
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 97.65
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.65
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.64
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 97.62
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 97.61
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.6
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 97.57
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 97.56
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 97.55
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 97.54
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.51
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 97.5
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 97.5
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.5
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 97.48
d2qy9a2211 GTPase domain of the signal recognition particle r 97.48
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.47
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 97.46
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 97.46
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 97.46
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 97.45
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 97.42
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 97.41
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.4
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 97.39
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.39
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.38
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 97.37
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.34
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 97.34
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 97.34
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 97.31
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.31
d1okkd2207 GTPase domain of the signal recognition particle r 97.26
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 97.21
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 97.19
d1vmaa2213 GTPase domain of the signal recognition particle r 97.19
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 97.15
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 97.15
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 97.13
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.11
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.09
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 97.06
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.99
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 96.95
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.92
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 96.89
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 96.84
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.83
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.81
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.81
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 96.81
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.79
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 96.75
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 96.65
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 96.62
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 96.58
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.58
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 96.56
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 96.55
d1tuea_205 Replication protein E1 helicase domain {Human papi 96.5
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 96.5
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 96.45
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 96.43
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 96.37
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 96.36
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 96.34
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 96.32
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 96.31
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 96.26
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 96.25
d1yrba1 244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 96.21
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.19
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 96.18
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 96.17
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 96.16
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 96.14
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 96.12
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.1
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 96.06
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 96.05
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 96.05
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 96.04
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 96.04
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 96.0
d2qy9a2211 GTPase domain of the signal recognition particle r 95.99
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 95.97
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 95.97
d1nrjb_209 Signal recognition particle receptor beta-subunit 95.94
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 95.92
d2fh5b1207 Signal recognition particle receptor beta-subunit 95.91
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 95.88
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 95.88
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 95.86
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 95.82
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 95.8
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 95.8
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 95.76
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 95.72
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 95.61
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 95.6
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.59
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 95.58
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.57
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 95.54
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.54
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 95.51
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 95.5
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 95.47
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 95.45
d1p5zb_ 241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 95.45
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 95.44
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 95.43
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 95.43
d1okkd2207 GTPase domain of the signal recognition particle r 95.42
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 95.41
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 95.41
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 95.4
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 95.37
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 95.37
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 95.34
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 95.28
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 95.25
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 95.25
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 95.25
d1j8yf2211 GTPase domain of the signal sequence recognition p 95.25
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 95.24
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 95.23
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 95.23
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 95.23
d2ocpa1 241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 95.22
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 95.21
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 95.2
d1a7ja_ 288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 95.18
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 95.16
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 95.13
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 95.12
d1ls1a2207 GTPase domain of the signal sequence recognition p 95.08
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 95.08
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 95.06
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 95.05
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 95.04
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 95.0
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 94.98
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 94.95
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 94.91
d1deka_ 241 Deoxynucleoside monophosphate kinase {Bacteriophag 94.88
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 94.87
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 94.86
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 94.85
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 94.82
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 94.79
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 94.79
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 94.78
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 94.76
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 94.74
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 94.72
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 94.71
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 94.7
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 94.67
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 94.66
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 94.64
d1tuea_205 Replication protein E1 helicase domain {Human papi 94.63
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 94.62
d1vmaa2213 GTPase domain of the signal recognition particle r 94.61
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 94.58
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 94.56
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 94.54
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 94.54
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 94.54
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 94.53
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 94.52
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 94.51
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 94.49
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 94.45
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 94.43
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 94.38
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 94.37
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 94.34
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 94.28
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 94.2
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 94.19
d1g2912240 Maltose transport protein MalK, N-terminal domain 94.18
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 94.16
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 94.15
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 94.14
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 94.14
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 94.11
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 94.06
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 94.04
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 94.04
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 94.03
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 94.0
d2awna2232 Maltose transport protein MalK, N-terminal domain 93.98
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 93.97
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 93.92
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 93.92
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 93.82
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 93.81
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 93.78
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 93.75
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 93.68
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 93.67
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 93.57
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 93.5
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 93.45
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 93.38
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 93.36
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 93.26
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 93.25
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 93.12
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 93.08
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 93.07
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 93.02
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 92.93
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 92.93
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.92
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 92.91
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 92.91
d1xpua3 289 Transcription termination factor Rho, ATPase domai 92.87
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 92.85
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 92.8
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 92.75
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 92.74
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 92.72
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 92.72
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 92.72
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 92.67
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 92.63
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 92.62
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 92.47
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 92.44
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 92.4
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 92.39
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 92.37
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 92.37
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 92.35
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 92.27
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 92.22
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 92.17
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 91.99
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 91.98
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 91.93
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 91.93
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 91.8
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 91.78
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 91.75
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 91.53
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 91.5
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 91.49
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 91.45
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 91.4
d1nrjb_209 Signal recognition particle receptor beta-subunit 91.32
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 91.25
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 91.25
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 91.09
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 91.08
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 91.08
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 91.04
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 91.04
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 91.01
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 90.91
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 90.85
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.81
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 90.78
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 90.77
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 90.76
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 90.64
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 90.58
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 90.54
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.53
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 90.5
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 90.41
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 90.38
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 90.27
d2hyda1255 Putative multidrug export ATP-binding/permease pro 90.23
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 90.21
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 90.13
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 90.12
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 90.02
d1j3ba1 318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 90.01
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 89.83
d2fh5b1207 Signal recognition particle receptor beta-subunit 89.78
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 89.77
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 89.76
d1p6xa_ 333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 89.75
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 89.62
d1wxqa1 319 GTP-binding protein PH0525 {Pyrococcus horikoshii 89.58
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 89.57
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 89.53
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 89.51
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 89.45
d2dy1a2 267 Elongation factor G (EF-G), N-terminal (G) domain 89.43
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 89.33
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 89.33
d1ni3a1 296 YchF GTP-binding protein N-terminal domain {Fissio 89.3
d1e2ka_ 329 Thymidine kinase {Herpes simplex virus type 1, dif 89.26
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 89.21
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 89.18
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 89.09
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 88.9
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 88.87
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 88.84
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 88.83
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 88.82
d2olra1 313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 88.8
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 88.76
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 88.7
d1osna_ 331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 88.65
d2bv3a2 276 Elongation factor G (EF-G), N-terminal (G) domain 88.54
d1xpua3289 Transcription termination factor Rho, ATPase domai 88.51
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 88.47
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 88.45
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 88.34
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 88.34
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 88.18
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 88.17
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 88.17
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 88.04
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 88.0
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 87.98
d1ihua1 296 Arsenite-translocating ATPase ArsA {Escherichia co 87.97
d1ii2a1 323 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 87.81
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 87.75
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 87.59
d1jala1 278 YchF GTP-binding protein N-terminal domain {Haemop 87.56
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 87.51
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 87.47
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 87.37
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 87.14
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 87.07
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 86.7
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 86.68
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 86.44
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 86.38
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 86.37
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 86.27
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 86.26
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 85.74
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 85.51
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 85.45
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 85.38
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 85.34
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 85.1
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 84.98
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 84.62
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 84.6
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 84.44
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 84.39
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 84.35
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 84.27
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 84.12
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 83.99
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 83.43
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 83.35
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 83.23
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 83.19
d1f5na2 277 Interferon-induced guanylate-binding protein 1 (GB 83.17
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 82.87
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 82.63
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 82.28
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 81.84
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 81.33
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 81.28
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 81.05
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 80.48
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]

Probab=99.93  E-value=1.6e-26  Score=208.67  Aligned_cols=143  Identities=43%  Similarity=0.774  Sum_probs=126.0

Q ss_pred             ccCCCCCcccccCcHHHHHHHHHHHhccccCchhhhhcCCCCCcceeEeCCCCCchHHHHHHHhhhcCceEEEeccCccc
Q psy6098         203 EKVPDSTYEMVGGLDNQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELV  282 (378)
Q Consensus       203 ~~~~~~~~~~i~g~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~ll~Gp~G~GKTtl~~~ia~~~~~~~i~~~~~~l~  282 (378)
                      +..+.++|+|++|+++++++|++.+.+ +.+++.+..+++..+++++|+||||||||+++++||..++.+++.++++++.
T Consensus         4 ~~~~~~t~~Di~Gl~~~k~~l~e~v~~-~~~~~~~~~~g~~~~~~iLL~GppGtGKT~la~~iA~~~~~~~~~i~~~~l~   82 (256)
T d1lv7a_           4 EDQIKTTFADVAGCDEAKEEVAELVEY-LREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFV   82 (256)
T ss_dssp             ECSSCCCGGGSCSCHHHHHHTHHHHHH-HHCGGGC-----CCCCEEEEECCTTSCHHHHHHHHHHHHTCCEEEECSCSST
T ss_pred             CCCCCCCHHHHhchHHHHHHHHHHHHH-HHCHHHHHHcCCCCCCeEEeeCCCCCCccHHHHHHHHHcCCCEEEEEhHHhh
Confidence            456789999999999999999998876 8889999999999999999999999999999999999999999999999999


Q ss_pred             ccccchhHHHHHHHHHHhhhhhhhhccCchhhhhHhhhhhhhhhcccccCCCeEEEEecCccccCCCCCCCCCCChHHHH
Q psy6098         283 QKFIGEGSRMVRELFVMASLKKLAFAHHPLLFWSLLTILTNTIVCNFREHAPSIIFMDEIDSIGSSRIESGSGGDSEVQR  362 (378)
Q Consensus       283 ~~~~~~~~~~v~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~vl~lDEid~~~~~r~~~~~~~d~~~~~  362 (378)
                      +.|+|+++..++++|+.|                             +.+.|+||||||||++++.|+....+.+....+
T Consensus        83 ~~~~g~~~~~l~~~f~~A-----------------------------~~~~P~il~iDeiD~l~~~r~~~~~~~~~~~~~  133 (256)
T d1lv7a_          83 EMFVGVGASRVRDMFEQA-----------------------------KKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQ  133 (256)
T ss_dssp             TSCCCCCHHHHHHHHHHH-----------------------------HTTCSEEEEETTHHHHTCCCSTTSCCTTCHHHH
T ss_pred             hcchhHHHHHHHHHHHHH-----------------------------HHcCCEEEEEEChhhhCccCCCCCCCCcHHHHH
Confidence            999999999999999998                             778999999999999999987666666666777


Q ss_pred             HHHHHHHhccCCC
Q psy6098         363 TMLELLNQLDGFE  375 (378)
Q Consensus       363 ~~~~lL~~l~~~~  375 (378)
                      .+.++|..|++..
T Consensus       134 ~~~~ll~~~d~~~  146 (256)
T d1lv7a_         134 TLNQMLVEMDGFE  146 (256)
T ss_dssp             HHHHHHHHHHTCC
T ss_pred             HHHHHHHHhhCCC
Confidence            8889999998764
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure