Psyllid ID: psy6164
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 64 | ||||||
| 110671520 | 140 | putative ribosomal protein L17/23 [Diaph | 0.718 | 0.328 | 1.0 | 4e-17 | |
| 240849037 | 140 | ribosomal protein L23-like [Acyrthosipho | 0.718 | 0.328 | 0.956 | 2e-16 | |
| 292397872 | 140 | ribosomal protein L23 [Nylanderia nr. pu | 0.796 | 0.364 | 0.862 | 2e-16 | |
| 307170578 | 140 | 60S ribosomal protein L23 [Camponotus fl | 0.718 | 0.328 | 0.934 | 2e-16 | |
| 340724772 | 140 | PREDICTED: 60S ribosomal protein L23-lik | 0.718 | 0.328 | 0.934 | 3e-16 | |
| 389608303 | 140 | ribosomal protein L23 [Papilio xuthus] g | 0.718 | 0.328 | 0.934 | 3e-16 | |
| 66558956 | 140 | PREDICTED: 60S ribosomal protein L23 [Ap | 0.718 | 0.328 | 0.934 | 3e-16 | |
| 112984274 | 140 | ribosomal protein L23 [Bombyx mori] gi|1 | 0.718 | 0.328 | 0.934 | 3e-16 | |
| 332375604 | 140 | unknown [Dendroctonus ponderosae] | 0.703 | 0.321 | 0.955 | 3e-16 | |
| 242019454 | 140 | 60S ribosomal protein L23, putative [Ped | 0.718 | 0.328 | 0.934 | 3e-16 |
| >gi|110671520|gb|ABG82011.1| putative ribosomal protein L17/23 [Diaphorina citri] | Back alignment and taxonomy information |
|---|
Score = 92.0 bits (227), Expect = 4e-17, Method: Compositional matrix adjust.
Identities = 46/46 (100%), Positives = 46/46 (100%)
Query: 1 MSKRGRGGSAGAKFRISLALPVGAVINCADNTGAKNLFVIAVQGVK 46
MSKRGRGGSAGAKFRISLALPVGAVINCADNTGAKNLFVIAVQGVK
Sbjct: 1 MSKRGRGGSAGAKFRISLALPVGAVINCADNTGAKNLFVIAVQGVK 46
|
Source: Diaphorina citri Species: Diaphorina citri Genus: Diaphorina Family: Psyllidae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|240849037|ref|NP_001155385.1| ribosomal protein L23-like [Acyrthosiphon pisum] gi|239799377|dbj|BAH70612.1| ACYPI000455 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|292397872|gb|ADE27976.1| ribosomal protein L23 [Nylanderia nr. pubens LZ-2010] | Back alignment and taxonomy information |
|---|
| >gi|307170578|gb|EFN62772.1| 60S ribosomal protein L23 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|340724772|ref|XP_003400755.1| PREDICTED: 60S ribosomal protein L23-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|389608303|dbj|BAM17763.1| ribosomal protein L23 [Papilio xuthus] gi|389610691|dbj|BAM18957.1| ribosomal protein L23 [Papilio polytes] | Back alignment and taxonomy information |
|---|
| >gi|66558956|ref|XP_392812.2| PREDICTED: 60S ribosomal protein L23 [Apis mellifera] gi|156545547|ref|XP_001605069.1| PREDICTED: 60S ribosomal protein L23-like [Nasonia vitripennis] gi|380028209|ref|XP_003697800.1| PREDICTED: 60S ribosomal protein L23-like [Apis florea] gi|383854692|ref|XP_003702854.1| PREDICTED: 60S ribosomal protein L23-like [Megachile rotundata] gi|62083503|gb|AAX62476.1| ribosomal protein L23 [Lysiphlebus testaceipes] gi|90819996|gb|ABD98755.1| putative ribosomal protein L17/23 [Graphocephala atropunctata] | Back alignment and taxonomy information |
|---|
| >gi|112984274|ref|NP_001037227.1| ribosomal protein L23 [Bombyx mori] gi|15081322|gb|AAK83857.1|AF395586_1 ribosomal protein L17/23 [Spodoptera frugiperda] gi|49532860|dbj|BAD26665.1| Ribosomal protein L17/23 [Plutella xylostella] gi|54609237|gb|AAV34834.1| ribosomal protein L23 [Bombyx mori] gi|268306378|gb|ACY95310.1| ribosomal protein L23 [Manduca sexta] gi|315115429|gb|ADT80687.1| ribosomal protein L23 [Euphydryas aurinia] gi|342356417|gb|AEL28867.1| ribosomal protein L23 [Heliconius melpomene cythera] gi|357620607|gb|EHJ72748.1| ribosomal protein L23 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|332375604|gb|AEE62943.1| unknown [Dendroctonus ponderosae] | Back alignment and taxonomy information |
|---|
| >gi|242019454|ref|XP_002430176.1| 60S ribosomal protein L23, putative [Pediculus humanus corporis] gi|212515267|gb|EEB17438.1| 60S ribosomal protein L23, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 64 | ||||||
| UNIPROTKB|Q3T057 | 140 | RPL23 "60S ribosomal protein L | 0.718 | 0.328 | 0.847 | 5.3e-17 | |
| UNIPROTKB|F2Z4P3 | 140 | RPL23 "60S ribosomal protein L | 0.718 | 0.328 | 0.847 | 5.3e-17 | |
| UNIPROTKB|J9P897 | 140 | J9P897 "Uncharacterized protei | 0.718 | 0.328 | 0.847 | 5.3e-17 | |
| UNIPROTKB|Q9XSU3 | 140 | RPL23 "60S ribosomal protein L | 0.718 | 0.328 | 0.847 | 5.3e-17 | |
| UNIPROTKB|B9ZVP7 | 114 | RPL23 "60S ribosomal protein L | 0.718 | 0.403 | 0.847 | 5.3e-17 | |
| UNIPROTKB|J3KT29 | 122 | RPL23 "60S ribosomal protein L | 0.718 | 0.377 | 0.847 | 5.3e-17 | |
| UNIPROTKB|P62829 | 140 | RPL23 "60S ribosomal protein L | 0.718 | 0.328 | 0.847 | 5.3e-17 | |
| UNIPROTKB|P62831 | 140 | RPL23 "60S ribosomal protein L | 0.718 | 0.328 | 0.847 | 5.3e-17 | |
| MGI|MGI:1929455 | 140 | Rpl23 "ribosomal protein L23" | 0.718 | 0.328 | 0.847 | 5.3e-17 | |
| RGD|62067 | 140 | Rpl23 "ribosomal protein L23" | 0.718 | 0.328 | 0.847 | 5.3e-17 |
| UNIPROTKB|Q3T057 RPL23 "60S ribosomal protein L23" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Score = 209 (78.6 bits), Expect = 5.3e-17, P = 5.3e-17
Identities = 39/46 (84%), Positives = 45/46 (97%)
Query: 1 MSKRGRGGSAGAKFRISLALPVGAVINCADNTGAKNLFVIAVQGVK 46
MSKRGRGGS+GAKFRISL LPVGAVINCADNTGAKNL++I+V+G+K
Sbjct: 1 MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIK 46
|
|
| UNIPROTKB|F2Z4P3 RPL23 "60S ribosomal protein L23" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P897 J9P897 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9XSU3 RPL23 "60S ribosomal protein L23" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B9ZVP7 RPL23 "60S ribosomal protein L23" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3KT29 RPL23 "60S ribosomal protein L23" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P62829 RPL23 "60S ribosomal protein L23" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P62831 RPL23 "60S ribosomal protein L23" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1929455 Rpl23 "ribosomal protein L23" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|62067 Rpl23 "ribosomal protein L23" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 64 | |||
| PTZ00054 | 139 | PTZ00054, PTZ00054, 60S ribosomal protein L23; Pro | 1e-21 | |
| PRK08571 | 132 | PRK08571, rpl14p, 50S ribosomal protein L14P; Revi | 4e-09 | |
| TIGR03673 | 131 | TIGR03673, rpl14p_arch, 50S ribosomal protein L14P | 2e-08 | |
| COG0093 | 122 | COG0093, RplN, Ribosomal protein L14 [Translation, | 1e-05 | |
| pfam00238 | 122 | pfam00238, Ribosomal_L14, Ribosomal protein L14p/L | 3e-05 |
| >gnl|CDD|185418 PTZ00054, PTZ00054, 60S ribosomal protein L23; Provisional | Back alignment and domain information |
|---|
Score = 80.5 bits (199), Expect = 1e-21
Identities = 31/45 (68%), Positives = 39/45 (86%)
Query: 2 SKRGRGGSAGAKFRISLALPVGAVINCADNTGAKNLFVIAVQGVK 46
KRGRGG G KFR++L LPVGAV+NCADN+GAKNL++IAV+G+
Sbjct: 1 MKRGRGGVGGNKFRVTLGLPVGAVVNCADNSGAKNLYIIAVKGIH 45
|
Length = 139 |
| >gnl|CDD|181478 PRK08571, rpl14p, 50S ribosomal protein L14P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|132712 TIGR03673, rpl14p_arch, 50S ribosomal protein L14P | Back alignment and domain information |
|---|
| >gnl|CDD|223171 COG0093, RplN, Ribosomal protein L14 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|201105 pfam00238, Ribosomal_L14, Ribosomal protein L14p/L23e | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 64 | |||
| KOG0901|consensus | 145 | 99.82 | ||
| PTZ00054 | 139 | 60S ribosomal protein L23; Provisional | 99.57 | |
| PRK08571 | 132 | rpl14p 50S ribosomal protein L14P; Reviewed | 99.53 | |
| TIGR03673 | 131 | rpl14p_arch 50S ribosomal protein L14P. Part of th | 99.5 | |
| COG0093 | 122 | RplN Ribosomal protein L14 [Translation, ribosomal | 99.26 | |
| CHL00057 | 122 | rpl14 ribosomal protein L14 | 99.13 | |
| PRK05483 | 122 | rplN 50S ribosomal protein L14; Validated | 99.12 | |
| TIGR01067 | 122 | rplN_bact ribosomal protein L14, bacterial/organel | 99.12 | |
| PF00238 | 122 | Ribosomal_L14: Ribosomal protein L14p/L23e; InterP | 99.03 | |
| PTZ00320 | 188 | ribosomal protein L14; Provisional | 98.56 |
| >KOG0901|consensus | Back alignment and domain information |
|---|
Probab=99.82 E-value=8.5e-21 Score=130.69 Aligned_cols=56 Identities=64% Similarity=0.986 Sum_probs=54.1
Q ss_pred CCCCCCCCCCcccceeecccccccEEEEecCcCCceEEEEEEeCccccccchhhhc
Q psy6164 1 MSKRGRGGSAGAKFRISLALPVGAVINCADNTGAKNLFVIAVQGVKDLTTFEEFER 56 (64)
Q Consensus 1 m~k~~~~~~~~~k~rit~giq~~s~lnvADNSGAK~l~iI~V~g~kgrlnr~~~~~ 56 (64)
||+.+++++.+.++|+++|||+|+.+|||||||||+|+||+|+|++|||||||...
T Consensus 1 ~~~~~~~gs~~~k~r~s~~~~~g~~incaDNSgAknL~~isv~g~~Grlnrl~~A~ 56 (145)
T KOG0901|consen 1 MSSRGRGGSSGVKFRISLGLPVGAVINCADNSGAKNLYCISVKGIKGRLNRLPAAG 56 (145)
T ss_pred CcccccCcccchhhhhhhccccceEEEecCCCCcceEEEEEEeccccccccccCCC
Confidence 89999999999999999999999999999999999999999999999999999754
|
|
| >PTZ00054 60S ribosomal protein L23; Provisional | Back alignment and domain information |
|---|
| >PRK08571 rpl14p 50S ribosomal protein L14P; Reviewed | Back alignment and domain information |
|---|
| >TIGR03673 rpl14p_arch 50S ribosomal protein L14P | Back alignment and domain information |
|---|
| >COG0093 RplN Ribosomal protein L14 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >CHL00057 rpl14 ribosomal protein L14 | Back alignment and domain information |
|---|
| >PRK05483 rplN 50S ribosomal protein L14; Validated | Back alignment and domain information |
|---|
| >TIGR01067 rplN_bact ribosomal protein L14, bacterial/organelle | Back alignment and domain information |
|---|
| >PF00238 Ribosomal_L14: Ribosomal protein L14p/L23e; InterPro: IPR000218 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PTZ00320 ribosomal protein L14; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 64 | ||||
| 2zkr_k | 140 | Structure Of A Mammalian Ribosomal 60s Subunit With | 9e-18 | ||
| 3izr_M | 140 | Localization Of The Large Subunit Ribosomal Protein | 1e-15 | ||
| 4a17_J | 141 | T.Thermophila 60s Ribosomal Subunit In Complex With | 2e-11 | ||
| 3zf7_W | 139 | High-resolution Cryo-electron Microscopy Structure | 5e-11 | ||
| 1s1i_R | 137 | Structure Of The Ribosomal 80s-Eef2-Sordarin Comple | 8e-11 | ||
| 2x7n_C | 132 | Mechanism Of Eif6s Anti-Association Activity Length | 3e-10 | ||
| 3jyw_R | 131 | Structure Of The 60s Proteins For Eukaryotic Riboso | 3e-10 |
| >pdb|2ZKR|KK Chain k, Structure Of A Mammalian Ribosomal 60s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 140 | Back alignment and structure |
|
| >pdb|3IZR|M Chain M, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 140 | Back alignment and structure |
| >pdb|4A17|J Chain J, T.Thermophila 60s Ribosomal Subunit In Complex With Initiation Factor 6. This File Contains 5s Rrna, 5.8s Rrna And Proteins Of Molecule 2. Length = 141 | Back alignment and structure |
| >pdb|3ZF7|W Chain W, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 139 | Back alignment and structure |
| >pdb|1S1I|R Chain R, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From Yeast Obtained By Docking Atomic Models For Rna And Protein Components Into A 11.7 A Cryo-Em Map. This File, 1s1i, Contains 60s Subunit. The 40s Ribosomal Subunit Is In File 1s1h. Length = 137 | Back alignment and structure |
| >pdb|2X7N|C Chain C, Mechanism Of Eif6s Anti-Association Activity Length = 132 | Back alignment and structure |
| >pdb|3JYW|R Chain R, Structure Of The 60s Proteins For Eukaryotic Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 131 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 64 | |||
| 3u5e_V | 137 | L17A, YL32, 60S ribosomal protein L23-A; translati | 2e-09 | |
| 1vq8_K | 132 | 50S ribosomal protein L14P; ribosome 50S, protein- | 7e-09 | |
| 3bbo_M | 121 | Ribosomal protein L14; large ribosomal subunit, sp | 1e-04 | |
| 1whi_A | 122 | Ribosomal protein L14; rRNA-binding; 1.50A {Geobac | 1e-04 | |
| 3r8s_K | 122 | 50S ribosomal protein L14; protein biosynthesis, R | 2e-04 | |
| 3v2d_O | 122 | 50S ribosomal protein L14; ribosome associated inh | 3e-04 |
| >3u5e_V L17A, YL32, 60S ribosomal protein L23-A; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3izc_M 1s1i_R 3izs_M* 3j16_I 3o5h_U 3o58_U 3u5i_V 2x7n_C 3jyw_R 2zkr_k 3iz5_M 3izr_M 4a17_J 4a1a_J 4a1c_J 4a1e_J Length = 137 | Back alignment and structure |
|---|
Score = 49.0 bits (116), Expect = 2e-09
Identities = 26/38 (68%), Positives = 34/38 (89%)
Query: 7 GGSAGAKFRISLALPVGAVINCADNTGAKNLFVIAVQG 44
G+ G KFRISL LPVGA++NCADN+GA+NL++IAV+G
Sbjct: 4 NGAQGTKFRISLGLPVGAIMNCADNSGARNLYIIAVKG 41
|
| >1vq8_K 50S ribosomal protein L14P; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: b.39.1.1 PDB: 1vq4_K* 1vq5_K* 1vq6_K* 1vq7_K* 1s72_K* 1vq9_K* 1vqk_K* 1vql_K* 1vqm_K* 1vqn_K* 1vqo_K* 1vqp_K* 1yhq_K* 1yi2_K* 1yij_K* 1yit_K* 1yj9_K* 1yjn_K* 1yjw_K* 2otj_K* ... Length = 132 | Back alignment and structure |
|---|
| >3bbo_M Ribosomal protein L14; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Length = 121 | Back alignment and structure |
|---|
| >1whi_A Ribosomal protein L14; rRNA-binding; 1.50A {Geobacillus stearothermophilus} SCOP: b.39.1.1 PDB: 1giy_N 1ml5_n* 1c04_D 1yl3_N 2b66_O 2b9n_O 2b9p_O 487d_M Length = 122 | Back alignment and structure |
|---|
| >3r8s_K 50S ribosomal protein L14; protein biosynthesis, RNA, tRNA, transfer RNA, 23S ribosomal subunit, ribosome recycling factor, RRF, ribosome; 3.00A {Escherichia coli} PDB: 3oat_K* 3oas_K* 3ofd_K 3ofc_K 3ofr_K* 3ofz_K* 3og0_K 3ofq_K 3r8t_K 3i1n_K 1p85_I 1p86_I 1vs8_K 1vs6_K 2aw4_K 2awb_K 1vt2_K 2i2v_K 2i2t_K* 2qao_K* ... Length = 122 | Back alignment and structure |
|---|
| >3v2d_O 50S ribosomal protein L14; ribosome associated inhibitor A, RAIA, protein Y, stress RES stationary phase, ribosome hibernation, ribosome; 2.70A {Thermus thermophilus} PDB: 2j03_O 2jl6_O 2jl8_O 2v47_O 2v49_O 2wdi_O 2wdj_O 2wdl_O 2wdn_O 2wh2_O 2wh4_O 2wrj_O 2wrl_O 2wro_O 2wrr_O 2x9s_O 2x9u_O 2xg0_O 2xg2_O 2xqe_O ... Length = 122 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 64 | |||
| 3j21_J | 141 | 50S ribosomal protein L14P; archaea, archaeal, KIN | 99.82 | |
| 3u5e_V | 137 | L17A, YL32, 60S ribosomal protein L23-A; translati | 99.75 | |
| 1vq8_K | 132 | 50S ribosomal protein L14P; ribosome 50S, protein- | 99.66 | |
| 1whi_A | 122 | Ribosomal protein L14; rRNA-binding; 1.50A {Geobac | 99.31 | |
| 3bbo_M | 121 | Ribosomal protein L14; large ribosomal subunit, sp | 99.31 | |
| 3v2d_O | 122 | 50S ribosomal protein L14; ribosome associated inh | 99.28 | |
| 3r8s_K | 122 | 50S ribosomal protein L14; protein biosynthesis, R | 99.27 |
| >3j21_J 50S ribosomal protein L14P; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
Probab=99.82 E-value=5.8e-21 Score=129.46 Aligned_cols=55 Identities=36% Similarity=0.504 Sum_probs=44.0
Q ss_pred CCCCCCCCCCc-ccceeecccccccEEEEecCcCCceEEEEEEeCccccccchhhh
Q psy6164 1 MSKRGRGGSAG-AKFRISLALPVGAVINCADNTGAKNLFVIAVQGVKDLTTFEEFE 55 (64)
Q Consensus 1 m~k~~~~~~~~-~k~rit~giq~~s~lnvADNSGAK~l~iI~V~g~kgrlnr~~~~ 55 (64)
|||+++|+..+ +++++|+|||++|+|+||||||||+++||+|+|++|+++|.|+-
T Consensus 1 ~~~~~~~~~~~~~~~~~~~mIq~~t~L~VaDNSGAk~v~cI~Vlg~kg~~~r~~~A 56 (141)
T 3j21_J 1 MAKKGAGATRGVSAVRPTRALPVGAYLTVADNSGAKVIQIIGVVEYHGTRRRLASA 56 (141)
T ss_dssp ---------CCCCCSBCCCCBCTTCEEEECSSSSEEEEEEEEETTCCCCTTCCCCB
T ss_pred CCccccCCccccccccccceeccCCEEEEccCCCCcEEEEEEEcCCCCcccccccC
Confidence 89999999998 89999999999999999999999999999999999999998764
|
| >3u5e_V L17A, YL32, 60S ribosomal protein L23-A; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3izc_M 1s1i_R 3izs_M* 3j16_I 3o5h_U 3o58_U 3u5i_V 4b6a_V 2x7n_C 3jyw_R 2zkr_k 3iz5_M 3izr_M 4a17_J 4a1a_J 4a1c_J 4a1e_J | Back alignment and structure |
|---|
| >1vq8_K 50S ribosomal protein L14P; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: b.39.1.1 PDB: 1vq4_K* 1vq5_K* 1vq6_K* 1vq7_K* 1s72_K* 1vq9_K* 1vqk_K* 1vql_K* 1vqm_K* 1vqn_K* 1vqo_K* 1vqp_K* 1yhq_K* 1yi2_K* 1yij_K* 1yit_K* 1yj9_K* 1yjn_K* 1yjw_K* 2otj_K* ... | Back alignment and structure |
|---|
| >1whi_A Ribosomal protein L14; rRNA-binding; 1.50A {Geobacillus stearothermophilus} SCOP: b.39.1.1 PDB: 1giy_N 1ml5_n* 1c04_D 1yl3_N 2b66_O 2b9n_O 2b9p_O 487d_M | Back alignment and structure |
|---|
| >3bbo_M Ribosomal protein L14; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} | Back alignment and structure |
|---|
| >3v2d_O 50S ribosomal protein L14; ribosome associated inhibitor A, RAIA, protein Y, stress RES stationary phase, ribosome hibernation, ribosome; 2.70A {Thermus thermophilus} PDB: 2j03_O 2jl6_O 2jl8_O 2v47_O 2v49_O 2wdi_O 2wdj_O 2wdl_O 2wdn_O 2wh2_O 2wh4_O 2wrj_O 2wrl_O 2wro_O 2wrr_O 2x9s_O 2x9u_O 2xg0_O 2xg2_O 2xqe_O ... | Back alignment and structure |
|---|
| >3r8s_K 50S ribosomal protein L14; protein biosynthesis, RNA, tRNA, transfer RNA, 23S ribosomal subunit, ribosome recycling factor, RRF, ribosome; 3.00A {Escherichia coli} PDB: 3j19_K 3oat_K* 3oas_K* 3ofd_K 3ofc_K 3ofr_K* 3ofz_K* 3og0_K 3ofq_K 3r8t_K 3i1n_K 1p85_I 1p86_I 1vs8_K 1vs6_K 2aw4_K 2awb_K 1vt2_K 2i2v_K 2i2t_K* ... | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 64 | ||||
| d1vqok1 | 132 | b.39.1.1 (K:1-132) Ribosomal protein L14 {Archaeon | 6e-10 | |
| d2gyci1 | 121 | b.39.1.1 (I:2-122) Ribosomal protein L14 {Escheric | 1e-04 | |
| d1whia_ | 122 | b.39.1.1 (A:) Ribosomal protein L14 {Bacillus stea | 2e-04 | |
| d2j01o1 | 122 | b.39.1.1 (O:1-122) Ribosomal protein L14 {Thermus | 3e-04 |
| >d1vqok1 b.39.1.1 (K:1-132) Ribosomal protein L14 {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 132 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Ribosomal protein L14 superfamily: Ribosomal protein L14 family: Ribosomal protein L14 domain: Ribosomal protein L14 species: Archaeon Haloarcula marismortui [TaxId: 2238]
Score = 49.0 bits (117), Expect = 6e-10
Identities = 15/34 (44%), Positives = 21/34 (61%)
Query: 11 GAKFRISLALPVGAVINCADNTGAKNLFVIAVQG 44
++ L G++I CADNTGA+ L VI+V G
Sbjct: 3 ALGADVTQGLEKGSLITCADNTGARELKVISVHG 36
|
| >d2gyci1 b.39.1.1 (I:2-122) Ribosomal protein L14 {Escherichia coli [TaxId: 562]} Length = 121 | Back information, alignment and structure |
|---|
| >d1whia_ b.39.1.1 (A:) Ribosomal protein L14 {Bacillus stearothermophilus [TaxId: 1422]} Length = 122 | Back information, alignment and structure |
|---|
| >d2j01o1 b.39.1.1 (O:1-122) Ribosomal protein L14 {Thermus thermophilus [TaxId: 274]} Length = 122 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 64 | |||
| d1vqok1 | 132 | Ribosomal protein L14 {Archaeon Haloarcula marismo | 99.51 | |
| d1whia_ | 122 | Ribosomal protein L14 {Bacillus stearothermophilus | 99.2 | |
| d2j01o1 | 122 | Ribosomal protein L14 {Thermus thermophilus [TaxId | 99.15 | |
| d2gyci1 | 121 | Ribosomal protein L14 {Escherichia coli [TaxId: 56 | 99.03 |
| >d1vqok1 b.39.1.1 (K:1-132) Ribosomal protein L14 {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Ribosomal protein L14 superfamily: Ribosomal protein L14 family: Ribosomal protein L14 domain: Ribosomal protein L14 species: Archaeon Haloarcula marismortui [TaxId: 2238]
Probab=99.51 E-value=3.6e-15 Score=98.09 Aligned_cols=45 Identities=33% Similarity=0.456 Sum_probs=41.4
Q ss_pred cccceeecccccccEEEEecCcCCceEEEEEEeCccccccchhhh
Q psy6164 11 GAKFRISLALPVGAVINCADNTGAKNLFVIAVQGVKDLTTFEEFE 55 (64)
Q Consensus 11 ~~k~rit~giq~~s~lnvADNSGAK~l~iI~V~g~kgrlnr~~~~ 55 (64)
+-+.++++|||.+|+|+||||||||.++||+|+|++++.+|.|+-
T Consensus 3 ~~~~~~~~~Iq~~s~L~v~DNSGak~v~cI~V~~~~~~k~r~~~a 47 (132)
T d1vqok1 3 ALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRLPKA 47 (132)
T ss_dssp CCSSEECCCEETTCEEEECBSSSEEEEEEEEETTCCCCTTCCCEE
T ss_pred cccccccccccccCEEEEeeCCCCceEEEEEEecccccccccccc
Confidence 346789999999999999999999999999999999999998764
|
| >d1whia_ b.39.1.1 (A:) Ribosomal protein L14 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2j01o1 b.39.1.1 (O:1-122) Ribosomal protein L14 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2gyci1 b.39.1.1 (I:2-122) Ribosomal protein L14 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|