Psyllid ID: psy6394
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1045 | ||||||
| 224057323 | 493 | PREDICTED: lipoamide acyltransferase com | 0.395 | 0.837 | 0.392 | 1e-84 | |
| 326925002 | 674 | PREDICTED: lipoamide acyltransferase com | 0.433 | 0.672 | 0.366 | 1e-83 | |
| 432853434 | 498 | PREDICTED: lipoamide acyltransferase com | 0.409 | 0.859 | 0.395 | 1e-82 | |
| 449268114 | 474 | hypothetical protein A306_13406, partial | 0.425 | 0.938 | 0.369 | 1e-82 | |
| 355682807 | 473 | dihydrolipoamide branched chain transacy | 0.388 | 0.858 | 0.383 | 2e-82 | |
| 397474090 | 482 | PREDICTED: lipoamide acyltransferase com | 0.395 | 0.856 | 0.384 | 4e-82 | |
| 392494079 | 482 | lipoamide acyltransferase component of b | 0.395 | 0.856 | 0.384 | 4e-82 | |
| 426330491 | 482 | PREDICTED: lipoamide acyltransferase com | 0.396 | 0.858 | 0.387 | 5e-82 | |
| 45382815 | 493 | lipoamide acyltransferase component of b | 0.430 | 0.912 | 0.364 | 6e-82 | |
| 179354 | 477 | branched chain acyltransferase precursor | 0.396 | 0.867 | 0.387 | 6e-82 |
| >gi|224057323|ref|XP_002188172.1| PREDICTED: lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial [Taeniopygia guttata] | Back alignment and taxonomy information |
|---|
Score = 322 bits (824), Expect = 1e-84, Method: Compositional matrix adjust.
Identities = 182/464 (39%), Positives = 266/464 (57%), Gaps = 51/464 (10%)
Query: 446 KLIQFNLADIGEGIREVNIKEWNGNVTEGARINEFDVVCEVESDKASVTITSRYKGTVRK 505
+++QF L+DIGEGI EV +KEW + EG +++FD +CEV+SDKASVTITSRY G +RK
Sbjct: 63 QIVQFKLSDIGEGITEVTVKEWY--IKEGDSVSQFDSICEVQSDKASVTITSRYDGVIRK 120
Query: 506 VYYGEGDVALVGKPLLDIEVE-DEGVAAEEADSLDRKAAPGVS-------EVNTPDTSDQ 557
++Y D A VGKPL+DIE++ +GVA+EE D P VS E+ T
Sbjct: 121 LHYSIDDTAFVGKPLVDIEIDASKGVASEE----DVVETPPVSHEEHTHQEIKGHKTLAT 176
Query: 558 PNETLHKDPNKIDTKELRGTGKQGRVLKEDIITYMNSPSDETNPAHTAHVREASNVISIR 617
P N I E+ GTGK R+LKEDI+ Y+ + P
Sbjct: 177 PAVRRLAMENNIKLSEVVGTGKDNRILKEDILNYLAKQTGAILPLSP------------- 223
Query: 618 GYVKGMFKSMTEANTIPSLRLTEEVDTTQLRDVKKEDIITYMNSPSDETNPAHTAHVREA 677
+A +P R E V +K P + P + E
Sbjct: 224 -----------KAEIVPPQRKAEAVPAAPKDKARK--------IPVPVSRPLAFS---EK 261
Query: 678 SNVIPIRGYVKGMFKSMTEANTIPSLRLTEEVDTTQLRDVKNQVSALYQEKFRLKLTYMP 737
P+ G+ K M K+M+ A IP ++E+D TQL ++ ++ L + + +KL++MP
Sbjct: 262 DKTEPVTGFQKAMVKTMSAALKIPHFGYSDEIDLTQLVQLREELKPLAEIR-GVKLSFMP 320
Query: 738 FFIKALSLCMTEHPILNASIDPTQENILVNPDHNISIAIDTKHGLVVPNIKSVNKLCLLD 797
FFIKA SL + ++PILNAS+D +N+ HNI +A+DT+ GL+VPN+K+V + D
Sbjct: 321 FFIKAASLGLLQYPILNASLDENCQNVTYKASHNIGVAMDTEQGLIVPNVKNVQVCSVFD 380
Query: 798 ITRELLRIQGCSHEGKVLPRDIQGGTISMSNVGNVGGTLVQPIIVPGQVCIVAFGKIQLL 857
I EL R+Q G++ D+ GGT ++SN+G +GGT +P+I+P +V I A GKIQ+L
Sbjct: 381 IAVELNRLQSLGSAGQLGTSDLTGGTFTLSNIGTIGGTYAKPVILPPEVAIGALGKIQVL 440
Query: 858 PRFDAEMRIVAKCILNVTWAADHRVVDGATVARAATLWKS-LEN 900
PRF+++ ++ I+NV+W+ADHR++DGAT+AR + LWKS LEN
Sbjct: 441 PRFNSKGEVIKAQIMNVSWSADHRIIDGATMARFSNLWKSYLEN 484
|
Source: Taeniopygia guttata Species: Taeniopygia guttata Genus: Taeniopygia Family: Estrildidae Order: Passeriformes Class: Aves Phylum: Chordata Superkingdom: Eukaryota |
| >gi|326925002|ref|XP_003208711.1| PREDICTED: lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial-like [Meleagris gallopavo] | Back alignment and taxonomy information |
|---|
| >gi|432853434|ref|XP_004067705.1| PREDICTED: lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial-like [Oryzias latipes] | Back alignment and taxonomy information |
|---|
| >gi|449268114|gb|EMC78984.1| hypothetical protein A306_13406, partial [Columba livia] | Back alignment and taxonomy information |
|---|
| >gi|355682807|gb|AER96987.1| dihydrolipoamide branched chain transacylase E2 [Mustela putorius furo] | Back alignment and taxonomy information |
|---|
| >gi|397474090|ref|XP_003808523.1| PREDICTED: lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial [Pan paniscus] gi|410254896|gb|JAA15415.1| dihydrolipoamide branched chain transacylase E2 [Pan troglodytes] gi|410254898|gb|JAA15416.1| dihydrolipoamide branched chain transacylase E2 [Pan troglodytes] gi|410254900|gb|JAA15417.1| dihydrolipoamide branched chain transacylase E2 [Pan troglodytes] gi|410293998|gb|JAA25599.1| dihydrolipoamide branched chain transacylase E2 [Pan troglodytes] gi|410294000|gb|JAA25600.1| dihydrolipoamide branched chain transacylase E2 [Pan troglodytes] | Back alignment and taxonomy information |
|---|
| >gi|392494079|ref|NP_001909.3| lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial precursor [Homo sapiens] gi|400668|sp|P11182.3|ODB2_HUMAN RecName: Full=Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial; AltName: Full=Branched-chain alpha-keto acid dehydrogenase complex component E2; Short=BCKAD-E2; Short=BCKADE2; AltName: Full=Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto acid dehydrogenase complex; AltName: Full=Dihydrolipoamide branched chain transacylase; AltName: Full=Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase; Flags: Precursor gi|30490|emb|CAA47285.1| transacylase [Homo sapiens] gi|16741763|gb|AAH16675.1| Dihydrolipoamide branched chain transacylase E2 [Homo sapiens] gi|30583583|gb|AAP36036.1| dihydrolipoamide branched chain transacylase (E2 component of branched chain keto acid dehydrogenase complex; maple syrup urine disease) [Homo sapiens] gi|61359897|gb|AAX41783.1| dihydrolipoamide branched chain transacylase [synthetic construct] gi|61359903|gb|AAX41784.1| dihydrolipoamide branched chain transacylase [synthetic construct] gi|119593369|gb|EAW72963.1| dihydrolipoamide branched chain transacylase E2 [Homo sapiens] gi|189053756|dbj|BAG36008.1| unnamed protein product [Homo sapiens] | Back alignment and taxonomy information |
|---|
| >gi|426330491|ref|XP_004026244.1| PREDICTED: lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial [Gorilla gorilla gorilla] | Back alignment and taxonomy information |
|---|
| >gi|45382815|ref|NP_989987.1| lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial precursor [Gallus gallus] gi|12964602|dbj|BAB32667.1| branched-chain alpha-keto acid dihydrolipoyl acyltransferase [Gallus gallus] | Back alignment and taxonomy information |
|---|
| >gi|179354|gb|AAA35589.1| branched chain acyltransferase precursor [Homo sapiens] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1045 | ||||||
| UNIPROTKB|P11182 | 482 | DBT "Lipoamide acyltransferase | 0.208 | 0.452 | 0.436 | 2.5e-86 | |
| ZFIN|ZDB-GENE-050320-85 | 493 | dbt "dihydrolipoamide branched | 0.208 | 0.442 | 0.445 | 7.1e-85 | |
| MGI|MGI:105386 | 482 | Dbt "dihydrolipoamide branched | 0.237 | 0.514 | 0.411 | 8.5e-83 | |
| UNIPROTKB|P11181 | 482 | DBT "Lipoamide acyltransferase | 0.208 | 0.452 | 0.436 | 1.1e-82 | |
| UNIPROTKB|F1S563 | 482 | DBT "Uncharacterized protein" | 0.237 | 0.514 | 0.399 | 1.2e-82 | |
| UNIPROTKB|E2RQG4 | 482 | DBT "Uncharacterized protein" | 0.208 | 0.452 | 0.427 | 3.2e-82 | |
| UNIPROTKB|F1P1X9 | 493 | DBT "Uncharacterized protein" | 0.208 | 0.442 | 0.440 | 1.4e-81 | |
| WB|WBGene00014054 | 448 | ZK669.4 [Caenorhabditis elegan | 0.248 | 0.580 | 0.391 | 1.1e-75 | |
| TIGR_CMR|SO_2341 | 535 | SO_2341 "alpha keto acid dehyd | 0.228 | 0.446 | 0.419 | 6.3e-71 | |
| UNIPROTKB|G4MSC5 | 523 | MGG_04449 "Branched-chain alph | 0.204 | 0.409 | 0.388 | 1.2e-70 |
| UNIPROTKB|P11182 DBT "Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 503 (182.1 bits), Expect = 2.5e-86, Sum P(4) = 2.5e-86
Identities = 96/220 (43%), Positives = 148/220 (67%)
Query: 682 PIRGYVKGMFKSMTEANTIPSLRLTEEVDTTQLRDVKNQVSALYQEKFRLKLTYMPFFIK 741
PI+G+ K M K+M+ A IP +E+D T+L ++ ++ + + +KL++MPFF+K
Sbjct: 255 PIKGFQKAMVKTMSAALKIPHFGYCDEIDLTELVKLREELKPIAFAR-GIKLSFMPFFLK 313
Query: 742 ALSLCMTEHPILNASIDPTQENILVNPDHNISIAIDTKHGLVVPNIKSVNKLCLLDITRE 801
A SL + + PILNAS+D +NI HNI IA+DT+ GL+VPN+K+V + DI E
Sbjct: 314 AASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQICSIFDIATE 373
Query: 802 LLRIQGCSHEGKVLPRDIQGGTISMSNVGNVGGTLVQPIIVPGQVCIVAFGKIQLLPRFD 861
L R+Q G++ D+ GGT ++SN+G++GGT +P+I+P +V I A G I+ +PRF+
Sbjct: 374 LNRLQKLGSVGQLSTTDLTGGTFTLSNIGSIGGTFAKPVIMPPEVAIGALGSIKAIPRFN 433
Query: 862 AEMRIVAKCILNVTWAADHRVVDGATVARAATLWKS-LEN 900
+ + I+NV+W+ADHRV+DGAT++R + LWKS LEN
Sbjct: 434 QKGEVYKAQIMNVSWSADHRVIDGATMSRFSNLWKSYLEN 473
|
|
| ZFIN|ZDB-GENE-050320-85 dbt "dihydrolipoamide branched chain transacylase E2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:105386 Dbt "dihydrolipoamide branched chain transacylase E2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P11181 DBT "Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S563 DBT "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RQG4 DBT "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P1X9 DBT "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00014054 ZK669.4 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_2341 SO_2341 "alpha keto acid dehydrogenase complex, E2 component" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4MSC5 MGG_04449 "Branched-chain alpha-keto acid lipoamide acyltransferase" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1045 | |||
| PLN02528 | 416 | PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase | 1e-107 | |
| PRK11855 | 547 | PRK11855, PRK11855, dihydrolipoamide acetyltransfe | 1e-86 | |
| COG0508 | 404 | COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogena | 5e-69 | |
| PRK11856 | 411 | PRK11856, PRK11856, branched-chain alpha-keto acid | 1e-68 | |
| pfam00198 | 212 | pfam00198, 2-oxoacid_dh, 2-oxoacid dehydrogenases | 4e-64 | |
| PLN02528 | 416 | PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase | 8e-51 | |
| pfam00198 | 212 | pfam00198, 2-oxoacid_dh, 2-oxoacid dehydrogenases | 7e-47 | |
| PRK11854 | 633 | PRK11854, aceF, pyruvate dehydrogenase dihydrolipo | 7e-45 | |
| PRK11855 | 547 | PRK11855, PRK11855, dihydrolipoamide acetyltransfe | 4e-43 | |
| TIGR01348 | 546 | TIGR01348, PDHac_trf_long, pyruvate dehydrogenase | 1e-41 | |
| PRK11857 | 306 | PRK11857, PRK11857, dihydrolipoamide acetyltransfe | 2e-37 | |
| PLN02528 | 416 | PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase | 1e-36 | |
| TIGR01347 | 403 | TIGR01347, sucB, 2-oxoglutarate dehydrogenase comp | 3e-36 | |
| PRK11856 | 411 | PRK11856, PRK11856, branched-chain alpha-keto acid | 2e-35 | |
| TIGR01349 | 436 | TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase | 5e-33 | |
| TIGR02927 | 579 | TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena | 1e-31 | |
| PRK11856 | 411 | PRK11856, PRK11856, branched-chain alpha-keto acid | 4e-31 | |
| COG0508 | 404 | COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogena | 1e-30 | |
| PRK11855 | 547 | PRK11855, PRK11855, dihydrolipoamide acetyltransfe | 1e-25 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 8e-25 | |
| PRK11857 | 306 | PRK11857, PRK11857, dihydrolipoamide acetyltransfe | 1e-24 | |
| PLN02744 | 539 | PLN02744, PLN02744, dihydrolipoyllysine-residue ac | 1e-24 | |
| COG0508 | 404 | COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogena | 2e-23 | |
| PRK11854 | 633 | PRK11854, aceF, pyruvate dehydrogenase dihydrolipo | 5e-23 | |
| PRK05704 | 407 | PRK05704, PRK05704, dihydrolipoamide succinyltrans | 4e-21 | |
| cd06849 | 74 | cd06849, lipoyl_domain, Lipoyl domain of the dihyd | 1e-20 | |
| TIGR01348 | 546 | TIGR01348, PDHac_trf_long, pyruvate dehydrogenase | 2e-20 | |
| cd06849 | 74 | cd06849, lipoyl_domain, Lipoyl domain of the dihyd | 4e-20 | |
| PRK14843 | 347 | PRK14843, PRK14843, dihydrolipoamide acetyltransfe | 1e-19 | |
| TIGR01349 | 436 | TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase | 5e-19 | |
| PLN02226 | 463 | PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E | 2e-18 | |
| PRK11855 | 547 | PRK11855, PRK11855, dihydrolipoamide acetyltransfe | 4e-17 | |
| PRK11855 | 547 | PRK11855, PRK11855, dihydrolipoamide acetyltransfe | 3e-16 | |
| TIGR02927 | 579 | TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena | 2e-15 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 2e-15 | |
| PLN02744 | 539 | PLN02744, PLN02744, dihydrolipoyllysine-residue ac | 4e-15 | |
| pfam00364 | 73 | pfam00364, Biotin_lipoyl, Biotin-requiring enzyme | 3e-14 | |
| pfam00364 | 73 | pfam00364, Biotin_lipoyl, Biotin-requiring enzyme | 1e-13 | |
| TIGR01347 | 403 | TIGR01347, sucB, 2-oxoglutarate dehydrogenase comp | 3e-13 | |
| TIGR01349 | 436 | TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase | 3e-13 | |
| TIGR01348 | 546 | TIGR01348, PDHac_trf_long, pyruvate dehydrogenase | 4e-12 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 4e-12 | |
| PRK11854 | 633 | PRK11854, aceF, pyruvate dehydrogenase dihydrolipo | 1e-11 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 1e-11 | |
| PLN02744 | 539 | PLN02744, PLN02744, dihydrolipoyllysine-residue ac | 2e-11 | |
| PLN02226 | 463 | PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E | 3e-11 | |
| PRK05704 | 407 | PRK05704, PRK05704, dihydrolipoamide succinyltrans | 4e-11 | |
| TIGR01347 | 403 | TIGR01347, sucB, 2-oxoglutarate dehydrogenase comp | 8e-11 | |
| PRK14843 | 347 | PRK14843, PRK14843, dihydrolipoamide acetyltransfe | 8e-11 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 6e-10 | |
| PRK05704 | 407 | PRK05704, PRK05704, dihydrolipoamide succinyltrans | 2e-09 | |
| PRK11854 | 633 | PRK11854, aceF, pyruvate dehydrogenase dihydrolipo | 1e-08 | |
| PRK11854 | 633 | PRK11854, aceF, pyruvate dehydrogenase dihydrolipo | 2e-08 | |
| TIGR02927 | 579 | TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena | 2e-08 | |
| pfam02817 | 39 | pfam02817, E3_binding, e3 binding domain | 1e-07 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 2e-07 | |
| PRK11854 | 633 | PRK11854, aceF, pyruvate dehydrogenase dihydrolipo | 4e-07 | |
| PRK11854 | 633 | PRK11854, aceF, pyruvate dehydrogenase dihydrolipo | 4e-07 | |
| PRK11857 | 306 | PRK11857, PRK11857, dihydrolipoamide acetyltransfe | 7e-06 | |
| PRK14875 | 371 | PRK14875, PRK14875, acetoin dehydrogenase E2 subun | 3e-05 | |
| PRK14875 | 371 | PRK14875, PRK14875, acetoin dehydrogenase E2 subun | 3e-05 | |
| cd06663 | 73 | cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_ | 2e-04 | |
| cd06663 | 73 | cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_ | 2e-04 | |
| COG0511 | 140 | COG0511, AccB, Biotin carboxyl carrier protein [Li | 2e-04 | |
| COG0511 | 140 | COG0511, AccB, Biotin carboxyl carrier protein [Li | 2e-04 | |
| cd06850 | 67 | cd06850, biotinyl_domain, The biotinyl-domain or b | 5e-04 | |
| cd06850 | 67 | cd06850, biotinyl_domain, The biotinyl-domain or b | 5e-04 | |
| TIGR01348 | 546 | TIGR01348, PDHac_trf_long, pyruvate dehydrogenase | 6e-04 | |
| TIGR02712 | 1201 | TIGR02712, urea_carbox, urea carboxylase | 7e-04 | |
| TIGR02712 | 1201 | TIGR02712, urea_carbox, urea carboxylase | 7e-04 | |
| pfam02817 | 39 | pfam02817, E3_binding, e3 binding domain | 0.002 | |
| COG4770 | 645 | COG4770, COG4770, Acetyl/propionyl-CoA carboxylase | 0.002 | |
| COG4770 | 645 | COG4770, COG4770, Acetyl/propionyl-CoA carboxylase | 0.002 |
| >gnl|CDD|215289 PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase E2 component | Back alignment and domain information |
|---|
Score = 339 bits (872), Expect = e-107
Identities = 157/457 (34%), Positives = 229/457 (50%), Gaps = 61/457 (13%)
Query: 450 FNLADIGEGIREVNIKEWNGNVTEGARINEFDVVCEVESDKASVTITSRYKGTVRKVYYG 509
LA GEGI E + W V EG ++ EF +CEV+SDKA++ ITSRYKG V ++ +
Sbjct: 1 VPLAQTGEGIAECELLRWF--VKEGDQVEEFQPLCEVQSDKATIEITSRYKGKVAQINFS 58
Query: 510 EGDVALVGKPLLDIEVEDEGVAAEEADSLDRKAAPGVSEVNTPDTSDQPNET-------- 561
GD+ VG+ LL I VED ++ L ++ VS + + +
Sbjct: 59 PGDIVKVGETLLKIMVEDSQHLRSDSLLLPTDSSNIVSLAESDERGSNLSGVLSTPAVRH 118
Query: 562 LHKDPNKIDTKELRGTGKQGRVLKEDIITYMNSPSDETNPAHTAHVREASNVISIRGYVK 621
L K ID ++ GTGK GRVLKED++ Y K
Sbjct: 119 LAKQ-YGIDLNDILGTGKDGRVLKEDVLKYAAQ--------------------------K 151
Query: 622 GMFKSMTEANTIPSLRLTEEVDTTQLRDVKKEDIITYMNSPSDETNPAHTAHVREASNVI 681
G+ K + A E + S D+T I
Sbjct: 152 GVVKDSSSAEEATIAEQEEFSTSVSTPT---------EQSYEDKT--------------I 188
Query: 682 PIRGYVKGMFKSMTEANTIPSLRLTEEVDTTQLRDVKNQVSALYQEKFRLKLTYMPFFIK 741
P+RG+ + M K+MT A +P EE++ L ++K +K T++PF IK
Sbjct: 189 PLRGFQRAMVKTMTAAAKVPHFHYVEEINVDALVELKASFQEN-NTDPTVKHTFLPFLIK 247
Query: 742 ALSLCMTEHPILNASIDPTQENILVNPDHNISIAIDTKHGLVVPNIKSVNKLCLLDITRE 801
+LS+ ++++P+LN+ + I + HNI +A+ T+HGLVVPNIK+V L LL+IT+E
Sbjct: 248 SLSMALSKYPLLNSCFNEETSEIRLKGSHNIGVAMATEHGLVVPNIKNVQSLSLLEITKE 307
Query: 802 LLRIQGCSHEGKVLPRDIQGGTISMSNVGNVGGTLVQPIIVPGQVCIVAFGKIQLLPRFD 861
L R+Q + E K+ P DI GGTI++SN+G +GG P++ +V I+A G+IQ +PRF
Sbjct: 308 LSRLQHLAAENKLNPEDITGGTITLSNIGAIGGKFGSPVLNLPEVAIIALGRIQKVPRFV 367
Query: 862 AEMRIVAKCILNVTWAADHRVVDGATVARAATLWKSL 898
+ + I+ VT ADHRV+DGATVAR WKS
Sbjct: 368 DDGNVYPASIMTVTIGADHRVLDGATVARFCNEWKSY 404
|
Length = 416 |
| >gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223582 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|237001 PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|215782 pfam00198, 2-oxoacid_dh, 2-oxoacid dehydrogenases acyltransferase (catalytic domain) | Back alignment and domain information |
|---|
| >gnl|CDD|215289 PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >gnl|CDD|215782 pfam00198, 2-oxoacid_dh, 2-oxoacid dehydrogenases acyltransferase (catalytic domain) | Back alignment and domain information |
|---|
| >gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233366 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >gnl|CDD|237002 PRK11857, PRK11857, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|215289 PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >gnl|CDD|233365 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >gnl|CDD|237001 PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233367 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|237001 PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223582 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237002 PRK11857, PRK11857, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|215397 PLN02744, PLN02744, dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex | Back alignment and domain information |
|---|
| >gnl|CDD|223582 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235571 PRK05704, PRK05704, dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|133458 cd06849, lipoyl_domain, Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|233366 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >gnl|CDD|133458 cd06849, lipoyl_domain, Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|184847 PRK14843, PRK14843, dihydrolipoamide acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233367 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >gnl|CDD|177871 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215397 PLN02744, PLN02744, dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex | Back alignment and domain information |
|---|
| >gnl|CDD|201182 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|201182 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|233365 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >gnl|CDD|233367 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >gnl|CDD|233366 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215397 PLN02744, PLN02744, dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex | Back alignment and domain information |
|---|
| >gnl|CDD|177871 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >gnl|CDD|235571 PRK05704, PRK05704, dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233365 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >gnl|CDD|184847 PRK14843, PRK14843, dihydrolipoamide acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235571 PRK05704, PRK05704, dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|202412 pfam02817, E3_binding, e3 binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237002 PRK11857, PRK11857, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|184875 PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184875 PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133456 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
| >gnl|CDD|133456 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
| >gnl|CDD|223585 COG0511, AccB, Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223585 COG0511, AccB, Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|133459 cd06850, biotinyl_domain, The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >gnl|CDD|133459 cd06850, biotinyl_domain, The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >gnl|CDD|233366 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >gnl|CDD|233980 TIGR02712, urea_carbox, urea carboxylase | Back alignment and domain information |
|---|
| >gnl|CDD|233980 TIGR02712, urea_carbox, urea carboxylase | Back alignment and domain information |
|---|
| >gnl|CDD|202412 pfam02817, E3_binding, e3 binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|227111 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|227111 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1045 | |||
| TIGR02927 | 590 | SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo | 100.0 | |
| TIGR01348 | 546 | PDHac_trf_long pyruvate dehydrogenase complex dihy | 100.0 | |
| PRK11854 | 633 | aceF pyruvate dehydrogenase dihydrolipoyltransacet | 100.0 | |
| PRK11855 | 547 | dihydrolipoamide acetyltransferase; Reviewed | 100.0 | |
| PRK05704 | 407 | dihydrolipoamide succinyltransferase; Validated | 100.0 | |
| TIGR01347 | 403 | sucB 2-oxoglutarate dehydrogenase complex dihydrol | 100.0 | |
| PLN02744 | 539 | dihydrolipoyllysine-residue acetyltransferase comp | 100.0 | |
| PLN02528 | 416 | 2-oxoisovalerate dehydrogenase E2 component | 100.0 | |
| KOG0558|consensus | 474 | 100.0 | ||
| COG0508 | 404 | AceF Pyruvate/2-oxoglutarate dehydrogenase complex | 100.0 | |
| TIGR01349 | 435 | PDHac_trf_mito pyruvate dehydrogenase complex dihy | 100.0 | |
| KOG0557|consensus | 470 | 100.0 | ||
| PLN02226 | 463 | 2-oxoglutarate dehydrogenase E2 component | 100.0 | |
| PTZ00144 | 418 | dihydrolipoamide succinyltransferase; Provisional | 100.0 | |
| PRK14843 | 347 | dihydrolipoamide acetyltransferase; Provisional | 100.0 | |
| PRK11856 | 411 | branched-chain alpha-keto acid dehydrogenase subun | 100.0 | |
| KOG0559|consensus | 457 | 100.0 | ||
| PRK11857 | 306 | dihydrolipoamide acetyltransferase; Reviewed | 100.0 | |
| KOG0557|consensus | 470 | 100.0 | ||
| PLN02226 | 463 | 2-oxoglutarate dehydrogenase E2 component | 100.0 | |
| PTZ00144 | 418 | dihydrolipoamide succinyltransferase; Provisional | 100.0 | |
| PF00198 | 231 | 2-oxoacid_dh: 2-oxoacid dehydrogenases acyltransfe | 100.0 | |
| TIGR02927 | 590 | SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo | 100.0 | |
| TIGR01348 | 546 | PDHac_trf_long pyruvate dehydrogenase complex dihy | 100.0 | |
| PRK14843 | 347 | dihydrolipoamide acetyltransferase; Provisional | 100.0 | |
| PRK11854 | 633 | aceF pyruvate dehydrogenase dihydrolipoyltransacet | 100.0 | |
| PRK12270 | 1228 | kgd alpha-ketoglutarate decarboxylase; Reviewed | 100.0 | |
| PRK11855 | 547 | dihydrolipoamide acetyltransferase; Reviewed | 100.0 | |
| PRK11857 | 306 | dihydrolipoamide acetyltransferase; Reviewed | 100.0 | |
| PF00198 | 231 | 2-oxoacid_dh: 2-oxoacid dehydrogenases acyltransfe | 100.0 | |
| PRK05704 | 407 | dihydrolipoamide succinyltransferase; Validated | 100.0 | |
| TIGR01347 | 403 | sucB 2-oxoglutarate dehydrogenase complex dihydrol | 100.0 | |
| PLN02528 | 416 | 2-oxoisovalerate dehydrogenase E2 component | 100.0 | |
| PLN02744 | 539 | dihydrolipoyllysine-residue acetyltransferase comp | 100.0 | |
| KOG0559|consensus | 457 | 100.0 | ||
| TIGR01349 | 435 | PDHac_trf_mito pyruvate dehydrogenase complex dihy | 100.0 | |
| COG0508 | 404 | AceF Pyruvate/2-oxoglutarate dehydrogenase complex | 100.0 | |
| KOG0558|consensus | 474 | 100.0 | ||
| PRK12270 | 1228 | kgd alpha-ketoglutarate decarboxylase; Reviewed | 100.0 | |
| PRK11856 | 411 | branched-chain alpha-keto acid dehydrogenase subun | 99.97 | |
| PF00364 | 74 | Biotin_lipoyl: Biotin-requiring enzyme; InterPro: | 99.64 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 99.64 | |
| PF00364 | 74 | Biotin_lipoyl: Biotin-requiring enzyme; InterPro: | 99.6 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 99.59 | |
| PRK06748 | 83 | hypothetical protein; Validated | 99.53 | |
| PRK11892 | 464 | pyruvate dehydrogenase subunit beta; Provisional | 99.49 | |
| PRK06748 | 83 | hypothetical protein; Validated | 99.46 | |
| PRK05889 | 71 | putative acetyl-CoA carboxylase biotin carboxyl ca | 99.36 | |
| cd06663 | 73 | Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar | 99.31 | |
| PRK11892 | 464 | pyruvate dehydrogenase subunit beta; Provisional | 99.31 | |
| PRK08225 | 70 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 99.27 | |
| PRK05889 | 71 | putative acetyl-CoA carboxylase biotin carboxyl ca | 99.26 | |
| COG0511 | 140 | AccB Biotin carboxyl carrier protein [Lipid metabo | 99.24 | |
| cd06663 | 73 | Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar | 99.22 | |
| PF02817 | 39 | E3_binding: e3 binding domain; InterPro: IPR004167 | 99.21 | |
| PRK08225 | 70 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 99.13 | |
| PRK06549 | 130 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 99.11 | |
| COG0511 | 140 | AccB Biotin carboxyl carrier protein [Lipid metabo | 99.1 | |
| PRK07051 | 80 | hypothetical protein; Validated | 99.06 | |
| PRK05641 | 153 | putative acetyl-CoA carboxylase biotin carboxyl ca | 99.04 | |
| PRK06549 | 130 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 99.0 | |
| PLN02983 | 274 | biotin carboxyl carrier protein of acetyl-CoA carb | 98.99 | |
| PRK07051 | 80 | hypothetical protein; Validated | 98.97 | |
| TIGR00531 | 156 | BCCP acetyl-CoA carboxylase, biotin carboxyl carri | 98.97 | |
| cd06850 | 67 | biotinyl_domain The biotinyl-domain or biotin carb | 98.96 | |
| PRK05641 | 153 | putative acetyl-CoA carboxylase biotin carboxyl ca | 98.91 | |
| PRK06302 | 155 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 98.9 | |
| PRK14042 | 596 | pyruvate carboxylase subunit B; Provisional | 98.87 | |
| PLN02983 | 274 | biotin carboxyl carrier protein of acetyl-CoA carb | 98.85 | |
| PF02817 | 39 | E3_binding: e3 binding domain; InterPro: IPR004167 | 98.85 | |
| cd06850 | 67 | biotinyl_domain The biotinyl-domain or biotin carb | 98.85 | |
| cd06849 | 74 | lipoyl_domain Lipoyl domain of the dihydrolipoyl a | 98.84 | |
| TIGR00531 | 156 | BCCP acetyl-CoA carboxylase, biotin carboxyl carri | 98.8 | |
| cd06849 | 74 | lipoyl_domain Lipoyl domain of the dihydrolipoyl a | 98.75 | |
| PRK06302 | 155 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 98.74 | |
| TIGR02712 | 1201 | urea_carbox urea carboxylase. Members of this fami | 98.72 | |
| PRK14042 | 596 | pyruvate carboxylase subunit B; Provisional | 98.71 | |
| PF00302 | 206 | CAT: Chloramphenicol acetyltransferase; InterPro: | 98.71 | |
| TIGR01108 | 582 | oadA oxaloacetate decarboxylase alpha subunit. Thi | 98.65 | |
| TIGR01235 | 1143 | pyruv_carbox pyruvate carboxylase. This enzyme pla | 98.64 | |
| PRK14040 | 593 | oxaloacetate decarboxylase; Provisional | 98.62 | |
| PRK13757 | 219 | chloramphenicol acetyltransferase; Provisional | 98.59 | |
| TIGR02712 | 1201 | urea_carbox urea carboxylase. Members of this fami | 98.56 | |
| TIGR01108 | 582 | oadA oxaloacetate decarboxylase alpha subunit. Thi | 98.5 | |
| PRK14040 | 593 | oxaloacetate decarboxylase; Provisional | 98.48 | |
| PRK09282 | 592 | pyruvate carboxylase subunit B; Validated | 98.47 | |
| TIGR01235 | 1143 | pyruv_carbox pyruvate carboxylase. This enzyme pla | 98.43 | |
| PRK12999 | 1146 | pyruvate carboxylase; Reviewed | 98.4 | |
| COG4770 | 645 | Acetyl/propionyl-CoA carboxylase, alpha subunit [L | 98.33 | |
| COG1038 | 1149 | PycA Pyruvate carboxylase [Energy production and c | 98.31 | |
| PRK09282 | 592 | pyruvate carboxylase subunit B; Validated | 98.3 | |
| PRK12999 | 1146 | pyruvate carboxylase; Reviewed | 98.18 | |
| COG4770 | 645 | Acetyl/propionyl-CoA carboxylase, alpha subunit [L | 98.12 | |
| KOG0369|consensus | 1176 | 98.01 | ||
| COG1038 | 1149 | PycA Pyruvate carboxylase [Energy production and c | 97.92 | |
| cd06848 | 96 | GCS_H Glycine cleavage H-protein. Glycine cleavage | 97.87 | |
| cd06848 | 96 | GCS_H Glycine cleavage H-protein. Glycine cleavage | 97.73 | |
| COG4845 | 219 | Chloramphenicol O-acetyltransferase [Defense mecha | 97.63 | |
| TIGR03077 | 110 | not_gcvH glycine cleavage protein H-like protein, | 97.58 | |
| KOG0369|consensus | 1176 | 97.51 | ||
| PRK01202 | 127 | glycine cleavage system protein H; Provisional | 97.48 | |
| KOG0238|consensus | 670 | 97.47 | ||
| PRK00624 | 114 | glycine cleavage system protein H; Provisional | 97.44 | |
| TIGR03077 | 110 | not_gcvH glycine cleavage protein H-like protein, | 97.29 | |
| PRK13380 | 144 | glycine cleavage system protein H; Provisional | 97.21 | |
| KOG0368|consensus | 2196 | 97.16 | ||
| PRK00624 | 114 | glycine cleavage system protein H; Provisional | 97.12 | |
| KOG0238|consensus | 670 | 97.05 | ||
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 96.99 | |
| PRK10559 | 310 | p-hydroxybenzoic acid efflux subunit AaeA; Provisi | 96.96 | |
| PRK13380 | 144 | glycine cleavage system protein H; Provisional | 96.93 | |
| KOG0368|consensus | 2196 | 96.85 | ||
| TIGR01730 | 322 | RND_mfp RND family efflux transporter, MFP subunit | 96.84 | |
| PRK09783 | 409 | copper/silver efflux system membrane fusion protei | 96.76 | |
| PF13533 | 50 | Biotin_lipoyl_2: Biotin-lipoyl like | 96.75 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 96.69 | |
| TIGR00527 | 127 | gcvH glycine cleavage system H protein. The genome | 96.68 | |
| PRK01202 | 127 | glycine cleavage system protein H; Provisional | 96.65 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 96.61 | |
| PRK10559 | 310 | p-hydroxybenzoic acid efflux subunit AaeA; Provisi | 96.57 | |
| PRK15136 | 390 | multidrug efflux system protein EmrA; Provisional | 96.55 | |
| PRK09578 | 385 | periplasmic multidrug efflux lipoprotein precursor | 96.49 | |
| TIGR01730 | 322 | RND_mfp RND family efflux transporter, MFP subunit | 96.48 | |
| PF13533 | 50 | Biotin_lipoyl_2: Biotin-lipoyl like | 96.47 | |
| PRK03598 | 331 | putative efflux pump membrane fusion protein; Prov | 96.37 | |
| TIGR00527 | 127 | gcvH glycine cleavage system H protein. The genome | 96.28 | |
| PRK09783 | 409 | copper/silver efflux system membrane fusion protei | 96.25 | |
| PRK09859 | 385 | multidrug efflux system protein MdtE; Provisional | 96.2 | |
| PF01597 | 122 | GCV_H: Glycine cleavage H-protein; InterPro: IPR00 | 96.2 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 96.18 | |
| PRK15030 | 397 | multidrug efflux system transporter AcrA; Provisio | 96.07 | |
| PRK09578 | 385 | periplasmic multidrug efflux lipoprotein precursor | 95.95 | |
| PRK15136 | 390 | multidrug efflux system protein EmrA; Provisional | 95.91 | |
| PRK11578 | 370 | macrolide transporter subunit MacA; Provisional | 95.89 | |
| PRK12784 | 84 | hypothetical protein; Provisional | 95.89 | |
| PRK03598 | 331 | putative efflux pump membrane fusion protein; Prov | 95.88 | |
| PRK11556 | 415 | multidrug efflux system subunit MdtA; Provisional | 95.84 | |
| COG0509 | 131 | GcvH Glycine cleavage system H protein (lipoate-bi | 95.71 | |
| PRK09859 | 385 | multidrug efflux system protein MdtE; Provisional | 95.66 | |
| PF12700 | 328 | HlyD_2: HlyD family secretion protein; PDB: 3LNN_B | 95.51 | |
| PRK12784 | 84 | hypothetical protein; Provisional | 95.51 | |
| PF01597 | 122 | GCV_H: Glycine cleavage H-protein; InterPro: IPR00 | 95.45 | |
| PRK15030 | 397 | multidrug efflux system transporter AcrA; Provisio | 95.43 | |
| PF00302 | 206 | CAT: Chloramphenicol acetyltransferase; InterPro: | 95.35 | |
| PRK13757 | 219 | chloramphenicol acetyltransferase; Provisional | 95.28 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 95.26 | |
| PRK11556 | 415 | multidrug efflux system subunit MdtA; Provisional | 95.13 | |
| PRK11578 | 370 | macrolide transporter subunit MacA; Provisional | 95.11 | |
| COG0509 | 131 | GcvH Glycine cleavage system H protein (lipoate-bi | 94.9 | |
| TIGR03309 | 256 | matur_yqeB selenium-dependent molybdenum hydroxyla | 94.51 | |
| PF01398 | 114 | JAB: JAB1/Mov34/MPN/PAD-1 ubiquitin protease; Inte | 94.32 | |
| cd08057 | 157 | MPN_euk_non_mb Mpr1p, Pad1p N-terminal (MPN) domai | 94.07 | |
| TIGR03309 | 256 | matur_yqeB selenium-dependent molybdenum hydroxyla | 94.01 | |
| TIGR00999 | 265 | 8a0102 Membrane Fusion Protein cluster 2 (function | 93.21 | |
| PF13375 | 101 | RnfC_N: RnfC Barrel sandwich hybrid domain | 92.71 | |
| cd08067 | 187 | MPN_2A_DUB Mov34/MPN/PAD-1 family: Histone H2A deu | 92.49 | |
| cd06250 | 359 | M14_PaAOTO_like An uncharacterized subgroup of the | 92.3 | |
| cd06251 | 287 | M14_ASTE_ASPA_like_1 A functionally uncharacterize | 92.2 | |
| PF13375 | 101 | RnfC_N: RnfC Barrel sandwich hybrid domain | 92.17 | |
| cd06253 | 298 | M14_ASTE_ASPA_like_3 A functionally uncharacterize | 91.82 | |
| cd07767 | 116 | MPN Mpr1p, Pad1p N-terminal (MPN) domains. MPN (al | 91.02 | |
| smart00232 | 135 | JAB_MPN JAB/MPN domain. Domain in Jun kinase activ | 90.4 | |
| PLN03246 | 303 | 26S proteasome regulatory subunit; Provisional | 90.16 | |
| TIGR02994 | 325 | ectoine_eutE ectoine utilization protein EutE. Mem | 89.61 | |
| cd08062 | 280 | MPN_RPN7_8 Mpr1p, Pad1p N-terminal (MPN) domains w | 89.56 | |
| COG3608 | 331 | Predicted deacylase [General function prediction o | 89.46 | |
| cd06253 | 298 | M14_ASTE_ASPA_like_3 A functionally uncharacterize | 89.46 | |
| PF13437 | 105 | HlyD_3: HlyD family secretion protein | 89.09 | |
| cd06252 | 316 | M14_ASTE_ASPA_like_2 A functionally uncharacterize | 88.85 | |
| cd08058 | 119 | MPN_euk_mb Mpr1p, Pad1p N-terminal (MPN) domains w | 88.67 | |
| cd06251 | 287 | M14_ASTE_ASPA_like_1 A functionally uncharacterize | 88.66 | |
| PF05896 | 257 | NQRA: Na(+)-translocating NADH-quinone reductase s | 88.48 | |
| PF00529 | 305 | HlyD: HlyD family secretion protein the correspond | 87.51 | |
| cd06250 | 359 | M14_PaAOTO_like An uncharacterized subgroup of the | 87.3 | |
| PF13437 | 105 | HlyD_3: HlyD family secretion protein | 87.12 | |
| COG3608 | 331 | Predicted deacylase [General function prediction o | 86.75 | |
| TIGR02994 | 325 | ectoine_eutE ectoine utilization protein EutE. Mem | 85.85 | |
| PF00529 | 305 | HlyD: HlyD family secretion protein the correspond | 85.46 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 85.45 | |
| cd08063 | 288 | MPN_CSN6 Mpr1p, Pad1p N-terminal (MPN) domains wit | 85.2 | |
| cd06252 | 316 | M14_ASTE_ASPA_like_2 A functionally uncharacterize | 85.08 | |
| PF12700 | 328 | HlyD_2: HlyD family secretion protein; PDB: 3LNN_B | 85.06 | |
| cd06254 | 288 | M14_ASTE_ASPA_like_4 A functionally uncharacterize | 84.93 | |
| PF09891 | 150 | DUF2118: Uncharacterized protein conserved in arch | 84.17 | |
| PF09891 | 150 | DUF2118: Uncharacterized protein conserved in arch | 83.68 | |
| cd08066 | 173 | MPN_AMSH_like Mov34/MPN/PAD-1 family. AMSH (associ | 83.24 | |
| KOG3373|consensus | 172 | 82.63 | ||
| COG1726 | 447 | NqrA Na+-transporting NADH:ubiquinone oxidoreducta | 82.21 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 81.17 | |
| TIGR01936 | 447 | nqrA NADH:ubiquinone oxidoreductase, Na(+)-translo | 80.58 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 80.43 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 80.18 |
| >TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.3e-94 Score=867.82 Aligned_cols=539 Identities=24% Similarity=0.375 Sum_probs=413.4
Q ss_pred EEEEccCCCCCCceEEEEEEeccCCCCCeecCCCeEEEEEcCCceeEEeCCCCeEEEEEeeCCCCeecCCCeEEEEEecC
Q psy6394 188 IQFKLADIGEGIREVNIKEWNGNVTEGARINEFDVVCEVESDKASVTITSRYKGTVRKVYYGEGDVALVGKPLLDIEVED 267 (1045)
Q Consensus 188 ~~~~~P~lg~~~~eg~i~~w~~~v~~Gd~V~~gd~l~~vetdKa~~~i~s~~~G~v~~i~~~~g~~v~vG~~l~~i~~~~ 267 (1045)
++|+||+||++|.||+|++|+ |++||.|++||+||+|||||++++|+||.+|+|.++++++|+.|++|++|+.|+..+
T Consensus 3 ~~i~~P~lg~~~~eg~i~~w~--v~~Gd~V~~g~~l~~vEtdKa~~ev~a~~~G~v~~i~v~~Gd~v~vG~~ia~i~~~~ 80 (590)
T TIGR02927 3 FSVEMPALGESVTEGTITQWL--KAEGDTVELDEPLLEVSTDKVDTEIPSPAAGVILEIKAEEDDTVDIGGEIAIIGEAG 80 (590)
T ss_pred eeEECCCCCCCccEEEEEEEE--ECCCCEEeCCCeEEEEEecceEEEecCCCCEEEEEEeecCCCEEeeeeeEEEEeecc
Confidence 579999999999999999999 999999999999999999999999999999999999999999999999999997543
Q ss_pred ccccccccccccccCCCCCCCCCCCCCCCCCCccccCCCCCCCCCCCCCCCCCCCCCCccccccccCccccccccccccc
Q psy6394 268 EGVAAEEADSLDRKAAPGVSEVNTPDTSDQPNETLHKEPNKVNREPIAHKPDVTPDLSRDSAVSHLNQPVNLNKNKWKIL 347 (1045)
Q Consensus 268 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 347 (1045)
+......... .++. +++...++.. ..+. . .++..+. .. .
T Consensus 81 ~~~~~~~~~~----~~~~------~~~~~~~~~~----~~~~----~-~~~~~~~-----~~-----~------------ 119 (590)
T TIGR02927 81 EASAEAGAED----SAAA------AEPEEAPAEE----APKE----E-PKAAPAE-----SV-----E------------ 119 (590)
T ss_pred cccccccccc----cccc------cccccccccc----cccc----c-ccccccc-----cc-----c------------
Confidence 3211000000 0000 0000000000 0000 0 0000000 00 0
Q ss_pred cChHHHHHHHHcCCCcccccccCCCcceehhhHHhhhcCCCccccccccccccccceeEEecceeeecccccccccCCCC
Q psy6394 348 ATPSVRRMIKHYEIDTKELRGTGKQGRVLKEDIITYMNSPIDETNLAHTAHVREASNVISIRGYVKGMFKSMTEAHGHHL 427 (1045)
Q Consensus 348 atP~vRrlA~e~gidls~v~gTG~~Gri~k~DVl~~~~~~~~~~~~~~~~~~~~~~~~~~l~g~r~~m~k~Mt~S~~~~~ 427 (1045)
.+|
T Consensus 120 ~a~----------------------------------------------------------------------------- 122 (590)
T TIGR02927 120 QAP----------------------------------------------------------------------------- 122 (590)
T ss_pred ccc-----------------------------------------------------------------------------
Confidence 000
Q ss_pred CCCCcccccccccc--cccceeEEEEecCCCCCcceeEEEEeeeccCCCCeeccCCeEeEEeccceeeEEecCCCEEEEE
Q psy6394 428 STPPLQCHHHLHTS--CIRHKLIQFNLADIGEGIREVNIKEWNGNVTEGARINEFDVVCEVESDKASVTITSRYKGTVRK 505 (1045)
Q Consensus 428 s~~~~~~~~~~~~s--~~~~~~~~i~~P~lge~~~eg~i~~w~~~v~~Gd~V~~gd~l~~vetdKa~~ei~ap~~G~v~~ 505 (1045)
.++.. ....+.++|+||+||++|+||+|.+|+ |++||.|++||+||+|||||+++||+||++|+|.+
T Consensus 123 ---------~~~~~~~~~~~~~~~~~~P~lg~~~~eg~i~~w~--v~~Gd~V~~g~~l~~vEtdKa~~ev~s~~~G~v~~ 191 (590)
T TIGR02927 123 ---------AESSAPSQGGGAATDIEMPELGESVTEGTITQWL--KAVGDKIEVDEPILEVSTDKVDTEIPSPVAGTILE 191 (590)
T ss_pred ---------cccccccccCCCceEEEcCCCCCCcceEEEEEEE--eCCCCEecCCCEeEEEEecceeeEEcCCCCeEEEE
Confidence 00000 001224789999999999999999999 99999999999999999999999999999999999
Q ss_pred EeeCCCCEEecCCceEEEeecCccccc------cc-c------ccccc--c-----CCC--------CCC----CC----
Q psy6394 506 VYYGEGDVALVGKPLLDIEVEDEGVAA------EE-A------DSLDR--K-----AAP--------GVS----EV---- 549 (1045)
Q Consensus 506 i~~~~G~~v~vg~~l~~i~~~~~~~~~------~~-~------~~~~~--~-----~~~--------~~~----~~---- 549 (1045)
|++++|+.|++|++|++|+.+++..+. .. . .+.+. . ..+ ... ..
T Consensus 192 i~v~~G~~v~vG~~l~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 271 (590)
T TIGR02927 192 ILAEEDDTVDVGAEIAKIGDAGAAAAEDAKAEEEAEAKAEAKPEEKPDPKKDEAAEPEPDEPEAEKAEKKEEKAAAAPAA 271 (590)
T ss_pred EecCCCCEecCCCEEEEEecCCCccccccccccccccccccccCCCCccccccccccccccccccccccccccccccccc
Confidence 999999999999999999754322100 00 0 00000 0 000 000 00
Q ss_pred -CCCCCCCCccccccCCCCCCCcCccccCCCCCccchHhHHhhhCCCCCCCCCCccccccccccceeecccccccccccc
Q psy6394 550 -NTPDTSDQPNETLHKDPNKIDTKELRGTGKQGRVLKEDIITYMNSPSDETNPAHTAHVREASNVISIRGYVKGMFKSMT 628 (1045)
Q Consensus 550 -~~~~~~asP~vr~la~e~gidls~v~gTG~~GrI~k~DV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 628 (1045)
....+++||++||||+|+||||+.|+|||++|||+|+||++|+.........+.++++..+
T Consensus 272 ~~~~~~~asP~aR~lA~e~gvdl~~v~GtG~~GrI~k~DV~~~~~~~~~~~~~~~~~~~~~~------------------ 333 (590)
T TIGR02927 272 NSDGSPYVTPLVRKLAAEHGIDLNSVKGTGIGGRIRKQDVLAAAEGAKAAAEAPAAEAAAAA------------------ 333 (590)
T ss_pred cccCcccCCchhHHHHHHcCCCHHHCCCCCCCCeEeHHHHHHHHhccccccccccccccccC------------------
Confidence 1124678999999999999999999999999999999999997532111000000000000
Q ss_pred ccccCCCccccccccccccccccchhhhcccCCCCCCCCCCcccccCCcceeeecCchhhHHHHHhhhc-CCCCeeEEee
Q psy6394 629 EANTIPSLRLTEEVDTTQLRDVKKEDIITYMNSPSDETNPAHTAHVREASNVIPIRGYVKGMFKSMTEA-NTIPSLRLTE 707 (1045)
Q Consensus 629 ~~~~~p~~~l~~~~d~~~~~~v~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~pls~~rk~ia~~m~~S-~~iP~~~~~~ 707 (1045)
+ .....+. ..+... ......+.+||++|||.||++|++| +++||+|++.
T Consensus 334 -----~----------------------~~~~~~~--~~~~~~-~~~~~~~~~pls~~rk~ia~~m~~S~~~iPh~~~~~ 383 (590)
T TIGR02927 334 -----P----------------------AAAAAAS--ASPAPA-KAHLRGTTQKANRIREITAKKTREALQASAQLTQLH 383 (590)
T ss_pred -----c----------------------ccccccc--CCCccc-cccccCceeeccHHHHHHHHHHHHHhccCCeEEEEe
Confidence 0 0000000 000000 0001245689999999999999999 7899999999
Q ss_pred cccchHHHHHHHHHHHHHHhccCcccChHHHHHHHHHHHHHhCCccceEEcCCCceEEEcCCccEEEEEecCCCeeeeee
Q psy6394 708 EVDTTQLRDVKNQVSALYQEKFRLKLTYMPFFIKALSLCMTEHPILNASIDPTQENILVNPDHNISIAIDTKHGLVVPNI 787 (1045)
Q Consensus 708 evD~t~l~~~r~~~~~~~~~~~~~klT~~~~likAva~aL~~~P~lNa~~~~~~~~i~~~~~vnIgiAV~t~~GL~vPvI 787 (1045)
++|+++|+++|+++++.+.+..+.|+|+++||+||+++||++||.||++|+++++.|++++++||||||++++||+||||
T Consensus 384 evdvt~l~~~R~~l~~~~~~~~~~kls~~~~iiKA~a~AL~~~P~~Na~~~~~~~~i~~~~~vnigvAv~t~~GL~vPvI 463 (590)
T TIGR02927 384 EVDMTKIAALRARAKAAFAEKEGVNLTFLPFFAKAVIDALKAHPNVNASYNADTKEITYHAAEHLGFAVDTDAGLLSPVI 463 (590)
T ss_pred EEEcHHHHHHHHHHHhhhHHhcCCcccHHHHHHHHHHHHHHhCCHhheEEecCCCEEEEeCCccEEEEEECCCCcEeccc
Confidence 99999999999999976555423899999999999999999999999999876778999999999999999999999999
Q ss_pred cccccccHHHHHHHHHHHHhccccCCCCCCccCCCceEeeccCCccceeecccccccceeeEeeccceeEeEec--cCC-
Q psy6394 788 KSVNKLCLLDITRELLRIQGCSHEGKVLPRDIQGGTISMSNVGNVGGTLVQPIIVPGQVCIVAFGKIQLLPRFD--AEM- 864 (1045)
Q Consensus 788 r~ad~~sl~ei~~~l~~l~~~ar~~kl~~~d~~ggTftISNlG~~G~~~~tpii~~pq~ailavG~i~~~p~~~--~~g- 864 (1045)
||+|+++|.+|++++++|++++|+|||+++||+||||||||+|+||+++|+|||||||+||||+|+++++|+|+ .+|
T Consensus 464 k~a~~~sl~~ia~~i~~l~~kAr~gkL~p~e~~GgTfTISNlG~~G~~~~tpIIn~PqvaILgvG~i~~~pv~~~~~~g~ 543 (590)
T TIGR02927 464 HNAGDLSLGEIAKAIADIAARARNGKLKPDDLAGGTFTITNIGSEGALFDTPILIPPQAAILGTGAIVKRPRVITDEDGI 543 (590)
T ss_pred CCcccCCHHHHHHHHHHHHHHHHcCCCChHHhCCCeEEEECCCCCCccceeceecCCCeEEEEcccceEEEEEeccCCCc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999984 344
Q ss_pred -ceeEEEeeeEEEeccceeecchhhhhhhhhhhhcccccccCCcc
Q psy6394 865 -RIVAKCILNVTWAADHRVVDGATVARAATLWKSLENILVNPDHN 908 (1045)
Q Consensus 865 -~i~~~~~m~lslt~DhRviDGa~aa~fl~~~~~~~~ile~p~v~ 908 (1045)
.+++|++|++||+||||||||+++|+||+.|+++ ||+|.++
T Consensus 544 ~~~~~~~~m~lsls~DHRviDGa~aa~Fl~~lk~~---LE~~~~~ 585 (590)
T TIGR02927 544 DSIAIRQMCHLPLTYDHQLIDGADAGRFLTTIKDR---LEEAAFE 585 (590)
T ss_pred ccEEEEeeEEEeeeccchhcCcHHHHHHHHHHHHH---HhCcccc
Confidence 4999999999999999999999999999999999 9997654
|
This model represents an Actinobacterial clade of E2 enzyme, a component of the 2-oxoglutarate dehydrogenase complex involved in the TCA cycle. These proteins have multiple domains including the catalytic domain (pfam00198), one or two biotin domains (pfam00364) and an E3-component binding domain (pfam02817). |
| >TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >PRK11855 dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK05704 dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR01347 sucB 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >PLN02744 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex | Back alignment and domain information |
|---|
| >PLN02528 2-oxoisovalerate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >KOG0558|consensus | Back alignment and domain information |
|---|
| >COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >KOG0557|consensus | Back alignment and domain information |
|---|
| >PLN02226 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >PTZ00144 dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14843 dihydrolipoamide acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed | Back alignment and domain information |
|---|
| >KOG0559|consensus | Back alignment and domain information |
|---|
| >PRK11857 dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >KOG0557|consensus | Back alignment and domain information |
|---|
| >PLN02226 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >PTZ00144 dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF00198 2-oxoacid_dh: 2-oxoacid dehydrogenases acyltransferase (catalytic domain); InterPro: IPR001078 This domain is found in the lipoamide acyltransferase component of the branched-chain alpha-keto acid dehydrogenase complex 2 | Back alignment and domain information |
|---|
| >TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >PRK14843 dihydrolipoamide acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >PRK11855 dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK11857 dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF00198 2-oxoacid_dh: 2-oxoacid dehydrogenases acyltransferase (catalytic domain); InterPro: IPR001078 This domain is found in the lipoamide acyltransferase component of the branched-chain alpha-keto acid dehydrogenase complex 2 | Back alignment and domain information |
|---|
| >PRK05704 dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR01347 sucB 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >PLN02528 2-oxoisovalerate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >PLN02744 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex | Back alignment and domain information |
|---|
| >KOG0559|consensus | Back alignment and domain information |
|---|
| >TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0558|consensus | Back alignment and domain information |
|---|
| >PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed | Back alignment and domain information |
|---|
| >PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06748 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK11892 pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK06748 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional | Back alignment and domain information |
|---|
| >cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
| >PRK11892 pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional | Back alignment and domain information |
|---|
| >COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
| >PF02817 E3_binding: e3 binding domain; InterPro: IPR004167 A small domain of the E2 subunit of 2-oxo-acid dehydrogenases that is responsible for the binding of the E3 subunit | Back alignment and domain information |
|---|
| >PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK07051 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
| >PRK07051 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein | Back alignment and domain information |
|---|
| >cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK14042 pyruvate carboxylase subunit B; Provisional | Back alignment and domain information |
|---|
| >PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
| >PF02817 E3_binding: e3 binding domain; InterPro: IPR004167 A small domain of the E2 subunit of 2-oxo-acid dehydrogenases that is responsible for the binding of the E3 subunit | Back alignment and domain information |
|---|
| >cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases | Back alignment and domain information |
|---|
| >TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein | Back alignment and domain information |
|---|
| >cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases | Back alignment and domain information |
|---|
| >PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >TIGR02712 urea_carbox urea carboxylase | Back alignment and domain information |
|---|
| >PRK14042 pyruvate carboxylase subunit B; Provisional | Back alignment and domain information |
|---|
| >PF00302 CAT: Chloramphenicol acetyltransferase; InterPro: IPR001707 Chloramphenicol acetyltransferase (CAT) (2 | Back alignment and domain information |
|---|
| >TIGR01108 oadA oxaloacetate decarboxylase alpha subunit | Back alignment and domain information |
|---|
| >TIGR01235 pyruv_carbox pyruvate carboxylase | Back alignment and domain information |
|---|
| >PRK14040 oxaloacetate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK13757 chloramphenicol acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02712 urea_carbox urea carboxylase | Back alignment and domain information |
|---|
| >TIGR01108 oadA oxaloacetate decarboxylase alpha subunit | Back alignment and domain information |
|---|
| >PRK14040 oxaloacetate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK09282 pyruvate carboxylase subunit B; Validated | Back alignment and domain information |
|---|
| >TIGR01235 pyruv_carbox pyruvate carboxylase | Back alignment and domain information |
|---|
| >PRK12999 pyruvate carboxylase; Reviewed | Back alignment and domain information |
|---|
| >COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >COG1038 PycA Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK09282 pyruvate carboxylase subunit B; Validated | Back alignment and domain information |
|---|
| >PRK12999 pyruvate carboxylase; Reviewed | Back alignment and domain information |
|---|
| >COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >KOG0369|consensus | Back alignment and domain information |
|---|
| >COG1038 PycA Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd06848 GCS_H Glycine cleavage H-protein | Back alignment and domain information |
|---|
| >cd06848 GCS_H Glycine cleavage H-protein | Back alignment and domain information |
|---|
| >COG4845 Chloramphenicol O-acetyltransferase [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR03077 not_gcvH glycine cleavage protein H-like protein, Chlamydial | Back alignment and domain information |
|---|
| >KOG0369|consensus | Back alignment and domain information |
|---|
| >PRK01202 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >KOG0238|consensus | Back alignment and domain information |
|---|
| >PRK00624 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >TIGR03077 not_gcvH glycine cleavage protein H-like protein, Chlamydial | Back alignment and domain information |
|---|
| >PRK13380 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >KOG0368|consensus | Back alignment and domain information |
|---|
| >PRK00624 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >KOG0238|consensus | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional | Back alignment and domain information |
|---|
| >PRK13380 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >KOG0368|consensus | Back alignment and domain information |
|---|
| >TIGR01730 RND_mfp RND family efflux transporter, MFP subunit | Back alignment and domain information |
|---|
| >PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional | Back alignment and domain information |
|---|
| >PF13533 Biotin_lipoyl_2: Biotin-lipoyl like | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >TIGR00527 gcvH glycine cleavage system H protein | Back alignment and domain information |
|---|
| >PRK01202 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional | Back alignment and domain information |
|---|
| >PRK15136 multidrug efflux system protein EmrA; Provisional | Back alignment and domain information |
|---|
| >PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed | Back alignment and domain information |
|---|
| >TIGR01730 RND_mfp RND family efflux transporter, MFP subunit | Back alignment and domain information |
|---|
| >PF13533 Biotin_lipoyl_2: Biotin-lipoyl like | Back alignment and domain information |
|---|
| >PRK03598 putative efflux pump membrane fusion protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00527 gcvH glycine cleavage system H protein | Back alignment and domain information |
|---|
| >PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional | Back alignment and domain information |
|---|
| >PRK09859 multidrug efflux system protein MdtE; Provisional | Back alignment and domain information |
|---|
| >PF01597 GCV_H: Glycine cleavage H-protein; InterPro: IPR002930 This is a family of glycine cleavage H-proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >PRK15030 multidrug efflux system transporter AcrA; Provisional | Back alignment and domain information |
|---|
| >PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed | Back alignment and domain information |
|---|
| >PRK15136 multidrug efflux system protein EmrA; Provisional | Back alignment and domain information |
|---|
| >PRK11578 macrolide transporter subunit MacA; Provisional | Back alignment and domain information |
|---|
| >PRK12784 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK03598 putative efflux pump membrane fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK11556 multidrug efflux system subunit MdtA; Provisional | Back alignment and domain information |
|---|
| >COG0509 GcvH Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09859 multidrug efflux system protein MdtE; Provisional | Back alignment and domain information |
|---|
| >PF12700 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 4DK0_A 4DK1_C 3FPP_B 2K32_A 2K33_A 3OW7_B 3OOC_A 3T53_B 4DNT_C | Back alignment and domain information |
|---|
| >PRK12784 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF01597 GCV_H: Glycine cleavage H-protein; InterPro: IPR002930 This is a family of glycine cleavage H-proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes | Back alignment and domain information |
|---|
| >PRK15030 multidrug efflux system transporter AcrA; Provisional | Back alignment and domain information |
|---|
| >PF00302 CAT: Chloramphenicol acetyltransferase; InterPro: IPR001707 Chloramphenicol acetyltransferase (CAT) (2 | Back alignment and domain information |
|---|
| >PRK13757 chloramphenicol acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >PRK11556 multidrug efflux system subunit MdtA; Provisional | Back alignment and domain information |
|---|
| >PRK11578 macrolide transporter subunit MacA; Provisional | Back alignment and domain information |
|---|
| >COG0509 GcvH Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03309 matur_yqeB selenium-dependent molybdenum hydroxylase system protein, YqeB family | Back alignment and domain information |
|---|
| >PF01398 JAB: JAB1/Mov34/MPN/PAD-1 ubiquitin protease; InterPro: IPR000555 Members of this family are found in proteasome regulatory subunits, eukaryotic initiation factor 3 (eIF3) subunits and regulators of transcription factors | Back alignment and domain information |
|---|
| >cd08057 MPN_euk_non_mb Mpr1p, Pad1p N-terminal (MPN) domains without catalytic isopeptidase activity (non metal-binding); eukaryotic | Back alignment and domain information |
|---|
| >TIGR03309 matur_yqeB selenium-dependent molybdenum hydroxylase system protein, YqeB family | Back alignment and domain information |
|---|
| >TIGR00999 8a0102 Membrane Fusion Protein cluster 2 (function with RND porters) | Back alignment and domain information |
|---|
| >PF13375 RnfC_N: RnfC Barrel sandwich hybrid domain | Back alignment and domain information |
|---|
| >cd08067 MPN_2A_DUB Mov34/MPN/PAD-1 family: Histone H2A deubiquitinase | Back alignment and domain information |
|---|
| >cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PF13375 RnfC_N: RnfC Barrel sandwich hybrid domain | Back alignment and domain information |
|---|
| >cd06253 M14_ASTE_ASPA_like_3 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd07767 MPN Mpr1p, Pad1p N-terminal (MPN) domains | Back alignment and domain information |
|---|
| >smart00232 JAB_MPN JAB/MPN domain | Back alignment and domain information |
|---|
| >PLN03246 26S proteasome regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02994 ectoine_eutE ectoine utilization protein EutE | Back alignment and domain information |
|---|
| >cd08062 MPN_RPN7_8 Mpr1p, Pad1p N-terminal (MPN) domains without catalytic isopeptidase activity, found in 19S proteasomal subunits Rpn7 and Rpn8 | Back alignment and domain information |
|---|
| >COG3608 Predicted deacylase [General function prediction only] | Back alignment and domain information |
|---|
| >cd06253 M14_ASTE_ASPA_like_3 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PF13437 HlyD_3: HlyD family secretion protein | Back alignment and domain information |
|---|
| >cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd08058 MPN_euk_mb Mpr1p, Pad1p N-terminal (MPN) domains with catalytic isopeptidase activity (metal-binding); eukaryotic | Back alignment and domain information |
|---|
| >cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PF05896 NQRA: Na(+)-translocating NADH-quinone reductase subunit A (NQRA); InterPro: IPR008703 This family consists of several bacterial Na+-translocating NADH-quinone reductase subunit A (NQRA) proteins | Back alignment and domain information |
|---|
| >PF00529 HlyD: HlyD family secretion protein the corresponding Prosite entry | Back alignment and domain information |
|---|
| >cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PF13437 HlyD_3: HlyD family secretion protein | Back alignment and domain information |
|---|
| >COG3608 Predicted deacylase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02994 ectoine_eutE ectoine utilization protein EutE | Back alignment and domain information |
|---|
| >PF00529 HlyD: HlyD family secretion protein the corresponding Prosite entry | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >cd08063 MPN_CSN6 Mpr1p, Pad1p N-terminal (MPN) domains without catalytic isopeptidase activity, found in COP9 signalosome complex subunit 6 | Back alignment and domain information |
|---|
| >cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PF12700 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 4DK0_A 4DK1_C 3FPP_B 2K32_A 2K33_A 3OW7_B 3OOC_A 3T53_B 4DNT_C | Back alignment and domain information |
|---|
| >cd06254 M14_ASTE_ASPA_like_4 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PF09891 DUF2118: Uncharacterized protein conserved in archaea (DUF2118); InterPro: IPR019217 This entry represents a family of hypothetical proteins of unknown function | Back alignment and domain information |
|---|
| >PF09891 DUF2118: Uncharacterized protein conserved in archaea (DUF2118); InterPro: IPR019217 This entry represents a family of hypothetical proteins of unknown function | Back alignment and domain information |
|---|
| >cd08066 MPN_AMSH_like Mov34/MPN/PAD-1 family | Back alignment and domain information |
|---|
| >KOG3373|consensus | Back alignment and domain information |
|---|
| >COG1726 NqrA Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrA [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 1045 | ||||
| 2ihw_A | 262 | Crystal Structure Of A Cubic Core Of The Dihydrolip | 2e-51 | ||
| 2ihw_A | 262 | Crystal Structure Of A Cubic Core Of The Dihydrolip | 2e-37 | ||
| 1b5s_A | 242 | Dihydrolipoyl Transacetylase (E.C.2.3.1.12) Catalyt | 2e-28 | ||
| 1b5s_A | 242 | Dihydrolipoyl Transacetylase (E.C.2.3.1.12) Catalyt | 3e-17 | ||
| 3duf_I | 428 | Snapshots Of Catalysis In The E1 Subunit Of The Pyr | 3e-28 | ||
| 3duf_I | 428 | Snapshots Of Catalysis In The E1 Subunit Of The Pyr | 2e-17 | ||
| 1k8o_A | 93 | Solution Structure Of The Lipoic Acid-Bearing Domai | 2e-23 | ||
| 1k8o_A | 93 | Solution Structure Of The Lipoic Acid-Bearing Domai | 6e-23 | ||
| 3mae_A | 256 | Crystal Structure Of Probable Dihydrolipamide Acety | 1e-19 | ||
| 3mae_A | 256 | Crystal Structure Of Probable Dihydrolipamide Acety | 2e-09 | ||
| 1c4t_A | 233 | Catalytic Domain From Trimeric Dihydrolipoamide Suc | 7e-19 | ||
| 1c4t_A | 233 | Catalytic Domain From Trimeric Dihydrolipoamide Suc | 3e-11 | ||
| 1dpc_A | 243 | Crystallographic And Enzymatic Investigations On Th | 2e-17 | ||
| 1dpc_A | 243 | Crystallographic And Enzymatic Investigations On Th | 6e-10 | ||
| 3rqc_A | 224 | Crystal Structure Of The Catalytic Core Of The 2-Ox | 6e-17 | ||
| 3rqc_A | 224 | Crystal Structure Of The Catalytic Core Of The 2-Ox | 4e-11 | ||
| 1dpd_A | 243 | Crystallographic And Enzymatic Investigations On Th | 2e-16 | ||
| 1dpd_A | 243 | Crystallographic And Enzymatic Investigations On Th | 6e-09 | ||
| 1eaa_A | 243 | Atomic Structure Of The Cubic Core Of The Pyruvate | 3e-16 | ||
| 1eaa_A | 243 | Atomic Structure Of The Cubic Core Of The Pyruvate | 3e-09 | ||
| 1dpb_A | 243 | Crystallographic And Enzymatic Investigations On Th | 2e-15 | ||
| 1dpb_A | 243 | Crystallographic And Enzymatic Investigations On Th | 5e-08 | ||
| 3b8k_A | 239 | Structure Of The Truncated Human Dihydrolipoyl Acet | 2e-15 | ||
| 3b8k_A | 239 | Structure Of The Truncated Human Dihydrolipoyl Acet | 3e-13 | ||
| 1lab_A | 80 | Three-Dimensional Structure Of The Lipoyl Domain Fr | 1e-10 | ||
| 1lab_A | 80 | Three-Dimensional Structure Of The Lipoyl Domain Fr | 5e-10 | ||
| 3l60_A | 250 | Crystal Structure Of Branched-Chain Alpha-Keto Acid | 1e-08 | ||
| 3l60_A | 250 | Crystal Structure Of Branched-Chain Alpha-Keto Acid | 2e-08 | ||
| 2l5t_A | 77 | Solution Nmr Structure Of E2 Lipoyl Domain From The | 1e-07 | ||
| 2l5t_A | 77 | Solution Nmr Structure Of E2 Lipoyl Domain From The | 4e-07 | ||
| 2xt6_A | 1113 | Crystal Structure Of Mycobacterium Smegmatis Alpha- | 2e-05 | ||
| 2xt6_A | 1113 | Crystal Structure Of Mycobacterium Smegmatis Alpha- | 5e-04 | ||
| 2coo_A | 70 | Solution Structure Of The E3_binding Domain Of Dihy | 4e-05 | ||
| 1zwv_A | 58 | Solution Structure Of The Subunit Binding Domain (H | 5e-05 | ||
| 1w85_I | 49 | The Crystal Structure Of Pyruvate Dehydrogenase E1 | 2e-04 | ||
| 1w3d_A | 55 | Nmr Structure Of The Peripheral-Subunit Binding Dom | 2e-04 | ||
| 1w4g_A | 47 | Peripheral-Subunit Binding Domains From Mesophilic, | 2e-04 | ||
| 1w4f_A | 47 | Peripheral-Subunit Binding Domains From Mesophilic, | 3e-04 | ||
| 3rnm_E | 58 | The Crystal Structure Of The Subunit Binding Of Hum | 3e-04 | ||
| 2pdd_A | 43 | The High Resolution Structure Of The Peripheral Sub | 4e-04 | ||
| 2pde_A | 43 | The High Resolution Structure Of The Peripheral Sub | 8e-04 | ||
| 1ebd_C | 41 | Dihydrolipoamide Dehydrogenase Complexed With The B | 8e-04 |
| >pdb|2IHW|A Chain A, Crystal Structure Of A Cubic Core Of The Dihydrolipoamide Acyltransferase (E2b) Component In The Branched-Chain Alpha-Ketoacid Dehydrogenase Complex (Bckdc), Apo Form Length = 262 | Back alignment and structure |
|
| >pdb|2IHW|A Chain A, Crystal Structure Of A Cubic Core Of The Dihydrolipoamide Acyltransferase (E2b) Component In The Branched-Chain Alpha-Ketoacid Dehydrogenase Complex (Bckdc), Apo Form Length = 262 | Back alignment and structure |
| >pdb|1B5S|A Chain A, Dihydrolipoyl Transacetylase (E.C.2.3.1.12) Catalytic Domain (Residues 184-425) From Bacillus Stearothermophilus Length = 242 | Back alignment and structure |
| >pdb|1B5S|A Chain A, Dihydrolipoyl Transacetylase (E.C.2.3.1.12) Catalytic Domain (Residues 184-425) From Bacillus Stearothermophilus Length = 242 | Back alignment and structure |
| >pdb|3DUF|I Chain I, Snapshots Of Catalysis In The E1 Subunit Of The Pyruvate Dehydrogenase Multi-Enzyme Complex Length = 428 | Back alignment and structure |
| >pdb|3DUF|I Chain I, Snapshots Of Catalysis In The E1 Subunit Of The Pyruvate Dehydrogenase Multi-Enzyme Complex Length = 428 | Back alignment and structure |
| >pdb|1K8O|A Chain A, Solution Structure Of The Lipoic Acid-Bearing Domain Of The E2 Component Of Human, Mitochondrial Branched-Chain Alpha- Ketoacid Dehydrogenase Length = 93 | Back alignment and structure |
| >pdb|1K8O|A Chain A, Solution Structure Of The Lipoic Acid-Bearing Domain Of The E2 Component Of Human, Mitochondrial Branched-Chain Alpha- Ketoacid Dehydrogenase Length = 93 | Back alignment and structure |
| >pdb|3MAE|A Chain A, Crystal Structure Of Probable Dihydrolipamide Acetyltransferase From Listeria Monocytogenes 4b F2365 Length = 256 | Back alignment and structure |
| >pdb|3MAE|A Chain A, Crystal Structure Of Probable Dihydrolipamide Acetyltransferase From Listeria Monocytogenes 4b F2365 Length = 256 | Back alignment and structure |
| >pdb|1C4T|A Chain A, Catalytic Domain From Trimeric Dihydrolipoamide Succinyltransferase Length = 233 | Back alignment and structure |
| >pdb|1C4T|A Chain A, Catalytic Domain From Trimeric Dihydrolipoamide Succinyltransferase Length = 233 | Back alignment and structure |
| >pdb|1DPC|A Chain A, Crystallographic And Enzymatic Investigations On The Role Of Ser558, His610 And Asn614 In The Catalytic Mechanism Of Azotobacter Vinelandii Dihydrolipoamide Acetyltransferase (E2p) Length = 243 | Back alignment and structure |
| >pdb|1DPC|A Chain A, Crystallographic And Enzymatic Investigations On The Role Of Ser558, His610 And Asn614 In The Catalytic Mechanism Of Azotobacter Vinelandii Dihydrolipoamide Acetyltransferase (E2p) Length = 243 | Back alignment and structure |
| >pdb|3RQC|A Chain A, Crystal Structure Of The Catalytic Core Of The 2-Oxoacid Dehydrogenase Multienzyme Complex From Thermoplasma Acidophilum Length = 224 | Back alignment and structure |
| >pdb|3RQC|A Chain A, Crystal Structure Of The Catalytic Core Of The 2-Oxoacid Dehydrogenase Multienzyme Complex From Thermoplasma Acidophilum Length = 224 | Back alignment and structure |
| >pdb|1DPD|A Chain A, Crystallographic And Enzymatic Investigations On The Role Of Ser558, His610 And Asn614 In The Catalytic Mechanism Of Azotobacter Vinelandii Dihydrolipoamide Acetyltransferase (E2p) Length = 243 | Back alignment and structure |
| >pdb|1DPD|A Chain A, Crystallographic And Enzymatic Investigations On The Role Of Ser558, His610 And Asn614 In The Catalytic Mechanism Of Azotobacter Vinelandii Dihydrolipoamide Acetyltransferase (E2p) Length = 243 | Back alignment and structure |
| >pdb|1EAA|A Chain A, Atomic Structure Of The Cubic Core Of The Pyruvate Dehydrogenase Multienzyme Complex Length = 243 | Back alignment and structure |
| >pdb|1EAA|A Chain A, Atomic Structure Of The Cubic Core Of The Pyruvate Dehydrogenase Multienzyme Complex Length = 243 | Back alignment and structure |
| >pdb|1DPB|A Chain A, Crystallographic And Enzymatic Investigations On The Role Of Ser558, His610 And Asn614 In The Catalytic Mechanism Of Azotobacter Vinelandii Dihydrolipoamide Acetyltransferase (E2p) Length = 243 | Back alignment and structure |
| >pdb|1DPB|A Chain A, Crystallographic And Enzymatic Investigations On The Role Of Ser558, His610 And Asn614 In The Catalytic Mechanism Of Azotobacter Vinelandii Dihydrolipoamide Acetyltransferase (E2p) Length = 243 | Back alignment and structure |
| >pdb|3B8K|A Chain A, Structure Of The Truncated Human Dihydrolipoyl Acetyltransferase (E2) Length = 239 | Back alignment and structure |
| >pdb|3B8K|A Chain A, Structure Of The Truncated Human Dihydrolipoyl Acetyltransferase (E2) Length = 239 | Back alignment and structure |
| >pdb|1LAB|A Chain A, Three-Dimensional Structure Of The Lipoyl Domain From Bacillus Stearothermophilus Pyruvate Dehydrogenase Multienzyme Complex Length = 80 | Back alignment and structure |
| >pdb|1LAB|A Chain A, Three-Dimensional Structure Of The Lipoyl Domain From Bacillus Stearothermophilus Pyruvate Dehydrogenase Multienzyme Complex Length = 80 | Back alignment and structure |
| >pdb|3L60|A Chain A, Crystal Structure Of Branched-Chain Alpha-Keto Acid Dehydrogenase Subunit E2 From Mycobacterium Tuberculosis Length = 250 | Back alignment and structure |
| >pdb|3L60|A Chain A, Crystal Structure Of Branched-Chain Alpha-Keto Acid Dehydrogenase Subunit E2 From Mycobacterium Tuberculosis Length = 250 | Back alignment and structure |
| >pdb|2L5T|A Chain A, Solution Nmr Structure Of E2 Lipoyl Domain From Thermoplasma Acidophilum Length = 77 | Back alignment and structure |
| >pdb|2L5T|A Chain A, Solution Nmr Structure Of E2 Lipoyl Domain From Thermoplasma Acidophilum Length = 77 | Back alignment and structure |
| >pdb|2XT6|A Chain A, Crystal Structure Of Mycobacterium Smegmatis Alpha-Ketoglutarate Decarboxylase Homodimer (Orthorhombic Form) Length = 1113 | Back alignment and structure |
| >pdb|2XT6|A Chain A, Crystal Structure Of Mycobacterium Smegmatis Alpha-Ketoglutarate Decarboxylase Homodimer (Orthorhombic Form) Length = 1113 | Back alignment and structure |
| >pdb|2COO|A Chain A, Solution Structure Of The E3_binding Domain Of Dihydrolipoamide Branched Chaintransacylase Length = 70 | Back alignment and structure |
| >pdb|1ZWV|A Chain A, Solution Structure Of The Subunit Binding Domain (Hbsbd) Of The Human Mitochondrial Branched-Chain Alpha-Ketoacid Dehydrogenase Length = 58 | Back alignment and structure |
| >pdb|1W85|I Chain I, The Crystal Structure Of Pyruvate Dehydrogenase E1 Bound To The Peripheral Subunit Binding Domain Of E2 Length = 49 | Back alignment and structure |
| >pdb|3RNM|E Chain E, The Crystal Structure Of The Subunit Binding Of Human Dihydrolipoamide Transacylase (E2b) Bound To Human Dihydrolipoamide Dehydrogenase (E3) Length = 58 | Back alignment and structure |
| >pdb|2PDD|A Chain A, The High Resolution Structure Of The Peripheral Subunit- Binding Domain Of Dihydrolipoamide Acetyltransferase From The Pyruvate Dehydrogenase Multienzyme Complex Of Bacillus Stearothermophilus Length = 43 | Back alignment and structure |
| >pdb|2PDE|A Chain A, The High Resolution Structure Of The Peripheral Subunit-Binding Domain Of Dihydrolipoamide Acetyltransferase From The Pyruvate Dehydrogenase Multienzyme Complex Of Bacillus Stearothermophilus Length = 43 | Back alignment and structure |
| >pdb|1EBD|C Chain C, Dihydrolipoamide Dehydrogenase Complexed With The Binding Domain Of The Dihydrolipoamide Acetylase Length = 41 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1045 | |||
| 2ii3_A | 262 | Lipoamide acyltransferase component of branched-C | 1e-79 | |
| 2ii3_A | 262 | Lipoamide acyltransferase component of branched-C | 1e-54 | |
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 8e-77 | |
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 2e-35 | |
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 3e-29 | |
| 1dpb_A | 243 | Dihydrolipoyl-transacetylase; dihydrolipoamide ace | 6e-53 | |
| 1dpb_A | 243 | Dihydrolipoyl-transacetylase; dihydrolipoamide ace | 2e-35 | |
| 3l60_A | 250 | Branched-chain alpha-keto acid dehydrogenase; stru | 6e-50 | |
| 3l60_A | 250 | Branched-chain alpha-keto acid dehydrogenase; stru | 1e-33 | |
| 3rqc_A | 224 | Probable lipoamide acyltransferase; alpha beta fol | 1e-44 | |
| 3rqc_A | 224 | Probable lipoamide acyltransferase; alpha beta fol | 2e-30 | |
| 3b8k_A | 239 | PDCE2;, dihydrolipoyllysine-residue acetyltransfer | 2e-43 | |
| 3b8k_A | 239 | PDCE2;, dihydrolipoyllysine-residue acetyltransfer | 5e-32 | |
| 3mae_A | 256 | 2-oxoisovalerate dehydrogenase E2 component, dihyd | 4e-39 | |
| 3mae_A | 256 | 2-oxoisovalerate dehydrogenase E2 component, dihyd | 3e-23 | |
| 1k8m_A | 93 | E2 component of branched-chain ahpha-ketoacid dehy | 2e-32 | |
| 1k8m_A | 93 | E2 component of branched-chain ahpha-ketoacid dehy | 6e-32 | |
| 1scz_A | 233 | E2, dihydrolipoamide succinyltransferase; COA-depe | 6e-27 | |
| 1scz_A | 233 | E2, dihydrolipoamide succinyltransferase; COA-depe | 9e-17 | |
| 2l5t_A | 77 | Lipoamide acyltransferase; E2 lipoyl domain; NMR { | 2e-21 | |
| 2l5t_A | 77 | Lipoamide acyltransferase; E2 lipoyl domain; NMR { | 5e-21 | |
| 1zy8_K | 229 | Pyruvate dehydrogenase protein X component, mitoch | 7e-21 | |
| 1zy8_K | 229 | Pyruvate dehydrogenase protein X component, mitoch | 8e-18 | |
| 3cla_A | 213 | Type III chloramphenicol acetyltransferase; transf | 1e-18 | |
| 3cla_A | 213 | Type III chloramphenicol acetyltransferase; transf | 9e-12 | |
| 1q23_A | 219 | Chloramphenicol acetyltransferase; CAT I, trimer, | 3e-18 | |
| 1q23_A | 219 | Chloramphenicol acetyltransferase; CAT I, trimer, | 3e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-16 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-06 | |
| 3rnm_E | 58 | Lipoamide acyltransferase component of branched-C | 3e-12 | |
| 3rnm_E | 58 | Lipoamide acyltransferase component of branched-C | 9e-06 | |
| 2coo_A | 70 | Lipoamide acyltransferase component of branched- c | 3e-11 | |
| 2coo_A | 70 | Lipoamide acyltransferase component of branched- c | 1e-05 | |
| 2eq7_C | 40 | 2-oxoglutarate dehydrogenase E2 component; protein | 2e-10 | |
| 2eq7_C | 40 | 2-oxoglutarate dehydrogenase E2 component; protein | 1e-04 | |
| 2xt6_A | 1113 | 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET | 7e-10 | |
| 2xt6_A | 1113 | 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET | 5e-08 | |
| 2k7v_A | 85 | Dihydrolipoyllysine-residue acetyltransferase comp | 1e-09 | |
| 2k7v_A | 85 | Dihydrolipoyllysine-residue acetyltransferase comp | 4e-09 | |
| 1bal_A | 51 | Dihydrolipoamide succinyltransferase; glycolysis; | 3e-09 | |
| 1bal_A | 51 | Dihydrolipoamide succinyltransferase; glycolysis; | 2e-04 | |
| 1w85_I | 49 | Dihydrolipoyllysine-residue acetyltransferase comp | 3e-09 | |
| 1w4i_A | 62 | Pyruvate dehydrogenase E2; transferase, peripheral | 5e-09 | |
| 1w4i_A | 62 | Pyruvate dehydrogenase E2; transferase, peripheral | 4e-04 | |
| 1y8o_B | 128 | Dihydrolipoyllysine-residue acetyltransferase COM | 7e-09 | |
| 1y8o_B | 128 | Dihydrolipoyllysine-residue acetyltransferase COM | 7e-09 | |
| 1qjo_A | 80 | Dihydrolipoamide acetyltransferase; lipoyl domain, | 4e-08 | |
| 1qjo_A | 80 | Dihydrolipoamide acetyltransferase; lipoyl domain, | 1e-07 | |
| 2i9d_A | 217 | Chloramphenicol acetyltransferase; structural geno | 4e-08 | |
| 1gjx_A | 81 | Pyruvate dehydrogenase; oxidoreductase, lipoyl dom | 5e-08 | |
| 1gjx_A | 81 | Pyruvate dehydrogenase; oxidoreductase, lipoyl dom | 1e-07 | |
| 2dne_A | 108 | Dihydrolipoyllysine-residue acetyltransferase comp | 9e-08 | |
| 2dne_A | 108 | Dihydrolipoyllysine-residue acetyltransferase comp | 9e-08 | |
| 2eq9_C | 41 | Pyruvate dehydrogenase complex, dihydrolipoamide a | 2e-07 | |
| 2dnc_A | 98 | Pyruvate dehydrogenase protein X component; lipoic | 5e-07 | |
| 2dnc_A | 98 | Pyruvate dehydrogenase protein X component; lipoic | 5e-07 | |
| 1iyu_A | 79 | E2P, dihydrolipoamide acetyltransferase component | 7e-07 | |
| 1iyu_A | 79 | E2P, dihydrolipoamide acetyltransferase component | 9e-07 | |
| 2eq8_C | 40 | Pyruvate dehydrogenase complex, dihydrolipoamide a | 9e-07 | |
| 2kcc_A | 84 | Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, | 1e-06 | |
| 2kcc_A | 84 | Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, | 1e-06 | |
| 2dn8_A | 100 | Acetyl-COA carboxylase 2; biotin required enzyme, | 4e-06 | |
| 2dn8_A | 100 | Acetyl-COA carboxylase 2; biotin required enzyme, | 4e-06 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 6e-06 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 2e-04 | |
| 3crk_C | 87 | Dihydrolipoyllysine-residue acetyltransferase COM | 2e-05 | |
| 3crk_C | 87 | Dihydrolipoyllysine-residue acetyltransferase COM | 2e-05 | |
| 1z6h_A | 72 | Biotin/lipoyl attachment protein; solution structu | 3e-05 | |
| 1z6h_A | 72 | Biotin/lipoyl attachment protein; solution structu | 3e-05 | |
| 2ejm_A | 99 | Methylcrotonoyl-COA carboxylase subunit alpha; bio | 3e-04 | |
| 2ejm_A | 99 | Methylcrotonoyl-COA carboxylase subunit alpha; bio | 3e-04 |
| >2ii3_A Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex...; cubic core, HOMO trimer, oxidized COA-bound form; HET: CAO; 2.17A {Bos taurus} PDB: 2ihw_A* 2ii4_A* 2ii5_A* Length = 262 | Back alignment and structure |
|---|
Score = 259 bits (665), Expect = 1e-79
Identities = 96/223 (43%), Positives = 148/223 (66%), Gaps = 2/223 (0%)
Query: 680 VIPIRGYVKGMFKSMTEANTIPSLRLTEEVDTTQLRDVKNQVSALYQEKFRLKLTYMPFF 739
P++G+ K M K+M+ A IP +EVD T+L ++ ++ + + +KL++MPFF
Sbjct: 33 TEPVKGFHKAMVKTMSAALKIPHFGYCDEVDLTELVKLREELKPIAFAR-GIKLSFMPFF 91
Query: 740 IKALSLCMTEHPILNASIDPTQENILVNPDHNISIAIDTKHGLVVPNIKSVNKLCLLDIT 799
+KA SL + + PILNAS+D +NI HNI IA+DT+ GL+VPN+K+V + +I
Sbjct: 92 LKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQIRSIFEIA 151
Query: 800 RELLRIQGCSHEGKVLPRDIQGGTISMSNVGNVGGTLVQPIIVPGQVCIVAFGKIQLLPR 859
EL R+Q G++ D+ GGT ++SN+G++GGT +P+I+P +V I A G I+ LPR
Sbjct: 152 TELNRLQKLGSAGQLSTNDLIGGTFTLSNIGSIGGTYAKPVILPPEVAIGALGTIKALPR 211
Query: 860 FDAEMRIVAKCILNVTWAADHRVVDGATVARAATLWKS-LENI 901
F+ + + I+NV+W+ADHR++DGATV+R + LWKS LEN
Sbjct: 212 FNEKGEVCKAQIMNVSWSADHRIIDGATVSRFSNLWKSYLENP 254
|
| >2ii3_A Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex...; cubic core, HOMO trimer, oxidized COA-bound form; HET: CAO; 2.17A {Bos taurus} PDB: 2ihw_A* 2ii4_A* 2ii5_A* Length = 262 | Back alignment and structure |
|---|
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 | Back alignment and structure |
|---|
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 | Back alignment and structure |
|---|
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 | Back alignment and structure |
|---|
| >1dpb_A Dihydrolipoyl-transacetylase; dihydrolipoamide acetyltransferase; 2.50A {Azotobacter vinelandii} SCOP: c.43.1.1 PDB: 1dpd_A 1eaa_A 1eab_A* 1eac_A* 1ead_A* 1eae_A* 1eaf_A 1dpc_A Length = 243 | Back alignment and structure |
|---|
| >1dpb_A Dihydrolipoyl-transacetylase; dihydrolipoamide acetyltransferase; 2.50A {Azotobacter vinelandii} SCOP: c.43.1.1 PDB: 1dpd_A 1eaa_A 1eab_A* 1eac_A* 1ead_A* 1eae_A* 1eaf_A 1dpc_A Length = 243 | Back alignment and structure |
|---|
| >3l60_A Branched-chain alpha-keto acid dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.00A {Mycobacterium tuberculosis} Length = 250 | Back alignment and structure |
|---|
| >3l60_A Branched-chain alpha-keto acid dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.00A {Mycobacterium tuberculosis} Length = 250 | Back alignment and structure |
|---|
| >3rqc_A Probable lipoamide acyltransferase; alpha beta fold; 4.01A {Thermoplasma acidophilum dsm 1728} Length = 224 | Back alignment and structure |
|---|
| >3rqc_A Probable lipoamide acyltransferase; alpha beta fold; 4.01A {Thermoplasma acidophilum dsm 1728} Length = 224 | Back alignment and structure |
|---|
| >3b8k_A PDCE2;, dihydrolipoyllysine-residue acetyltransferase; central beta-sheet surrounded by five alpha-helices; 8.80A {Homo sapiens} Length = 239 | Back alignment and structure |
|---|
| >3b8k_A PDCE2;, dihydrolipoyllysine-residue acetyltransferase; central beta-sheet surrounded by five alpha-helices; 8.80A {Homo sapiens} Length = 239 | Back alignment and structure |
|---|
| >3mae_A 2-oxoisovalerate dehydrogenase E2 component, dihydrolipamide acetyltransferase; 2-oxoacid dehydrogenases acyltransferase; 2.50A {Listeria monocytogenes} Length = 256 | Back alignment and structure |
|---|
| >3mae_A 2-oxoisovalerate dehydrogenase E2 component, dihydrolipamide acetyltransferase; 2-oxoacid dehydrogenases acyltransferase; 2.50A {Listeria monocytogenes} Length = 256 | Back alignment and structure |
|---|
| >1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Length = 93 | Back alignment and structure |
|---|
| >1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Length = 93 | Back alignment and structure |
|---|
| >1scz_A E2, dihydrolipoamide succinyltransferase; COA-dependent acyltransferase, CAT-like, alpha and beta (2 L mixed beta-sheeet of 6 strands; 2.20A {Escherichia coli} SCOP: c.43.1.1 PDB: 1e2o_A 1c4t_A Length = 233 | Back alignment and structure |
|---|
| >1scz_A E2, dihydrolipoamide succinyltransferase; COA-dependent acyltransferase, CAT-like, alpha and beta (2 L mixed beta-sheeet of 6 strands; 2.20A {Escherichia coli} SCOP: c.43.1.1 PDB: 1e2o_A 1c4t_A Length = 233 | Back alignment and structure |
|---|
| >2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Length = 77 | Back alignment and structure |
|---|
| >2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Length = 77 | Back alignment and structure |
|---|
| >3cla_A Type III chloramphenicol acetyltransferase; transferase (acyltransferase); HET: CLM; 1.75A {Escherichia coli} SCOP: c.43.1.1 PDB: 1cla_A* 2cla_A 4cla_A* 1cia_A 1qca_A* Length = 213 | Back alignment and structure |
|---|
| >3cla_A Type III chloramphenicol acetyltransferase; transferase (acyltransferase); HET: CLM; 1.75A {Escherichia coli} SCOP: c.43.1.1 PDB: 1cla_A* 2cla_A 4cla_A* 1cia_A 1qca_A* Length = 213 | Back alignment and structure |
|---|
| >1q23_A Chloramphenicol acetyltransferase; CAT I, trimer, fusidic acid; HET: FUA; 2.18A {Escherichia coli} SCOP: c.43.1.1 PDB: 1noc_B 1pd5_A* 3u9b_A 3u9f_A* Length = 219 | Back alignment and structure |
|---|
| >1q23_A Chloramphenicol acetyltransferase; CAT I, trimer, fusidic acid; HET: FUA; 2.18A {Escherichia coli} SCOP: c.43.1.1 PDB: 1noc_B 1pd5_A* 3u9b_A 3u9f_A* Length = 219 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3rnm_E Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex,...; protein-protein interaction, redox protein; HET: FAD NHE; 2.40A {Homo sapiens} PDB: 1zwv_A Length = 58 | Back alignment and structure |
|---|
| >3rnm_E Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex,...; protein-protein interaction, redox protein; HET: FAD NHE; 2.40A {Homo sapiens} PDB: 1zwv_A Length = 58 | Back alignment and structure |
|---|
| >2coo_A Lipoamide acyltransferase component of branched- chain alpha-keto acid dehydrogenase...; E3_binding domain; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2coo_A Lipoamide acyltransferase component of branched- chain alpha-keto acid dehydrogenase...; E3_binding domain; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2eq7_C 2-oxoglutarate dehydrogenase E2 component; protein-protein complex, oxidoreductase; HET: FAD NAD; 1.80A {Thermus thermophilus} Length = 40 | Back alignment and structure |
|---|
| >2eq7_C 2-oxoglutarate dehydrogenase E2 component; protein-protein complex, oxidoreductase; HET: FAD NAD; 1.80A {Thermus thermophilus} Length = 40 | Back alignment and structure |
|---|
| >2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} Length = 1113 | Back alignment and structure |
|---|
| >2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} Length = 1113 | Back alignment and structure |
|---|
| >2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Length = 85 | Back alignment and structure |
|---|
| >2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Length = 85 | Back alignment and structure |
|---|
| >1bal_A Dihydrolipoamide succinyltransferase; glycolysis; NMR {Escherichia coli} SCOP: a.9.1.1 PDB: 1bbl_A 1w4h_A 2wav_A 2wxc_A 2btg_A 2bth_A 2cyu_A Length = 51 | Back alignment and structure |
|---|
| >1bal_A Dihydrolipoamide succinyltransferase; glycolysis; NMR {Escherichia coli} SCOP: a.9.1.1 PDB: 1bbl_A 1w4h_A 2wav_A 2wxc_A 2btg_A 2bth_A 2cyu_A Length = 51 | Back alignment and structure |
|---|
| >1w85_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: a.9.1.1 PDB: 1w88_I* 1w4g_A 1w4e_A 1w4f_A 2pdd_A 2pde_A 1ebd_C* Length = 49 | Back alignment and structure |
|---|
| >1w4i_A Pyruvate dehydrogenase E2; transferase, peripheral-subunit binding domain, ultrafast folding, homologues,; NMR {Pyrobaculum aerophilum} PDB: 1w4j_A 1w4k_A Length = 62 | Back alignment and structure |
|---|
| >1w4i_A Pyruvate dehydrogenase E2; transferase, peripheral-subunit binding domain, ultrafast folding, homologues,; NMR {Pyrobaculum aerophilum} PDB: 1w4j_A 1w4k_A Length = 62 | Back alignment and structure |
|---|
| >1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Length = 128 | Back alignment and structure |
|---|
| >1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Length = 128 | Back alignment and structure |
|---|
| >1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Length = 80 | Back alignment and structure |
|---|
| >1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Length = 80 | Back alignment and structure |
|---|
| >2i9d_A Chloramphenicol acetyltransferase; structural genomics, PSI- protein structure initiative, midwest center for structural genomics; 2.30A {Bacteroides thetaiotaomicron} Length = 217 | Back alignment and structure |
|---|
| >1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Length = 81 | Back alignment and structure |
|---|
| >1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Length = 81 | Back alignment and structure |
|---|
| >2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2eq9_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 2.09A {Thermus thermophilus} Length = 41 | Back alignment and structure |
|---|
| >2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
| >2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
| >1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Length = 79 | Back alignment and structure |
|---|
| >1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Length = 79 | Back alignment and structure |
|---|
| >2eq8_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 1.94A {Thermus thermophilus} Length = 40 | Back alignment and structure |
|---|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Length = 84 | Back alignment and structure |
|---|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Length = 84 | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Length = 1236 | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Length = 1236 | Back alignment and structure |
|---|
| >3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Length = 87 | Back alignment and structure |
|---|
| >3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Length = 87 | Back alignment and structure |
|---|
| >1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Length = 72 | Back alignment and structure |
|---|
| >1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Length = 72 | Back alignment and structure |
|---|
| >2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1045 | |||
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 100.0 | |
| 3mae_A | 256 | 2-oxoisovalerate dehydrogenase E2 component, dihyd | 100.0 | |
| 2ii3_A | 262 | Lipoamide acyltransferase component of branched-C | 100.0 | |
| 1dpb_A | 243 | Dihydrolipoyl-transacetylase; dihydrolipoamide ace | 100.0 | |
| 3l60_A | 250 | Branched-chain alpha-keto acid dehydrogenase; stru | 100.0 | |
| 1scz_A | 233 | E2, dihydrolipoamide succinyltransferase; COA-depe | 100.0 | |
| 3rqc_A | 224 | Probable lipoamide acyltransferase; alpha beta fol | 100.0 | |
| 3b8k_A | 239 | PDCE2;, dihydrolipoyllysine-residue acetyltransfer | 100.0 | |
| 1scz_A | 233 | E2, dihydrolipoamide succinyltransferase; COA-depe | 100.0 | |
| 3mae_A | 256 | 2-oxoisovalerate dehydrogenase E2 component, dihyd | 100.0 | |
| 1dpb_A | 243 | Dihydrolipoyl-transacetylase; dihydrolipoamide ace | 100.0 | |
| 2xt6_A | 1113 | 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET | 100.0 | |
| 2ii3_A | 262 | Lipoamide acyltransferase component of branched-C | 100.0 | |
| 3l60_A | 250 | Branched-chain alpha-keto acid dehydrogenase; stru | 100.0 | |
| 3b8k_A | 239 | PDCE2;, dihydrolipoyllysine-residue acetyltransfer | 100.0 | |
| 3rqc_A | 224 | Probable lipoamide acyltransferase; alpha beta fol | 100.0 | |
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 100.0 | |
| 1q23_A | 219 | Chloramphenicol acetyltransferase; CAT I, trimer, | 100.0 | |
| 3cla_A | 213 | Type III chloramphenicol acetyltransferase; transf | 100.0 | |
| 2i9d_A | 217 | Chloramphenicol acetyltransferase; structural geno | 100.0 | |
| 2xt6_A | 1113 | 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET | 99.97 | |
| 1q23_A | 219 | Chloramphenicol acetyltransferase; CAT I, trimer, | 99.95 | |
| 1zy8_K | 229 | Pyruvate dehydrogenase protein X component, mitoch | 99.95 | |
| 3cla_A | 213 | Type III chloramphenicol acetyltransferase; transf | 99.94 | |
| 2i9d_A | 217 | Chloramphenicol acetyltransferase; structural geno | 99.92 | |
| 1zy8_K | 229 | Pyruvate dehydrogenase protein X component, mitoch | 99.91 | |
| 1y8o_B | 128 | Dihydrolipoyllysine-residue acetyltransferase COM | 99.7 | |
| 2dne_A | 108 | Dihydrolipoyllysine-residue acetyltransferase comp | 99.68 | |
| 3crk_C | 87 | Dihydrolipoyllysine-residue acetyltransferase COM | 99.66 | |
| 2dnc_A | 98 | Pyruvate dehydrogenase protein X component; lipoic | 99.66 | |
| 1k8m_A | 93 | E2 component of branched-chain ahpha-ketoacid dehy | 99.63 | |
| 1y8o_B | 128 | Dihydrolipoyllysine-residue acetyltransferase COM | 99.61 | |
| 2dnc_A | 98 | Pyruvate dehydrogenase protein X component; lipoic | 99.59 | |
| 3crk_C | 87 | Dihydrolipoyllysine-residue acetyltransferase COM | 99.59 | |
| 2dne_A | 108 | Dihydrolipoyllysine-residue acetyltransferase comp | 99.58 | |
| 1ghj_A | 79 | E2, E2, the dihydrolipoamide succinyltransferase c | 99.57 | |
| 1k8m_A | 93 | E2 component of branched-chain ahpha-ketoacid dehy | 99.55 | |
| 1qjo_A | 80 | Dihydrolipoamide acetyltransferase; lipoyl domain, | 99.52 | |
| 2l5t_A | 77 | Lipoamide acyltransferase; E2 lipoyl domain; NMR { | 99.52 | |
| 1pmr_A | 80 | Dihydrolipoyl succinyltransferase; 2-oxoglutarate | 99.51 | |
| 1ghj_A | 79 | E2, E2, the dihydrolipoamide succinyltransferase c | 99.5 | |
| 1iyu_A | 79 | E2P, dihydrolipoamide acetyltransferase component | 99.45 | |
| 1qjo_A | 80 | Dihydrolipoamide acetyltransferase; lipoyl domain, | 99.45 | |
| 2l5t_A | 77 | Lipoamide acyltransferase; E2 lipoyl domain; NMR { | 99.44 | |
| 1pmr_A | 80 | Dihydrolipoyl succinyltransferase; 2-oxoglutarate | 99.42 | |
| 1gjx_A | 81 | Pyruvate dehydrogenase; oxidoreductase, lipoyl dom | 99.4 | |
| 1iyu_A | 79 | E2P, dihydrolipoamide acetyltransferase component | 99.37 | |
| 1gjx_A | 81 | Pyruvate dehydrogenase; oxidoreductase, lipoyl dom | 99.3 | |
| 2k7v_A | 85 | Dihydrolipoyllysine-residue acetyltransferase comp | 99.29 | |
| 2k7v_A | 85 | Dihydrolipoyllysine-residue acetyltransferase comp | 99.17 | |
| 2jku_A | 94 | Propionyl-COA carboxylase alpha chain, mitochondri | 99.15 | |
| 1z6h_A | 72 | Biotin/lipoyl attachment protein; solution structu | 99.12 | |
| 2kcc_A | 84 | Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, | 99.12 | |
| 2dn8_A | 100 | Acetyl-COA carboxylase 2; biotin required enzyme, | 99.05 | |
| 2eq9_C | 41 | Pyruvate dehydrogenase complex, dihydrolipoamide a | 99.04 | |
| 3rnm_E | 58 | Lipoamide acyltransferase component of branched-C | 99.02 | |
| 2kcc_A | 84 | Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, | 99.02 | |
| 1z6h_A | 72 | Biotin/lipoyl attachment protein; solution structu | 99.01 | |
| 2d5d_A | 74 | Methylmalonyl-COA decarboxylase gamma chain; bioti | 99.0 | |
| 2eq8_C | 40 | Pyruvate dehydrogenase complex, dihydrolipoamide a | 99.0 | |
| 2jku_A | 94 | Propionyl-COA carboxylase alpha chain, mitochondri | 99.0 | |
| 2eq7_C | 40 | 2-oxoglutarate dehydrogenase E2 component; protein | 98.99 | |
| 1bdo_A | 80 | Acetyl-COA carboxylase; BCCPSC, carboxyl transfera | 98.98 | |
| 2ejm_A | 99 | Methylcrotonoyl-COA carboxylase subunit alpha; bio | 98.97 | |
| 1dcz_A | 77 | Transcarboxylase 1.3S subunit; antiparallel beta s | 98.97 | |
| 1w85_I | 49 | Dihydrolipoyllysine-residue acetyltransferase comp | 98.95 | |
| 2dn8_A | 100 | Acetyl-COA carboxylase 2; biotin required enzyme, | 98.93 | |
| 1bal_A | 51 | Dihydrolipoamide succinyltransferase; glycolysis; | 98.93 | |
| 2d5d_A | 74 | Methylmalonyl-COA decarboxylase gamma chain; bioti | 98.88 | |
| 1bdo_A | 80 | Acetyl-COA carboxylase; BCCPSC, carboxyl transfera | 98.87 | |
| 1dcz_A | 77 | Transcarboxylase 1.3S subunit; antiparallel beta s | 98.85 | |
| 3n6r_A | 681 | Propionyl-COA carboxylase, alpha subunit; protein | 98.84 | |
| 2coo_A | 70 | Lipoamide acyltransferase component of branched- c | 98.83 | |
| 2f60_K | 64 | Pyruvate dehydrogenase protein X component; protei | 98.82 | |
| 2ejm_A | 99 | Methylcrotonoyl-COA carboxylase subunit alpha; bio | 98.81 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 98.77 | |
| 1w4i_A | 62 | Pyruvate dehydrogenase E2; transferase, peripheral | 98.77 | |
| 3hbl_A | 1150 | Pyruvate carboxylase; TIM barrel, ligase; HET: BTI | 98.75 | |
| 3u9t_A | 675 | MCC alpha, methylcrotonyl-COA carboxylase, alpha-s | 98.73 | |
| 3n6r_A | 681 | Propionyl-COA carboxylase, alpha subunit; protein | 98.69 | |
| 2eq9_C | 41 | Pyruvate dehydrogenase complex, dihydrolipoamide a | 98.65 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 98.63 | |
| 2eq7_C | 40 | 2-oxoglutarate dehydrogenase E2 component; protein | 98.62 | |
| 2eq8_C | 40 | Pyruvate dehydrogenase complex, dihydrolipoamide a | 98.6 | |
| 3rnm_E | 58 | Lipoamide acyltransferase component of branched-C | 98.59 | |
| 1bal_A | 51 | Dihydrolipoamide succinyltransferase; glycolysis; | 98.59 | |
| 3hbl_A | 1150 | Pyruvate carboxylase; TIM barrel, ligase; HET: BTI | 98.58 | |
| 1zko_A | 136 | Glycine cleavage system H protein; TM0212, structu | 98.57 | |
| 3u9t_A | 675 | MCC alpha, methylcrotonyl-COA carboxylase, alpha-s | 98.54 | |
| 1w85_I | 49 | Dihydrolipoyllysine-residue acetyltransferase comp | 98.5 | |
| 2k32_A | 116 | A; NMR {Campylobacter jejuni} PDB: 2k33_A* | 98.46 | |
| 3bg3_A | 718 | Pyruvate carboxylase, mitochondrial; TIM barrel, A | 98.44 | |
| 2coo_A | 70 | Lipoamide acyltransferase component of branched- c | 98.4 | |
| 2qf7_A | 1165 | Pyruvate carboxylase protein; multi-domain, multi- | 98.35 | |
| 1w4i_A | 62 | Pyruvate dehydrogenase E2; transferase, peripheral | 98.3 | |
| 2k32_A | 116 | A; NMR {Campylobacter jejuni} PDB: 2k33_A* | 98.29 | |
| 1zko_A | 136 | Glycine cleavage system H protein; TM0212, structu | 98.29 | |
| 2f60_K | 64 | Pyruvate dehydrogenase protein X component; protei | 98.26 | |
| 3bg3_A | 718 | Pyruvate carboxylase, mitochondrial; TIM barrel, A | 98.23 | |
| 3a7l_A | 128 | H-protein, glycine cleavage system H protein; lipo | 98.17 | |
| 2qf7_A | 1165 | Pyruvate carboxylase protein; multi-domain, multi- | 98.15 | |
| 1hpc_A | 131 | H protein of the glycine cleavage system; transit | 98.14 | |
| 1onl_A | 128 | Glycine cleavage system H protein; hybrid barrel-s | 98.14 | |
| 1hpc_A | 131 | H protein of the glycine cleavage system; transit | 97.73 | |
| 1onl_A | 128 | Glycine cleavage system H protein; hybrid barrel-s | 97.73 | |
| 3a7l_A | 128 | H-protein, glycine cleavage system H protein; lipo | 97.7 | |
| 3ne5_B | 413 | Cation efflux system protein CUSB; transmembrane h | 97.3 | |
| 2f1m_A | 277 | Acriflavine resistance protein A; helical hairpin, | 97.21 | |
| 3klr_A | 125 | Glycine cleavage system H protein; antiparallel be | 97.19 | |
| 3lnn_A | 359 | Membrane fusion protein (MFP) heavy metal cation Z | 97.15 | |
| 3fpp_A | 341 | Macrolide-specific efflux protein MACA; hexameric | 97.11 | |
| 3mxu_A | 143 | Glycine cleavage system H protein; seattle structu | 97.01 | |
| 3ne5_B | 413 | Cation efflux system protein CUSB; transmembrane h | 97.0 | |
| 2f1m_A | 277 | Acriflavine resistance protein A; helical hairpin, | 96.97 | |
| 3tzu_A | 137 | GCVH, glycine cleavage system H protein 1; ssgcid, | 96.9 | |
| 3lnn_A | 359 | Membrane fusion protein (MFP) heavy metal cation Z | 96.87 | |
| 3klr_A | 125 | Glycine cleavage system H protein; antiparallel be | 96.85 | |
| 3fpp_A | 341 | Macrolide-specific efflux protein MACA; hexameric | 96.8 | |
| 1vf7_A | 369 | Multidrug resistance protein MEXA; alpha hairpin, | 96.75 | |
| 3mxu_A | 143 | Glycine cleavage system H protein; seattle structu | 96.67 | |
| 3hgb_A | 155 | Glycine cleavage system H protein; ssgcid, niaid, | 96.55 | |
| 3tzu_A | 137 | GCVH, glycine cleavage system H protein 1; ssgcid, | 96.53 | |
| 1vf7_A | 369 | Multidrug resistance protein MEXA; alpha hairpin, | 96.41 | |
| 3hgb_A | 155 | Glycine cleavage system H protein; ssgcid, niaid, | 96.02 | |
| 4dk0_A | 369 | Putative MACA; alpha-hairpin, lipoyl, beta-barrel, | 95.74 | |
| 4dk0_A | 369 | Putative MACA; alpha-hairpin, lipoyl, beta-barrel, | 95.02 | |
| 3cdx_A | 354 | Succinylglutamatedesuccinylase/aspartoacylase; str | 94.53 | |
| 3na6_A | 331 | Succinylglutamate desuccinylase/aspartoacylase; st | 94.29 | |
| 3fmc_A | 368 | Putative succinylglutamate desuccinylase / aspart; | 93.61 | |
| 2o95_A | 187 | 26S proteasome non-ATPase regulatory subunit 7; PS | 93.55 | |
| 3cdx_A | 354 | Succinylglutamatedesuccinylase/aspartoacylase; str | 92.88 | |
| 3na6_A | 331 | Succinylglutamate desuccinylase/aspartoacylase; st | 92.65 | |
| 1f3z_A | 161 | EIIA-GLC, glucose-specific phosphocarrier; phospho | 92.09 | |
| 3fmc_A | 368 | Putative succinylglutamate desuccinylase / aspart; | 91.72 | |
| 2gpr_A | 154 | Glucose-permease IIA component; phosphotransferase | 90.79 | |
| 1f3z_A | 161 | EIIA-GLC, glucose-specific phosphocarrier; phospho | 90.06 | |
| 1ax3_A | 162 | Iiaglc, glucose permease IIA domain; phosphotransf | 89.84 | |
| 4e0q_A | 141 | COP9 signalosome complex subunit 6; MPN (MPR1P and | 89.54 | |
| 2gpr_A | 154 | Glucose-permease IIA component; phosphotransferase | 88.67 | |
| 2qj8_A | 332 | MLR6093 protein; structural genomics, joint center | 88.19 | |
| 4b4t_U | 338 | RPN8, 26S proteasome regulatory subunit RPN8; hydr | 86.46 | |
| 1ax3_A | 162 | Iiaglc, glucose permease IIA domain; phosphotransf | 86.44 | |
| 2xha_A | 193 | NUSG, transcription antitermination protein NUSG; | 86.14 | |
| 2qj8_A | 332 | MLR6093 protein; structural genomics, joint center | 82.82 | |
| 2xha_A | 193 | NUSG, transcription antitermination protein NUSG; | 82.01 | |
| 4b4t_V | 306 | 26S proteasome regulatory subunit RPN11; hydrolase | 80.25 |
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A | Back alignment and structure |
|---|
Probab=100.00 E-value=6.4e-80 Score=715.98 Aligned_cols=401 Identities=32% Similarity=0.513 Sum_probs=39.5
Q ss_pred eEEEEecCCCCCcceeEEEEeeeccCCCCeeccCCeEeEEeccceeeEEecCCCEEEEEEeeCCCCEEecCCceEEEeec
Q psy6394 447 LIQFNLADIGEGIREVNIKEWNGNVTEGARINEFDVVCEVESDKASVTITSRYKGTVRKVYYGEGDVALVGKPLLDIEVE 526 (1045)
Q Consensus 447 ~~~i~~P~lge~~~eg~i~~w~~~v~~Gd~V~~gd~l~~vetdKa~~ei~ap~~G~v~~i~~~~G~~v~vg~~l~~i~~~ 526 (1045)
.++|+||+||++|+||+|++|+ |++||.|++||+||+|||||++++|+||++|+|.++++++|+.|.+|++|+.|+.+
T Consensus 2 ~~~i~mP~lg~~~~eg~i~~w~--v~~Gd~V~~gd~l~~vEt~K~~~~i~ap~~G~v~~i~v~~G~~V~~G~~l~~i~~~ 79 (428)
T 3dva_I 2 AFEFKLPDIGEGIHEGEIVKWF--VKPGDEVNEDDVLCEVQNDKAVVEIPSPVKGKVLEILVPEGTVATVGQTLITLDAP 79 (428)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred CeeEEcCCCCCCCccEEEEEEE--cCCCCEECCCCEEEEEEeCCeeEEEecCCCeEEEEEEeCCCCEeCCCCEEEEEecC
Confidence 4689999999999999999999 99999999999999999999999999999999999999999999999999999865
Q ss_pred Cccccccc-----cc---cccc-c--CC------CC--C--C-CCCCCCCCCCccccccCCCCCCCcCccccCCCCCccc
Q psy6394 527 DEGVAAEE-----AD---SLDR-K--AA------PG--V--S-EVNTPDTSDQPNETLHKDPNKIDTKELRGTGKQGRVL 584 (1045)
Q Consensus 527 ~~~~~~~~-----~~---~~~~-~--~~------~~--~--~-~~~~~~~~asP~vr~la~e~gidls~v~gTG~~GrI~ 584 (1045)
++..+... .. +.+. . +. +. . . ......+++||++||||+|+||||+.|+|||++|||+
T Consensus 80 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~asP~~R~lA~e~gvdl~~v~gtG~~GrI~ 159 (428)
T 3dva_I 80 GYENMTFKGQEQEEAKKEEKTETVSKEEKVDAVAPNAPAAEAEAGPNRRVIAMPSVRKYAREKGVDIRLVQGTGKNGRVL 159 (428)
T ss_dssp ------------------------------------------------CCCCCHHHHHHHHHTTCCGGGSCCCSTTSCCC
T ss_pred CccccccccccccccccCCCcccCCccccccCCCccccccccccccccccccCHHHHHHHHHcCCCHHHCCCCCCCCcee
Confidence 44321110 00 0000 0 00 00 0 0 0012346899999999999999999999999999999
Q ss_pred hHhHHhhhCCCCCCCCCCccccccccccceeeccccccccccccccccCCCccccccccccccccccchhhhcccCCCCC
Q psy6394 585 KEDIITYMNSPSDETNPAHTAHVREASNVISIRGYVKGMFKSMTEANTIPSLRLTEEVDTTQLRDVKKEDIITYMNSPSD 664 (1045)
Q Consensus 585 k~DV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~l~~~~d~~~~~~v~~~~~~~~~~~~~~ 664 (1045)
|+||++|++.......++.+++ . ...++
T Consensus 160 k~DV~~~~~~~~~~~~~~~~~~--~-------------------------------------------------~~~~~- 187 (428)
T 3dva_I 160 KEDIDAFLAGGAKPAPAAAEEK--A-------------------------------------------------APAAA- 187 (428)
T ss_dssp TTTTTTTSCC----------------------------------------------------------------------
T ss_pred HHHHHHHhhccccccccccccc--c-------------------------------------------------ccCCC-
Confidence 9999999764321100000000 0 00000
Q ss_pred CCCCCcccccCCcceeeecCchhhHHHHHhhhc-CCCCeeEEeecccchHHHHHHHHHHHHHHhccCcccChHHHHHHHH
Q psy6394 665 ETNPAHTAHVREASNVIPIRGYVKGMFKSMTEA-NTIPSLRLTEEVDTTQLRDVKNQVSALYQEKFRLKLTYMPFFIKAL 743 (1045)
Q Consensus 665 ~~~p~~~~~~~~~~~~~pls~~rk~ia~~m~~S-~~iP~~~~~~evD~t~l~~~r~~~~~~~~~~~~~klT~~~~likAv 743 (1045)
.+. ........+++||++|||.||++|.+| +++||+|++.+||+|+|+++|+++++..++.+ .|+||++|++||+
T Consensus 188 --~~~-~~~~~~~~~~~p~s~~Rk~ia~~m~~S~~~~P~~~~~~evDvt~l~~~rk~~~~~~~~~g-~kls~~~~~ikAv 263 (428)
T 3dva_I 188 --KPA-TTEGEFPETREKMSGIRRAIAKAMVHSKHTAPHVTLMDEADVTKLVAHRKKFKAIAAEKG-IKLTFLPYVVKAL 263 (428)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred --Ccc-ccccCCccccccCcHHHHHHHHHHHHhcccCCeEEEEEEEeHHHHHHHHHHhhhhHhhcC-CCcCHHHHHHHHH
Confidence 000 000112366789999999999999999 79999999999999999999999997655556 9999999999999
Q ss_pred HHHHHhCCccceEEcCCCceEEEcCCccEEEEEecCCCeeeeeecccccccHHHHHHHHHHHHhccccCCCCCCccCCCc
Q psy6394 744 SLCMTEHPILNASIDPTQENILVNPDHNISIAIDTKHGLVVPNIKSVNKLCLLDITRELLRIQGCSHEGKVLPRDIQGGT 823 (1045)
Q Consensus 744 a~aL~~~P~lNa~~~~~~~~i~~~~~vnIgiAV~t~~GL~vPvIr~ad~~sl~ei~~~l~~l~~~ar~~kl~~~d~~ggT 823 (1045)
++||++||+||++|++++++|++++++|||+||++++||++|||++++.+++.+|+++++++.+++|+|+|+++|++|||
T Consensus 264 a~Al~~~P~~Na~~~~~~~~i~~~~~v~igiAV~t~~GL~vPvi~~a~~~sl~eia~~~~~l~~~ar~gkL~~~e~~ggt 343 (428)
T 3dva_I 264 VSALREYPVLNTSIDDETEEIIQKHYYNIGIAADTDRGLLVPVIKHADRKPIFALAQEINELAEKARDGKLTPGEMKGAS 343 (428)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred HHHHHhCHHhhheEecCCCeEEEcCccCeEEEEEcCCceEEeeeccCCCCCHHHHHHHHHHHHHHHHcCCCCccccCCCE
Confidence 99999999999999865578999999999999999999999999999999999999999999999999999999999999
Q ss_pred eEeeccCCccceeecccccccceeeEeeccceeEeEeccCCceeEEEeeeEEEeccceeecchhhhhhhhhhhhcccccc
Q psy6394 824 ISMSNVGNVGGTLVQPIIVPGQVCIVAFGKIQLLPRFDAEMRIVAKCILNVTWAADHRVVDGATVARAATLWKSLENILV 903 (1045)
Q Consensus 824 ftISNlG~~G~~~~tpii~~pq~ailavG~i~~~p~~~~~g~i~~~~~m~lslt~DhRviDGa~aa~fl~~~~~~~~ile 903 (1045)
|||||+|+||+++|+||||+||+|||++|+++++|++ .+|++++|++|+++|+||||||||+++++||+.|+++ |+
T Consensus 344 ftISnlG~~G~~~ftpIin~pq~aIl~vG~i~~~pv~-~~g~i~~r~~m~lsls~DHRviDG~~aa~Fl~~lk~~---Le 419 (428)
T 3dva_I 344 CTITNIGSAGGQWFTPVINHPEVAILGIGRIAEKPIV-RDGEIVAAPMLALSLSFDHRMIDGATAQKALNHIKRL---LS 419 (428)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred EEEEcCCCCCccceEeecCCCCceEEEccccEEEEEE-ECCEEEEeeeEEEEEEecccccchHHHHHHHHHHHHH---Hh
Confidence 9999999999999999999999999999999999999 6889999999999999999999999999999999999 99
Q ss_pred cCCcce
Q psy6394 904 NPDHNI 909 (1045)
Q Consensus 904 ~p~v~I 909 (1045)
+|..++
T Consensus 420 ~P~~ll 425 (428)
T 3dva_I 420 DPELLL 425 (428)
T ss_dssp ------
T ss_pred CHHHHh
Confidence 998664
|
| >3mae_A 2-oxoisovalerate dehydrogenase E2 component, dihydrolipamide acetyltransferase; 2-oxoacid dehydrogenases acyltransferase; 2.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2ii3_A Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex...; cubic core, HOMO trimer, oxidized COA-bound form; HET: CAO; 2.17A {Bos taurus} PDB: 2ihw_A* 2ii4_A* 2ii5_A* | Back alignment and structure |
|---|
| >1dpb_A Dihydrolipoyl-transacetylase; dihydrolipoamide acetyltransferase; 2.50A {Azotobacter vinelandii} SCOP: c.43.1.1 PDB: 1dpd_A 1eaa_A 1eab_A* 1eac_A* 1ead_A* 1eae_A* 1eaf_A 1dpc_A | Back alignment and structure |
|---|
| >3l60_A Branched-chain alpha-keto acid dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: c.43.1.0 | Back alignment and structure |
|---|
| >1scz_A E2, dihydrolipoamide succinyltransferase; COA-dependent acyltransferase, CAT-like, alpha and beta (2 L mixed beta-sheeet of 6 strands; 2.20A {Escherichia coli} SCOP: c.43.1.1 PDB: 1e2o_A 1c4t_A | Back alignment and structure |
|---|
| >3rqc_A Probable lipoamide acyltransferase; alpha beta fold; 4.01A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >3b8k_A PDCE2;, dihydrolipoyllysine-residue acetyltransferase; central beta-sheet surrounded by five alpha-helices; 8.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1scz_A E2, dihydrolipoamide succinyltransferase; COA-dependent acyltransferase, CAT-like, alpha and beta (2 L mixed beta-sheeet of 6 strands; 2.20A {Escherichia coli} SCOP: c.43.1.1 PDB: 1e2o_A 1c4t_A | Back alignment and structure |
|---|
| >3mae_A 2-oxoisovalerate dehydrogenase E2 component, dihydrolipamide acetyltransferase; 2-oxoacid dehydrogenases acyltransferase; 2.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1dpb_A Dihydrolipoyl-transacetylase; dihydrolipoamide acetyltransferase; 2.50A {Azotobacter vinelandii} SCOP: c.43.1.1 PDB: 1dpd_A 1eaa_A 1eab_A* 1eac_A* 1ead_A* 1eae_A* 1eaf_A 1dpc_A | Back alignment and structure |
|---|
| >2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2ii3_A Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex...; cubic core, HOMO trimer, oxidized COA-bound form; HET: CAO; 2.17A {Bos taurus} PDB: 2ihw_A* 2ii4_A* 2ii5_A* | Back alignment and structure |
|---|
| >3l60_A Branched-chain alpha-keto acid dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: c.43.1.0 | Back alignment and structure |
|---|
| >3b8k_A PDCE2;, dihydrolipoyllysine-residue acetyltransferase; central beta-sheet surrounded by five alpha-helices; 8.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3rqc_A Probable lipoamide acyltransferase; alpha beta fold; 4.01A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A | Back alignment and structure |
|---|
| >1q23_A Chloramphenicol acetyltransferase; CAT I, trimer, fusidic acid; HET: FUA; 2.18A {Escherichia coli} SCOP: c.43.1.1 PDB: 1noc_B 1pd5_A* 3u9b_A 3u9f_A* | Back alignment and structure |
|---|
| >3cla_A Type III chloramphenicol acetyltransferase; transferase (acyltransferase); HET: CLM; 1.75A {Escherichia coli} SCOP: c.43.1.1 PDB: 1cla_A* 2cla_A 4cla_A* 1cia_A 1qca_A* | Back alignment and structure |
|---|
| >2i9d_A Chloramphenicol acetyltransferase; structural genomics, PSI- protein structure initiative, midwest center for structural genomics; 2.30A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >1q23_A Chloramphenicol acetyltransferase; CAT I, trimer, fusidic acid; HET: FUA; 2.18A {Escherichia coli} SCOP: c.43.1.1 PDB: 1noc_B 1pd5_A* 3u9b_A 3u9f_A* | Back alignment and structure |
|---|
| >3cla_A Type III chloramphenicol acetyltransferase; transferase (acyltransferase); HET: CLM; 1.75A {Escherichia coli} SCOP: c.43.1.1 PDB: 1cla_A* 2cla_A 4cla_A* 1cia_A 1qca_A* | Back alignment and structure |
|---|
| >2i9d_A Chloramphenicol acetyltransferase; structural genomics, PSI- protein structure initiative, midwest center for structural genomics; 2.30A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A | Back alignment and structure |
|---|
| >2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* | Back alignment and structure |
|---|
| >2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A | Back alignment and structure |
|---|
| >1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A | Back alignment and structure |
|---|
| >2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* | Back alignment and structure |
|---|
| >2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A | Back alignment and structure |
|---|
| >1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A | Back alignment and structure |
|---|
| >1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A | Back alignment and structure |
|---|
| >1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A | Back alignment and structure |
|---|
| >1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A | Back alignment and structure |
|---|
| >1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* | Back alignment and structure |
|---|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq9_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 2.09A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3rnm_E Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex,...; protein-protein interaction, redox protein; HET: FAD NHE; 2.40A {Homo sapiens} SCOP: a.9.1.0 PDB: 1zwv_A | Back alignment and structure |
|---|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* | Back alignment and structure |
|---|
| >2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A | Back alignment and structure |
|---|
| >2eq8_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 1.94A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2eq7_C 2-oxoglutarate dehydrogenase E2 component; protein-protein complex, oxidoreductase; HET: FAD NAD; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A | Back alignment and structure |
|---|
| >2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A | Back alignment and structure |
|---|
| >1w85_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: a.9.1.1 PDB: 1w88_I* 1w4g_A 1w4e_A 1w4f_A 2pdd_A 2pde_A 1ebd_C* | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bal_A Dihydrolipoamide succinyltransferase; glycolysis; NMR {Escherichia coli} SCOP: a.9.1.1 PDB: 1bbl_A 1w4h_A 2wav_A 2wxc_A 2btg_A 2bth_A 2cyu_A | Back alignment and structure |
|---|
| >2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A | Back alignment and structure |
|---|
| >1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A | Back alignment and structure |
|---|
| >1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A | Back alignment and structure |
|---|
| >3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >2coo_A Lipoamide acyltransferase component of branched- chain alpha-keto acid dehydrogenase...; E3_binding domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f60_K Pyruvate dehydrogenase protein X component; protein-binding protein, E3BD, protein binding; 1.55A {Homo sapiens} PDB: 2f5z_K | Back alignment and structure |
|---|
| >2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} | Back alignment and structure |
|---|
| >1w4i_A Pyruvate dehydrogenase E2; transferase, peripheral-subunit binding domain, ultrafast folding, homologues,; NMR {Pyrobaculum aerophilum} PDB: 1w4j_A 1w4k_A | Back alignment and structure |
|---|
| >3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* | Back alignment and structure |
|---|
| >3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >2eq9_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 2.09A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} | Back alignment and structure |
|---|
| >2eq7_C 2-oxoglutarate dehydrogenase E2 component; protein-protein complex, oxidoreductase; HET: FAD NAD; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2eq8_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 1.94A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3rnm_E Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex,...; protein-protein interaction, redox protein; HET: FAD NHE; 2.40A {Homo sapiens} SCOP: a.9.1.0 PDB: 1zwv_A | Back alignment and structure |
|---|
| >1bal_A Dihydrolipoamide succinyltransferase; glycolysis; NMR {Escherichia coli} SCOP: a.9.1.1 PDB: 1bbl_A 1w4h_A 2wav_A 2wxc_A 2btg_A 2bth_A 2cyu_A | Back alignment and structure |
|---|
| >3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* | Back alignment and structure |
|---|
| >1zko_A Glycine cleavage system H protein; TM0212, structural genomi center for structural genomics, JCSG, protein structure INI PSI; HET: MSE; 1.65A {Thermotoga maritima} PDB: 2ka7_A | Back alignment and structure |
|---|
| >1w85_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: a.9.1.1 PDB: 1w88_I* 1w4g_A 1w4e_A 1w4f_A 2pdd_A 2pde_A 1ebd_C* | Back alignment and structure |
|---|
| >2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* | Back alignment and structure |
|---|
| >3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A | Back alignment and structure |
|---|
| >2coo_A Lipoamide acyltransferase component of branched- chain alpha-keto acid dehydrogenase...; E3_binding domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* | Back alignment and structure |
|---|
| >1w4i_A Pyruvate dehydrogenase E2; transferase, peripheral-subunit binding domain, ultrafast folding, homologues,; NMR {Pyrobaculum aerophilum} PDB: 1w4j_A 1w4k_A | Back alignment and structure |
|---|
| >2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* | Back alignment and structure |
|---|
| >1zko_A Glycine cleavage system H protein; TM0212, structural genomi center for structural genomics, JCSG, protein structure INI PSI; HET: MSE; 1.65A {Thermotoga maritima} PDB: 2ka7_A | Back alignment and structure |
|---|
| >2f60_K Pyruvate dehydrogenase protein X component; protein-binding protein, E3BD, protein binding; 1.55A {Homo sapiens} PDB: 2f5z_K | Back alignment and structure |
|---|
| >3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A | Back alignment and structure |
|---|
| >3a7l_A H-protein, glycine cleavage system H protein; lipoic acid, lipoyl, transport protein; 1.30A {Escherichia coli} PDB: 3a7a_B 3ab9_A* 3a8i_E* 3a8j_E* 3a8k_E* | Back alignment and structure |
|---|
| >2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* | Back alignment and structure |
|---|
| >1hpc_A H protein of the glycine cleavage system; transit peptide; HET: LPA; 2.00A {Pisum sativum} SCOP: b.84.1.1 PDB: 1dxm_A* 1htp_A* | Back alignment and structure |
|---|
| >1onl_A Glycine cleavage system H protein; hybrid barrel-sandwich structure, structural genomics, riken structural genomics/proteomics initiative; 2.50A {Thermus thermophilus} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >1hpc_A H protein of the glycine cleavage system; transit peptide; HET: LPA; 2.00A {Pisum sativum} SCOP: b.84.1.1 PDB: 1dxm_A* 1htp_A* | Back alignment and structure |
|---|
| >1onl_A Glycine cleavage system H protein; hybrid barrel-sandwich structure, structural genomics, riken structural genomics/proteomics initiative; 2.50A {Thermus thermophilus} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >3a7l_A H-protein, glycine cleavage system H protein; lipoic acid, lipoyl, transport protein; 1.30A {Escherichia coli} PDB: 3a7a_B 3ab9_A* 3a8i_E* 3a8j_E* 3a8k_E* | Back alignment and structure |
|---|
| >3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B | Back alignment and structure |
|---|
| >2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} | Back alignment and structure |
|---|
| >3klr_A Glycine cleavage system H protein; antiparallel beta sheet, beta sandwich, oxidoreductase; HET: GOL; 0.88A {Bos taurus} SCOP: b.84.1.0 PDB: 2edg_A | Back alignment and structure |
|---|
| >3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} | Back alignment and structure |
|---|
| >3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} | Back alignment and structure |
|---|
| >3mxu_A Glycine cleavage system H protein; seattle structural genomics center for infectious disease, S CAT-scratch disease, bacteremia; HET: CIT; 1.80A {Bartonella henselae} | Back alignment and structure |
|---|
| >3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B | Back alignment and structure |
|---|
| >2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} | Back alignment and structure |
|---|
| >3tzu_A GCVH, glycine cleavage system H protein 1; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} | Back alignment and structure |
|---|
| >3klr_A Glycine cleavage system H protein; antiparallel beta sheet, beta sandwich, oxidoreductase; HET: GOL; 0.88A {Bos taurus} SCOP: b.84.1.0 PDB: 2edg_A | Back alignment and structure |
|---|
| >3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} | Back alignment and structure |
|---|
| >1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A | Back alignment and structure |
|---|
| >3mxu_A Glycine cleavage system H protein; seattle structural genomics center for infectious disease, S CAT-scratch disease, bacteremia; HET: CIT; 1.80A {Bartonella henselae} | Back alignment and structure |
|---|
| >3hgb_A Glycine cleavage system H protein; ssgcid, niaid, decode, UW, SBRI, lipoyl; 1.75A {Mycobacterium tuberculosis} PDB: 3ift_A | Back alignment and structure |
|---|
| >3tzu_A GCVH, glycine cleavage system H protein 1; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A | Back alignment and structure |
|---|
| >3hgb_A Glycine cleavage system H protein; ssgcid, niaid, decode, UW, SBRI, lipoyl; 1.75A {Mycobacterium tuberculosis} PDB: 3ift_A | Back alignment and structure |
|---|
| >4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A | Back alignment and structure |
|---|
| >4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A | Back alignment and structure |
|---|
| >3cdx_A Succinylglutamatedesuccinylase/aspartoacylase; structural genomics, PSI-2, protein structure initiative; 2.10A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >3na6_A Succinylglutamate desuccinylase/aspartoacylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.00A {Ruegeria SP} | Back alignment and structure |
|---|
| >3fmc_A Putative succinylglutamate desuccinylase / aspart; S genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Shewanella amazonensis} PDB: 3lwu_A* | Back alignment and structure |
|---|
| >2o95_A 26S proteasome non-ATPase regulatory subunit 7; PSMD7, MOV34, JAB1/MPN, metal-free dimer, UN function; HET: SO4 12P ETE PG4 PGE; 1.95A {Homo sapiens} PDB: 2o96_A | Back alignment and structure |
|---|
| >3cdx_A Succinylglutamatedesuccinylase/aspartoacylase; structural genomics, PSI-2, protein structure initiative; 2.10A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >3na6_A Succinylglutamate desuccinylase/aspartoacylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.00A {Ruegeria SP} | Back alignment and structure |
|---|
| >1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A | Back alignment and structure |
|---|
| >3fmc_A Putative succinylglutamate desuccinylase / aspart; S genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Shewanella amazonensis} PDB: 3lwu_A* | Back alignment and structure |
|---|
| >2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 | Back alignment and structure |
|---|
| >1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A | Back alignment and structure |
|---|
| >1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A | Back alignment and structure |
|---|
| >4e0q_A COP9 signalosome complex subunit 6; MPN (MPR1P and PAD1P N-terminal) domain, unknown function; 2.50A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 | Back alignment and structure |
|---|
| >2qj8_A MLR6093 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.00A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >4b4t_U RPN8, 26S proteasome regulatory subunit RPN8; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A | Back alignment and structure |
|---|
| >2xha_A NUSG, transcription antitermination protein NUSG; 1.91A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2qj8_A MLR6093 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.00A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >2xha_A NUSG, transcription antitermination protein NUSG; 1.91A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4b4t_V 26S proteasome regulatory subunit RPN11; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 1045 | ||||
| d1scza_ | 233 | c.43.1.1 (A:) Dihydrolipoamide succinyltransferase | 2e-42 | |
| d1scza_ | 233 | c.43.1.1 (A:) Dihydrolipoamide succinyltransferase | 7e-28 | |
| d1q23a_ | 214 | c.43.1.1 (A:) Chloramphenicol acetyltransferase, C | 8e-34 | |
| d1q23a_ | 214 | c.43.1.1 (A:) Chloramphenicol acetyltransferase, C | 6e-23 | |
| d1b5sa_ | 242 | c.43.1.1 (A:) Dihydrolipoamide acetyltransferase { | 8e-34 | |
| d1b5sa_ | 242 | c.43.1.1 (A:) Dihydrolipoamide acetyltransferase { | 3e-25 | |
| d3claa_ | 213 | c.43.1.1 (A:) Chloramphenicol acetyltransferase, C | 2e-30 | |
| d3claa_ | 213 | c.43.1.1 (A:) Chloramphenicol acetyltransferase, C | 4e-22 | |
| d1dpba_ | 243 | c.43.1.1 (A:) Dihydrolipoamide acetyltransferase { | 6e-26 | |
| d1dpba_ | 243 | c.43.1.1 (A:) Dihydrolipoamide acetyltransferase { | 4e-18 | |
| d1k8ma_ | 87 | b.84.1.1 (A:) Lipoyl domain of the mitochondrial b | 7e-18 | |
| d1k8ma_ | 87 | b.84.1.1 (A:) Lipoyl domain of the mitochondrial b | 2e-17 | |
| d1laba_ | 80 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 7e-16 | |
| d1laba_ | 80 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 2e-15 | |
| d1ghja_ | 79 | b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate | 2e-14 | |
| d1ghja_ | 79 | b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate | 7e-14 | |
| d1pmra_ | 80 | b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate | 2e-14 | |
| d1pmra_ | 80 | b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate | 7e-14 | |
| d1gjxa_ | 81 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 1e-13 | |
| d1gjxa_ | 81 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 6e-13 | |
| d1y8ob1 | 102 | b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoa | 3e-13 | |
| d1y8ob1 | 102 | b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoa | 1e-12 | |
| d1qjoa_ | 80 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 2e-12 | |
| d1qjoa_ | 80 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 6e-12 | |
| d1iyua_ | 79 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 8e-11 | |
| d1iyua_ | 79 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 3e-10 | |
| d1w85i_ | 42 | a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl | 9e-11 | |
| d1w85i_ | 42 | a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl | 2e-04 | |
| d2cyua1 | 39 | a.9.1.1 (A:2-40) E3-binding domain of dihydrolipoa | 4e-08 | |
| d2cyua1 | 39 | a.9.1.1 (A:2-40) E3-binding domain of dihydrolipoa | 4e-04 | |
| d1dcza_ | 77 | b.84.1.1 (A:) Biotin carboxyl carrier domain of tr | 2e-06 | |
| d1dcza_ | 77 | b.84.1.1 (A:) Biotin carboxyl carrier domain of tr | 2e-06 | |
| d1bdoa_ | 80 | b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carbox | 3e-05 | |
| d1bdoa_ | 80 | b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carbox | 3e-05 |
| >d1scza_ c.43.1.1 (A:) Dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} Length = 233 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: CoA-dependent acyltransferases superfamily: CoA-dependent acyltransferases family: CAT-like domain: Dihydrolipoamide succinyltransferase species: Escherichia coli [TaxId: 562]
Score = 152 bits (385), Expect = 2e-42
Identities = 56/222 (25%), Positives = 114/222 (51%), Gaps = 5/222 (2%)
Query: 681 IPIRGYVKGMFKSMTEA-NTIPSLRLTEEVDTTQLRDVKNQVSALYQEKFRLKLTYMPFF 739
+P+ K + + + EA N+ L EV+ + D++ Q ++++ ++L +M F+
Sbjct: 7 VPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFY 66
Query: 740 IKALSLCMTEHPILNASIDPTQENILVNPDHNISIAIDTKHGLVVPNIKSVNKLCLLDIT 799
+KA+ + +P +NASID ++++ + ++S+A+ T GLV P ++ V+ L + DI
Sbjct: 67 VKAVVEALKRYPEVNASID--GDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMADIE 124
Query: 800 RELLRIQGCSHEGKVLPRDIQGGTISMSNVGNVGGTLVQPIIVPGQVCIVAFGKIQLLPR 859
+++ + +GK+ D+ GG +++N G G + PII P Q I+ I+ P
Sbjct: 125 KKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPM 184
Query: 860 FDAEMRIVAKCILNVTWAADHRVVDGATVARAATLWKS-LEN 900
++ ++ + + DHR++DG K LE+
Sbjct: 185 AV-NGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLED 225
|
| >d1scza_ c.43.1.1 (A:) Dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} Length = 233 | Back information, alignment and structure |
|---|
| >d1q23a_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} Length = 214 | Back information, alignment and structure |
|---|
| >d1q23a_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} Length = 214 | Back information, alignment and structure |
|---|
| >d1b5sa_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 242 | Back information, alignment and structure |
|---|
| >d1b5sa_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 242 | Back information, alignment and structure |
|---|
| >d3claa_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} Length = 213 | Back information, alignment and structure |
|---|
| >d3claa_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} Length = 213 | Back information, alignment and structure |
|---|
| >d1dpba_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Length = 243 | Back information, alignment and structure |
|---|
| >d1dpba_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Length = 243 | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 80 | Back information, alignment and structure |
|---|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 80 | Back information, alignment and structure |
|---|
| >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Length = 79 | Back information, alignment and structure |
|---|
| >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Length = 79 | Back information, alignment and structure |
|---|
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Length = 81 | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Length = 81 | Back information, alignment and structure |
|---|
| >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Length = 79 | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Length = 79 | Back information, alignment and structure |
|---|
| >d1w85i_ a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 42 | Back information, alignment and structure |
|---|
| >d1w85i_ a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 42 | Back information, alignment and structure |
|---|
| >d2cyua1 a.9.1.1 (A:2-40) E3-binding domain of dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} Length = 39 | Back information, alignment and structure |
|---|
| >d2cyua1 a.9.1.1 (A:2-40) E3-binding domain of dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} Length = 39 | Back information, alignment and structure |
|---|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Length = 77 | Back information, alignment and structure |
|---|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Length = 77 | Back information, alignment and structure |
|---|
| >d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
| >d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1045 | |||
| d1scza_ | 233 | Dihydrolipoamide succinyltransferase {Escherichia | 100.0 | |
| d1dpba_ | 243 | Dihydrolipoamide acetyltransferase {Azotobacter vi | 100.0 | |
| d1b5sa_ | 242 | Dihydrolipoamide acetyltransferase {Bacillus stear | 100.0 | |
| d1dpba_ | 243 | Dihydrolipoamide acetyltransferase {Azotobacter vi | 100.0 | |
| d1b5sa_ | 242 | Dihydrolipoamide acetyltransferase {Bacillus stear | 100.0 | |
| d1scza_ | 233 | Dihydrolipoamide succinyltransferase {Escherichia | 100.0 | |
| d1q23a_ | 214 | Chloramphenicol acetyltransferase, CAT {Escherichi | 99.97 | |
| d3claa_ | 213 | Chloramphenicol acetyltransferase, CAT {Escherichi | 99.96 | |
| d1q23a_ | 214 | Chloramphenicol acetyltransferase, CAT {Escherichi | 99.9 | |
| d3claa_ | 213 | Chloramphenicol acetyltransferase, CAT {Escherichi | 99.88 | |
| d1y8ob1 | 102 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.84 | |
| d1k8ma_ | 87 | Lipoyl domain of the mitochondrial branched-chain | 99.82 | |
| d1ghja_ | 79 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 99.81 | |
| d1laba_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.79 | |
| d1y8ob1 | 102 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.79 | |
| d1ghja_ | 79 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 99.78 | |
| d1k8ma_ | 87 | Lipoyl domain of the mitochondrial branched-chain | 99.77 | |
| d1laba_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.76 | |
| d1pmra_ | 80 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 99.75 | |
| d1qjoa_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.74 | |
| d1gjxa_ | 81 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.74 | |
| d1pmra_ | 80 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 99.72 | |
| d1qjoa_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.69 | |
| d1iyua_ | 79 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.69 | |
| d1gjxa_ | 81 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.67 | |
| d1iyua_ | 79 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.64 | |
| d1dcza_ | 77 | Biotin carboxyl carrier domain of transcarboxylase | 99.43 | |
| d1w85i_ | 42 | E3/E1 binding domain of dihydrolipoyl acetyltransf | 99.41 | |
| d1dcza_ | 77 | Biotin carboxyl carrier domain of transcarboxylase | 99.33 | |
| d2cyua1 | 39 | E3-binding domain of dihydrolipoamide succinyltran | 99.33 | |
| d1bdoa_ | 80 | Biotinyl domain of acetyl-CoA carboxylase {Escheri | 99.23 | |
| d1w85i_ | 42 | E3/E1 binding domain of dihydrolipoyl acetyltransf | 99.14 | |
| d1bdoa_ | 80 | Biotinyl domain of acetyl-CoA carboxylase {Escheri | 99.11 | |
| d2cyua1 | 39 | E3-binding domain of dihydrolipoamide succinyltran | 99.04 | |
| d1onla_ | 127 | Protein H of glycine cleavage system {Thermus ther | 96.28 | |
| d1hpca_ | 131 | Protein H of glycine cleavage system {Pea (Pisum s | 96.14 | |
| d1onla_ | 127 | Protein H of glycine cleavage system {Thermus ther | 95.71 | |
| d1hpca_ | 131 | Protein H of glycine cleavage system {Pea (Pisum s | 95.59 | |
| d1vf7a_ | 237 | Multidrug resistance protein MexA domain {Pseudomo | 90.17 | |
| d1vf7a_ | 237 | Multidrug resistance protein MexA domain {Pseudomo | 89.66 |
| >d1scza_ c.43.1.1 (A:) Dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: CoA-dependent acyltransferases superfamily: CoA-dependent acyltransferases family: CAT-like domain: Dihydrolipoamide succinyltransferase species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=2.1e-58 Score=490.79 Aligned_cols=229 Identities=26% Similarity=0.467 Sum_probs=214.5
Q ss_pred cceeeecCchhhHHHHHhhhc-CCCCeeEEeecccchHHHHHHHHHHHHHHhccCcccChHHHHHHHHHHHHHhCCccce
Q psy6394 677 ASNVIPIRGYVKGMFKSMTEA-NTIPSLRLTEEVDTTQLRDVKNQVSALYQEKFRLKLTYMPFFIKALSLCMTEHPILNA 755 (1045)
Q Consensus 677 ~~~~~pls~~rk~ia~~m~~S-~~iP~~~~~~evD~t~l~~~r~~~~~~~~~~~~~klT~~~~likAva~aL~~~P~lNa 755 (1045)
.++++|++++||+||++|.+| +++||+|++.+||+++|+++|+++++...+..+.++|+++|++||++.||++||.+|+
T Consensus 3 ~ee~vpls~~rk~ia~~m~~S~~~iP~~~~~~evd~t~l~~~r~~~~~~~~~~~~~klt~~~~likA~a~aL~~~P~~Na 82 (233)
T d1scza_ 3 SEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFYVKAVVEALKRYPEVNA 82 (233)
T ss_dssp SCCCCCCCHHHHHHHHHHHHHHTTSCEEEEEEEEECHHHHHHHHHHHHHHHHHHSSCCCSHHHHHHHHHHHHHHCTTTTC
T ss_pred CCcccCCcHHHHHHHHHHHHHhccCCeEEEEEEEEHHHHHHHHHHHHHhhHhhcCCccCHHHHHHHHHHHHHHhCchhhe
Confidence 356789999999999999999 8999999999999999999999998876655459999999999999999999999999
Q ss_pred EEcCCCceEEEcCCccEEEEEecCCCeeeeeecccccccHHHHHHHHHHHHhccccCCCCCCccCCCceEeeccCCccce
Q psy6394 756 SIDPTQENILVNPDHNISIAIDTKHGLVVPNIKSVNKLCLLDITRELLRIQGCSHEGKVLPRDIQGGTISMSNVGNVGGT 835 (1045)
Q Consensus 756 ~~~~~~~~i~~~~~vnIgiAV~t~~GL~vPvIr~ad~~sl~ei~~~l~~l~~~ar~~kl~~~d~~ggTftISNlG~~G~~ 835 (1045)
+|++ +++
T Consensus 83 ~~~~--~~i----------------------------------------------------------------------- 89 (233)
T d1scza_ 83 SIDG--DDV----------------------------------------------------------------------- 89 (233)
T ss_dssp EEET--TEE-----------------------------------------------------------------------
T ss_pred EEcC--CeE-----------------------------------------------------------------------
Confidence 9974 111
Q ss_pred eecccccccceeeEeeccceeEeEeccCCceeEEEeeeEEEeccceeecchhhhhhhhhhhhcccccccCCcceEEEEec
Q psy6394 836 LVQPIIVPGQVCIVAFGKIQLLPRFDAEMRIVAKCILNVTWAADHRVVDGATVARAATLWKSLENILVNPDHNISIAIDT 915 (1045)
Q Consensus 836 ~~tpii~~pq~ailavG~i~~~p~~~~~g~i~~~~~m~lslt~DhRviDGa~aa~fl~~~~~~~~ile~p~v~Igiav~~ 915 (1045)
+.++++||||||++
T Consensus 90 ------------------------------------------------------------------~~~~~vnIgiAv~~ 103 (233)
T d1scza_ 90 ------------------------------------------------------------------VYHNYFDVSMAVST 103 (233)
T ss_dssp ------------------------------------------------------------------ECCSSCCEEECEEE
T ss_pred ------------------------------------------------------------------EEeccceEEEEEEc
Confidence 33355789999999
Q ss_pred CCceeeeeecccCCCCHHHHHHHHHHHHhhhhcCCCCccccCCCceeeecCCCCCCcceeeeecCCceeEEEecceeEEe
Q psy6394 916 KHGLVVPNIKSVNKLSLLDITRELLRIQGCSHEGKVLPRDIQGGTISMSNVGNVGGTLVQPIIVPRQVCIVAFGKIQLLP 995 (1045)
Q Consensus 916 ~~GL~vPvi~~a~~~sl~~ia~~~~~l~~~a~~g~l~~~d~~ggTftiSNlG~~g~~~~~~iin~pq~ail~vG~i~~~p 995 (1045)
++||+||||||||+||+.||++++++|++++|+|+|+++||+||||||||+||+|+++|+|||||||+||||+|+++++|
T Consensus 104 ~~GL~vPvI~~a~~~sl~eia~~~~~l~~~ar~~~L~~~d~~ggTfTISNlG~~g~~~~tpii~ppq~aIl~vG~i~~~p 183 (233)
T d1scza_ 104 PRGLVTPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRP 183 (233)
T ss_dssp TTEEECCEETTGGGCCHHHHHHHHHHHHHHTTTTCCCHHHHSCCSEEEEEGGGGTCCCCCCCCCTTCSEEEEEEEEEEEE
T ss_pred CCCeEEeEeeccccCCHHHHHHHHHHHHHHhhcCCCCHHHhCCCcEEEEcCccccceeeeeecCCCCceEEecccceeec
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EEecCceEEEEEEEEeeecccccccChHHHHHHHHHHHHhhcCcchhccC
Q psy6394 996 RFDAEMRVVAKCILNVTWAADHRVVDGATVARAATLWKSLVENPALLLTQ 1045 (1045)
Q Consensus 996 v~~~~~~~~~~~~m~ltls~DHRviDG~~aa~fl~~~k~~le~P~~ll~~ 1045 (1045)
++.+| ++++|++|+||||||||+|||++||+||++|+++||||+.||+|
T Consensus 184 v~~~g-~i~~r~~~~lsls~DHRviDGa~aa~Fl~~l~~~lE~P~~lll~ 232 (233)
T d1scza_ 184 MAVNG-QVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLD 232 (233)
T ss_dssp EEETT-EEEEEEEEEEEEEEETTTCCHHHHHHHHHHHHHHHHCTTHHHHT
T ss_pred cccCC-eEEEEEEeEEEEEhhcchhccHHHHHHHHHHHHHHhCHHHHhhC
Confidence 99876 89999999999999999999999999999999999999999986
|
| >d1dpba_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1b5sa_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1dpba_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1b5sa_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1scza_ c.43.1.1 (A:) Dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q23a_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3claa_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q23a_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3claa_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1w85i_ a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d2cyua1 a.9.1.1 (A:2-40) E3-binding domain of dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w85i_ a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cyua1 a.9.1.1 (A:2-40) E3-binding domain of dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1onla_ b.84.1.1 (A:) Protein H of glycine cleavage system {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1hpca_ b.84.1.1 (A:) Protein H of glycine cleavage system {Pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1onla_ b.84.1.1 (A:) Protein H of glycine cleavage system {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1hpca_ b.84.1.1 (A:) Protein H of glycine cleavage system {Pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|