Psyllid ID: psy6394


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040-----
MANVLSVSRSLRSICKTGFLFGEIHRKVSNVTTDSHSNNETVEITVSITATLPFSESEDLLFSKDGTLNEVLLDTILGEFKADVVGWYSFTRNQDLSQSLCQLFLAHHFSNYFSHIPKQLFLFFRISTNVVFEENFTYTNKFLCTTGSDSLSRKFSSSLQLRHGLHLSTPPLQCHHHLHTSCIRHKLIQFKLADIGEGIREVNIKEWNGNVTEGARINEFDVVCEVESDKASVTITSRYKGTVRKVYYGEGDVALVGKPLLDIEVEDEGVAAEEADSLDRKAAPGVSEVNTPDTSDQPNETLHKEPNKVNREPIAHKPDVTPDLSRDSAVSHLNQPVNLNKNKWKILATPSVRRMIKHYEIDTKELRGTGKQGRVLKEDIITYMNSPIDETNLAHTAHVREASNVISIRGYVKGMFKSMTEAHGHHLSTPPLQCHHHLHTSCIRHKLIQFNLADIGEGIREVNIKEWNGNVTEGARINEFDVVCEVESDKASVTITSRYKGTVRKVYYGEGDVALVGKPLLDIEVEDEGVAAEEADSLDRKAAPGVSEVNTPDTSDQPNETLHKDPNKIDTKELRGTGKQGRVLKEDIITYMNSPSDETNPAHTAHVREASNVISIRGYVKGMFKSMTEANTIPSLRLTEEVDTTQLRDVKKEDIITYMNSPSDETNPAHTAHVREASNVIPIRGYVKGMFKSMTEANTIPSLRLTEEVDTTQLRDVKNQVSALYQEKFRLKLTYMPFFIKALSLCMTEHPILNASIDPTQENILVNPDHNISIAIDTKHGLVVPNIKSVNKLCLLDITRELLRIQGCSHEGKVLPRDIQGGTISMSNVGNVGGTLVQPIIVPGQVCIVAFGKIQLLPRFDAEMRIVAKCILNVTWAADHRVVDGATVARAATLWKSLENILVNPDHNISIAIDTKHGLVVPNIKSVNKLSLLDITRELLRIQGCSHEGKVLPRDIQGGTISMSNVGNVGGTLVQPIIVPRQVCIVAFGKIQLLPRFDAEMRVVAKCILNVTWAADHRVVDGATVARAATLWKSLVENPALLLTQ
cccccHHHHHHHHHHHccccccccccccccccccccccccEEEEEEEEEEEEccccccccEEcccccHHHHHHHHHHccccccEEEEEEEcccHHHHHHHHHHHHHHHHccccccccccEEEEEEEEccEEHHHcccccccEEEEcccccccccccccHHccccccccccccccccccccccccccEEEEEcccccccccEEEEEEEEEccccccEEcccccEEEEEcccEEEEEcccccEEEEEEEEccccEEEcccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccHHHHHHHccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccEEEEEccccccccEEEEEEEEcccccccEEcccccEEEEEEccccEEEccccccEEEEEEEccccEEEcccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccHHHHHHHHHHHccccccEEEEEEEEcHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccEEEccccccEEEcccEEEEEEEcccccEEcccccccccccHHHHHHHHHHHHHHHHcccccccccccccEEEEcccccccccccccccccccEEEEcccEEEEEEEEccccEEEEcccccccccccccccHHHHHHHHccccccccccccccEEEEEEEEccccEEEccccccccccHHHHHHHHHHHHHHHHcccccccccccccEEEEcccccccccccccccccccEEEEcccEEEEEEEEccccEEEEcEEEEccccccccccHHHHHHHHHHHHHHHccccHHccc
cccEEEEHHHHHHHHHccccEcHEEEEEcccccccccccccEEEEEEcccccHHEEcccccEcccccHHHHHHHHHHHcccccEEEEEEEEEccccccHHHHHHHHHHccccccccccccEEEEEEEcccEEccccccccccccccccccccccccccHHHHccccccccccccccccccccccccEEEEEcccccccccHEEEEHEEEEccccccEcccccEEEEEcccEEEEEccccccEEEEEEEccccEEEcccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccHHHHHHHHHccccHHcccccccccEEEHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccEEcccccHHHHcccEEEEEcccccccccHHHHHHHHHcccccccccccccEEEEEccEEEEEEccccccEEEEEEEccccEEEccEEEEEEEccccccccccccccccccccccccccccccccccHHHHHHHHccccHHccccccccccccHHHHHHHHHccccccccccHHHHHHHHcccccHHcccccccccccHHccccccHHHcccccccccccHccHHHHcccccccccccccccccccccEcccHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcHHHcEEEccccccEEEcccccEEEcEEEccEEEccEEccHHHccHHHHHHHHHHHHHHHHcccccHHHHccccEEEEEccccccccccccccccccEEEEEcccEEEEEEccccEEEEEcHEEEEEccccEEEcHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccccEEEEEccccHHHHHHHHHHHHHHHHHHHcccccHHHHcccEEEEEccccccccccccccccHHHEEEEHcHcccccEEccccEEEEEcHEEEEEccccEEEcHHHHHHHHHHHHHHHHcHHHHHcc
MANVLSVSRSLRSICKTGFLFGEIHRKvsnvttdshsnnetVEITVSITatlpfsesedllfskdgtLNEVLLDTILGEFKADVVGWYSFTRNQDLSQSLCQLFLAHHfsnyfshipkQLFLFFRIstnvvfeenftYTNKflcttgsdslsrkfssslqlrhglhlstpplqchhhlhtSCIRHKLIQFKLADIGEGIREVNikewngnvtegarinEFDVVCevesdkasvtITSRYKGTVRKVyygegdvalvgkplldievedegvaaeeadsldrkaapgvsevntpdtsdqpnetlhkepnkvnrepiahkpdvtpdlsrdsavshlnqpvnlnknkwkilaTPSVRRMIKHYEIDtkelrgtgkqgrVLKEDIITYmnspidetnlahtAHVREASNVISIRGYVKGMFKSMteahghhlstpplqchhhlhtSCIRHKLIQFNLADIGEGIREVNikewngnvtegarinEFDVVCevesdkasvtITSRYKGTVRKVyygegdvalvgkplldievedegvaaeeadsldrkaapgvsevntpdtsdqpnetlhkdpnkidtkelrgtgkqgrVLKEDIITymnspsdetnpahtahVREASNVISIRGYVKGMFKsmteantipslrlteevdttqlrdvkkEDIItymnspsdetnpahtahvreasnvipirgYVKGMFKsmteantipslrlteevdttqLRDVKNQVSALYQEKFRLKLTYMPFFIKALSLCmtehpilnasidptqenilvnpdhnisiaidtkhglvvpniksvNKLCLLDITRELLRIQgcshegkvlprdiqggtismsnvgnvggtlvqpiivPGQVCIVAFgkiqllprfDAEMRIVAKCILNVtwaadhrvvdgATVARAATLWKSLENilvnpdhnisiaidtkhglvvpniksvnklSLLDITRELLRIQgcshegkvlprdiqggtismsnvgnvggtlvqpiiVPRQVCIVAFgkiqllprfDAEMRVVAKCILNVTwaadhrvvdgATVARAATLWKSLVEnpallltq
manvlsvsrslrsicKTGFLFGEIHRKvsnvttdshsnnetVEITVSITATLPFSESEDLLFSKDGTLNEVLLDTILGEFKADVVGWYSFTRNQDLSQSLCQLFLAHHFSNYFSHIPKQLFLFFRISTNVVFEENFTYTNKFLCTTGSDSLSRKFSSSLQLRHGLHLSTPPLQCHHHLHTSCIRHKLIQFKLADIGEGIREVnikewngnvtegariNEFDvvcevesdkasvtitsrykgtvrkVYYGEGDVALVGKPLLDIEVEDEGVAaeeadsldrkaapgvsevntpdtsdqpnetlhkepnkvnrepiaHKPDVTPDLSRDSAVShlnqpvnlnknkwkilatpsVRRMIKHyeidtkelrgtgkqgrvLKEDIITYMNSPIDETNLAHTAHVREASNVISIRGYVKGMFKSMTEAHGHHLSTPPLQCHHHLHTSCIRHKLIQFNLADIGEGIREVNIKEWNGNVTEGARINEFDvvcevesdkasvtitsrykgtvrkVYYGEGDVALVGKPLLDIEVEDEGVAaeeadsldrkaapgvsevntpdtsdqpnetlhkdpnkidtkelrgtgkqgrvLKEDIITYMNSPSDETNPAHTAHVREASNVISIRGYVKGMFKSMTeantipslrlteevdttqlrdvkkeDIITYmnspsdetnpahtahvreasnvIPIRGYVKGMFKSMTeantipslrlteevdttqlrdvkNQVSALYQEKFRLKLTYMPFFIKALSLCMTEHPILNASIDPTQENILVNPDHNISIAIDTKHGLVVPNIKSVNKLCLLDITRELLRIQGCSHEGKVLPRDIQGGTISMSNVGNVGGTLVQPIIVPGQVCIVAFGKIQLLPRFDAEMRIVAKCILNVTWAADHRVVDGATVARAATLWKSLENILVNPDHNISIAIdtkhglvvpnIKSVNKLSLLDITRELLRIQGCSHEGKVLPRDIQGGTISMSNVGNVGGTLVQPIIVPRQVCIVAFGKIQLLPRFDAEMRVVAKCILNVtwaadhrvVDGATVARAATLWKslvenpallltq
MANVLSVSRSLRSICKTGFLFGEIHRKVSNVTTDSHSNNETVEITVSITATLPFSESEDLLFSKDGTLNEVLLDTILGEFKADVVGWYSFTRNQDLSQSLCQLFLAHHFSNYFSHIPKQLFLFFRISTNVVFEENFTYTNKFLCTTGsdslsrkfssslqlRHGLHLSTPPLQCHHHLHTSCIRHKLIQFKLADIGEGIREVNIKEWNGNVTEGARINEFDVVCEVESDKASVTITSRYKGTVRKVYYGEGDVALVGKPLLDIevedegvaaeeadSLDRKAAPGVSEVNTPDTSDQPNETLHKEPNKVNREPIAHKPDVTPDLSRDSAVSHLNQPVNLNKNKWKILATPSVRRMIKHYEIDTKELRGTGKQGRVLKEDIITYMNSPIDETNLAHTAHVREASNVISIRGYVKGMFKSMTEAHGHHLSTPPLQCHHHLHTSCIRHKLIQFNLADIGEGIREVNIKEWNGNVTEGARINEFDVVCEVESDKASVTITSRYKGTVRKVYYGEGDVALVGKPLLDIevedegvaaeeadSLDRKAAPGVSEVNTPDTSDQPNETLHKDPNKIDTKELRGTGKQGRVLKEDIITYMNSPSDETNPAHTAHVREASNVISIRGYVKGMFKSMTEANTIPSLRLTEEVDTTQLRDVKKEDIITYMNSPSDETNPAHTAHVREASNVIPIRGYVKGMFKSMTEANTIPSLRLTEEVDTTQLRDVKNQVSALYQEKFRLKLTYMPFFIKALSLCMTEHPILNASIDPTQENILVNPDHNISIAIDTKHGLVVPNIKSVNKLCLLDITRELLRIQGCSHEGKVLPRDIQGGTISMSNVGNVGGTLVQPIIVPGQVCIVAFGKIQLLPRFDAEMRIVAKCILNVTWAADHRVVDGATVARAATLWKSLENILVNPDHNISIAIDTKHGLVVPNIKSVNKLSLLDITRELLRIQGCSHEGKVLPRDIQGGTISMSNVGNVGGTLVQPIIVPRQVCIVAFGKIQLLPRFDAEMRVVAKCILNVTWAADHRVVDGATVARAATLWKSLVENPALLLTQ
**********LRSICKTGFLFGEIHRKVSNVTT*****NETVEITVSITATLPFSESEDLLFSKDGTLNEVLLDTILGEFKADVVGWYSFTRNQDLSQSLCQLFLAHHFSNYFSHIPKQLFLFFRISTNVVFEENFTYTNKFLCTTGSDSL***F**SLQLRHGLHLSTPPLQCHHHLHTSCIRHKLIQFKLADIGEGIREVNIKEWNGNVTEGARINEFDVVCEVESDKASVTITSRYKGTVRKVYYGEGDVALVGKPLLDIEV***********************************************************************VNLNKNKWKILATPSVRRMIKHYEIDTKELRGTGKQGRVLKEDIITYMNSPIDETNLAHTAHVREASNVISIRGYVKGMFKSMTEAHGHHLSTPPLQCHHHLHTSCIRHKLIQFNLADIGEGIREVNIKEWNGNVTEGARINEFDVVCEVESDKASVTITSRYKGTVRKVYYGEGDVALVGKPLLDIEV**************************************************************IIT*******************ASNVISIRGYVKGMFKSMTEANTIPSLRLT**************DIITY******************ASNVIPIRGYVKGMFKSMTEANTIPSLRLTEEVDTTQLRDVKNQVSALYQEKFRLKLTYMPFFIKALSLCMTEHPILNASIDPTQENILVNPDHNISIAIDTKHGLVVPNIKSVNKLCLLDITRELLRIQGCSHEGKVLPRDIQGGTISMSNVGNVGGTLVQPIIVPGQVCIVAFGKIQLLPRFDAEMRIVAKCILNVTWAADHRVVDGATVARAATLWKSLENILVNPDHNISIAIDTKHGLVVPNIKSVNKLSLLDITRELLRIQGCSHEGKVLPRDIQGGTISMSNVGNVGGTLVQPIIVPRQVCIVAFGKIQLLPRFDAEMRVVAKCILNVTWAADHRVVDGATVARAATLWKSLVENPALL***
********RSLRSICKTGFLFGEIHRKVSN*T***HSNNETVEITVSITATLPFSESEDLLFSKDGTLNEVLLDTILGEFKADVVGWYSFTRNQDLSQSLCQLFLAHHFSNYFSHIPKQLFLFFRISTNVVFEENFTYTNKFLCTTG******************************************FKLADIGEGIREVNIKEWNGNVTEGARINEFDVVCEVESDKASVTITSRYKGTVRKVYYGEGDVALVGKPLLDIEV*********************************************************************************LATPSVRRMIKHYEIDTKELRGTGKQGRVLKEDII************************************************PPLQCHHHLHTSCIRHKLIQFNLADIGEGIREVNIKEWNGNVTEGARINEFDVVCEVESDKASVTITSRYKGTVRKVYYGEGDVALVGKPLLDI****************************************************************************************************************************************************************RGYVKGMFKSMTEANTIPSLRLTEEVDTTQLRDVKNQVSA*YQEKFRLKLTYMPFFIKALSLCMTEHPILNASIDPTQENILVNPDHNISIAIDTKHGLVVPNIKSVNKLCLLDITRELLRIQGCSHEGKVLPRDIQGGTISMSNVGNVGGTLVQPIIVPGQVCIVAFGKIQLLPRFDAEMRIVAKCILNVTWAADHRVVDGATVARAATLWKSLENILVNPDHNISIAIDTKHGLVVPNIKSVNKLSLLDITRELLRIQGCSHE*KVLPRDIQGGTISMSNVGNVGGTLVQPIIVPRQVCIVAFGKIQLLPRFDAEMRVVAKCILNVTWAADHRVVDGATVARAATLWKSLVENPALLLTQ
********RSLRSICKTGFLFGEIHRKVSNVTTDSHSNNETVEITVSITATLPFSESEDLLFSKDGTLNEVLLDTILGEFKADVVGWYSFTRNQDLSQSLCQLFLAHHFSNYFSHIPKQLFLFFRISTNVVFEENFTYTNKFLCTTGSDSLSRKFSSSLQLRHGLHLSTPPLQCHHHLHTSCIRHKLIQFKLADIGEGIREVNIKEWNGNVTEGARINEFDVVCEVESDKASVTITSRYKGTVRKVYYGEGDVALVGKPLLDIEVEDEG**********************************KEPNKVNREPIAHKPDVTPDLSRDSAVSHLNQPVNLNKNKWKILATPSVRRMIKHYEIDTKELRGTGKQGRVLKEDIITYMNSPIDETNLAHTAHVREASNVISIRGYVKGMFKSMTEAHGHHLSTPPLQCHHHLHTSCIRHKLIQFNLADIGEGIREVNIKEWNGNVTEGARINEFDVVCEVESDKASVTITSRYKGTVRKVYYGEGDVALVGKPLLDIEVEDEG********************************LHKDPNKIDTKELRGTGKQGRVLKEDIITYMNSPSDETNPAHTAHVREASNVISIRGYVKGMFKSMTEANTIPSLRLTEEVDTTQLRDVKKEDIITYMNSPSDETNPAHTAHVREASNVIPIRGYVKGMFKSMTEANTIPSLRLTEEVDTTQLRDVKNQVSALYQEKFRLKLTYMPFFIKALSLCMTEHPILNASIDPTQENILVNPDHNISIAIDTKHGLVVPNIKSVNKLCLLDITRELLRIQGCSHEGKVLPRDIQGGTISMSNVGNVGGTLVQPIIVPGQVCIVAFGKIQLLPRFDAEMRIVAKCILNVTWAADHRVVDGATVARAATLWKSLENILVNPDHNISIAIDTKHGLVVPNIKSVNKLSLLDITRELLRIQGCSHEGKVLPRDIQGGTISMSNVGNVGGTLVQPIIVPRQVCIVAFGKIQLLPRFDAEMRVVAKCILNVTWAADHRVVDGATVARAATLWKSLVENPALLLTQ
**NVLSVSRSLRSICKTGFLFGEIHRKVSNVTTDS*SNNETVEITVSITATLPFSESEDLLFSKDGTLNEVLLDTILGEFKADVVGWYSFTRNQDLSQSLCQLFLAHHFSNYFSHIPKQLFLFFRISTNVVFEE**************************************************HKLIQFKLADIGEGIREVNIKEWNGNVTEGARINEFDVVCEVESDKASVTITSRYKGTVRKVYYGEGDVALVGKPLLDIEVE**********************************************************************************TP*VRR****YEIDTKELRGTGKQGRVLKEDIITYMNS**************************KG************LSTPPLQCHHHLHTSCIRHKLIQFNLADIGEGIREVNIKEWNGNVTEGARINEFDVVCEVESDKASVTITSRYKGTVRKVYYGEGDVALVGKPLLDIEVED*******************************************************************************************************************************************************NVIPIRGYVKGMFKSMTEANTIPSLRLTEEVDTTQLRDVKNQVSALYQEKFRLKLTYMPFFIKALSLCMTEHPILNASIDPTQENILVNPDHNISIAIDTKHGLVVPNIKSVNKLCLLDITRELLRIQGCSHEGKVLPRDIQGGTISMSNVGNVGGTLVQPIIVPGQVCIVAFGKIQLLPRFDAEMRIVAKCILNVTWAADHRVVDGATVARAATLWKSLENILVNPDHNISIAIDTKHGLVVPNIKSVNKLSLLDITRELLRIQGCSHEGKVLPRDIQGGTISMSNVGNVGGTLVQPIIVPRQVCIVAFGKIQLLPRFDAEMRVVAKCILNVTWAADHRVVDGATVARAATLWKSLVENPALLLTQ
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANVLSVSRSLRSICKTGFLFGEIHRKVSNVTTDSHSNNETVEITVSITATLPFSESEDLLFSKDGTLNEVLLDTILGEFKADVVGWYSFTRNQDLSQSLCQLFLAHHFSNYFSHIPKQLFLFFRISTNVVFEENFTYTNKFLCTTGSDSLSRKFSSSLQLRHGLHLSTPPLQCHHHLHTSCIRHKLIQFKLADIGEGIREVNIKEWNGNVTEGARINEFDVVCEVESDKASVTITSRYKGTVRKVYYGEGDVALVGKPLLDIEVEDEGVAAEEADSLDRKAAPGVSEVNTPDTSDQPNETLHKEPNKVNREPIAHKPDVTPDLSRDSAVSHLNQPVNLNKNKWKILATPSVRRMIKHYEIDTKELRGTGKQGRVLKEDIITYMNSPIDETNLAHTAHVREASNVISIRGYVKGMFKSMTEAHGHHLSTPPLQCHHHLHTSCIRHKLIQFNLADIGEGIREVNIKEWNGNVTEGARINEFDVVCEVESDKASVTITSRYKGTVRKVYYGEGDVALVGKPLLDIEVEDEGVAAEEADSLDRKAAPGVSEVNTPDTSDQPNETLHKDPNKIDTKELRGTGKQGRVLKEDIITYMNSPSDETNPAHTAHVREASNVISIRGYVKGMFKSMTEANTIPSLRLTEEVDTTQLRDVKKEDIITYMNSPSDETNPAHTAHVREASNVIPIRGYVKGMFKSMTEANTIPSLRLTEEVDTTQLRDVKNQVSALYQEKFRLKLTYMPFFIKALSLCMTEHPILNASIDPTQENILVNPDHNISIAIDTKHGLVVPNIKSVNKLCLLDITRELLRIQGCSHEGKVLPRDIQGGTISMSNVGNVGGTLVQPIIVPGQVCIVAFGKIQLLPRFDAEMRIVAKCILNVTWAADHRVVDGATVARAATLWKSLENILVNPDHNISIAIDTKHGLVVPNIKSVNKLSLLDITRELLRIQGCSHEGKVLPRDIQGGTISMSNVGNVGGTLVQPIIVPRQVCIVAFGKIQLLPRFDAEMRVVAKCILNVTWAADHRVVDGATVARAATLWKSLVENPALLLTQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1045 2.2.26 [Sep-21-2011]
P11182482 Lipoamide acyltransferase yes N/A 0.395 0.856 0.384 6e-84
P53395482 Lipoamide acyltransferase yes N/A 0.395 0.856 0.379 5e-83
P11181482 Lipoamide acyltransferase yes N/A 0.426 0.925 0.359 1e-82
Q23571448 Lipoamide acyltransferase yes N/A 0.388 0.906 0.372 1e-80
Q8NX76430 Dihydrolipoyllysine-resid yes N/A 0.382 0.930 0.293 9e-39
Q6GAB9430 Dihydrolipoyllysine-resid yes N/A 0.382 0.930 0.293 9e-39
Q5HGY9430 Dihydrolipoyllysine-resid yes N/A 0.382 0.930 0.293 9e-39
P65636430 Dihydrolipoyllysine-resid yes N/A 0.382 0.930 0.293 9e-39
P65635430 Dihydrolipoyllysine-resid yes N/A 0.382 0.930 0.293 9e-39
Q5HQ74433 Dihydrolipoyllysine-resid yes N/A 0.381 0.921 0.282 1e-38
>sp|P11182|ODB2_HUMAN Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Homo sapiens GN=DBT PE=1 SV=3 Back     alignment and function desciption
 Score =  313 bits (801), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 183/476 (38%), Positives = 270/476 (56%), Gaps = 63/476 (13%)

Query: 435 HHHLHT-SCIRHKLIQFNLADIGEGIREVNIKEWNGNVTEGARINEFDVVCEVESDKASV 493
           HH L T + +R +++QF L+DIGEGIREV +KEW   V EG  +++FD +CEV+SDKASV
Sbjct: 51  HHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEWY--VKEGDTVSQFDSICEVQSDKASV 108

Query: 494 TITSRYKGTVRKVYYGEGDVALVGKPLLDIEVEDEGVAAEEADSLDRKAAPGVS------ 547
           TITSRY G ++K+YY   D+A VGKPL+DIE E   +   E D ++    P VS      
Sbjct: 109 TITSRYDGVIKKLYYNLDDIAYVGKPLVDIETE--ALKDSEEDVVE---TPAVSHDEHTH 163

Query: 548 -EVNTPDTSDQPNETLHKDPNKIDTKELRGTGKQGRVLKEDIITYMNSPSDETNPAHTAH 606
            E+    T   P        N I   E+ G+GK GR+LKEDI+ Y+              
Sbjct: 164 QEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLE------------- 210

Query: 607 VREASNVISIRGYVKGMFKSMTEAN-TIPSLRLTEEVDTTQLRDVKKEDIITYMNSPSDE 665
            ++   ++     V+ M       + T+P L             V K  + T      D+
Sbjct: 211 -KQTGAILPPSPKVEIMPPPPKPKDMTVPIL-------------VSKPPVFT----GKDK 252

Query: 666 TNPAHTAHVREASNVIPIRGYVKGMFKSMTEANTIPSLRLTEEVDTTQLRDVKNQVSALY 725
           T P              I+G+ K M K+M+ A  IP     +E+D T+L  ++ ++  + 
Sbjct: 253 TEP--------------IKGFQKAMVKTMSAALKIPHFGYCDEIDLTELVKLREELKPIA 298

Query: 726 QEKFRLKLTYMPFFIKALSLCMTEHPILNASIDPTQENILVNPDHNISIAIDTKHGLVVP 785
             +  +KL++MPFF+KA SL + + PILNAS+D   +NI     HNI IA+DT+ GL+VP
Sbjct: 299 FAR-GIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVP 357

Query: 786 NIKSVNKLCLLDITRELLRIQGCSHEGKVLPRDIQGGTISMSNVGNVGGTLVQPIIVPGQ 845
           N+K+V    + DI  EL R+Q     G++   D+ GGT ++SN+G++GGT  +P+I+P +
Sbjct: 358 NVKNVQICSIFDIATELNRLQKLGSVGQLSTTDLTGGTFTLSNIGSIGGTFAKPVIMPPE 417

Query: 846 VCIVAFGKIQLLPRFDAEMRIVAKCILNVTWAADHRVVDGATVARAATLWKS-LEN 900
           V I A G I+ +PRF+ +  +    I+NV+W+ADHRV+DGAT++R + LWKS LEN
Sbjct: 418 VAIGALGSIKAIPRFNQKGEVYKAQIMNVSWSADHRVIDGATMSRFSNLWKSYLEN 473




The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO(2). It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).
Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: 1EC: 6EC: 8
>sp|P53395|ODB2_MOUSE Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Mus musculus GN=Dbt PE=2 SV=2 Back     alignment and function description
>sp|P11181|ODB2_BOVIN Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Bos taurus GN=DBT PE=1 SV=2 Back     alignment and function description
>sp|Q23571|ODB2_CAEEL Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Caenorhabditis elegans GN=ZK669.4 PE=3 SV=1 Back     alignment and function description
>sp|Q8NX76|ODP2_STAAW Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus (strain MW2) GN=pdhC PE=3 SV=1 Back     alignment and function description
>sp|Q6GAB9|ODP2_STAAS Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus (strain MSSA476) GN=pdhC PE=3 SV=1 Back     alignment and function description
>sp|Q5HGY9|ODP2_STAAC Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus (strain COL) GN=pdhC PE=3 SV=1 Back     alignment and function description
>sp|P65636|ODP2_STAAN Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus (strain N315) GN=pdhC PE=1 SV=1 Back     alignment and function description
>sp|P65635|ODP2_STAAM Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pdhC PE=1 SV=1 Back     alignment and function description
>sp|Q5HQ74|ODP2_STAEQ Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=pdhC PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1045
224057323493 PREDICTED: lipoamide acyltransferase com 0.395 0.837 0.392 1e-84
326925002674 PREDICTED: lipoamide acyltransferase com 0.433 0.672 0.366 1e-83
432853434498 PREDICTED: lipoamide acyltransferase com 0.409 0.859 0.395 1e-82
449268114474 hypothetical protein A306_13406, partial 0.425 0.938 0.369 1e-82
355682807473 dihydrolipoamide branched chain transacy 0.388 0.858 0.383 2e-82
397474090482 PREDICTED: lipoamide acyltransferase com 0.395 0.856 0.384 4e-82
392494079482 lipoamide acyltransferase component of b 0.395 0.856 0.384 4e-82
426330491482 PREDICTED: lipoamide acyltransferase com 0.396 0.858 0.387 5e-82
45382815493 lipoamide acyltransferase component of b 0.430 0.912 0.364 6e-82
179354477 branched chain acyltransferase precursor 0.396 0.867 0.387 6e-82
>gi|224057323|ref|XP_002188172.1| PREDICTED: lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial [Taeniopygia guttata] Back     alignment and taxonomy information
 Score =  322 bits (824), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 182/464 (39%), Positives = 266/464 (57%), Gaps = 51/464 (10%)

Query: 446 KLIQFNLADIGEGIREVNIKEWNGNVTEGARINEFDVVCEVESDKASVTITSRYKGTVRK 505
           +++QF L+DIGEGI EV +KEW   + EG  +++FD +CEV+SDKASVTITSRY G +RK
Sbjct: 63  QIVQFKLSDIGEGITEVTVKEWY--IKEGDSVSQFDSICEVQSDKASVTITSRYDGVIRK 120

Query: 506 VYYGEGDVALVGKPLLDIEVE-DEGVAAEEADSLDRKAAPGVS-------EVNTPDTSDQ 557
           ++Y   D A VGKPL+DIE++  +GVA+EE    D    P VS       E+    T   
Sbjct: 121 LHYSIDDTAFVGKPLVDIEIDASKGVASEE----DVVETPPVSHEEHTHQEIKGHKTLAT 176

Query: 558 PNETLHKDPNKIDTKELRGTGKQGRVLKEDIITYMNSPSDETNPAHTAHVREASNVISIR 617
           P        N I   E+ GTGK  R+LKEDI+ Y+   +    P                
Sbjct: 177 PAVRRLAMENNIKLSEVVGTGKDNRILKEDILNYLAKQTGAILPLSP------------- 223

Query: 618 GYVKGMFKSMTEANTIPSLRLTEEVDTTQLRDVKKEDIITYMNSPSDETNPAHTAHVREA 677
                      +A  +P  R  E V        +K         P   + P   +   E 
Sbjct: 224 -----------KAEIVPPQRKAEAVPAAPKDKARK--------IPVPVSRPLAFS---EK 261

Query: 678 SNVIPIRGYVKGMFKSMTEANTIPSLRLTEEVDTTQLRDVKNQVSALYQEKFRLKLTYMP 737
               P+ G+ K M K+M+ A  IP    ++E+D TQL  ++ ++  L + +  +KL++MP
Sbjct: 262 DKTEPVTGFQKAMVKTMSAALKIPHFGYSDEIDLTQLVQLREELKPLAEIR-GVKLSFMP 320

Query: 738 FFIKALSLCMTEHPILNASIDPTQENILVNPDHNISIAIDTKHGLVVPNIKSVNKLCLLD 797
           FFIKA SL + ++PILNAS+D   +N+     HNI +A+DT+ GL+VPN+K+V    + D
Sbjct: 321 FFIKAASLGLLQYPILNASLDENCQNVTYKASHNIGVAMDTEQGLIVPNVKNVQVCSVFD 380

Query: 798 ITRELLRIQGCSHEGKVLPRDIQGGTISMSNVGNVGGTLVQPIIVPGQVCIVAFGKIQLL 857
           I  EL R+Q     G++   D+ GGT ++SN+G +GGT  +P+I+P +V I A GKIQ+L
Sbjct: 381 IAVELNRLQSLGSAGQLGTSDLTGGTFTLSNIGTIGGTYAKPVILPPEVAIGALGKIQVL 440

Query: 858 PRFDAEMRIVAKCILNVTWAADHRVVDGATVARAATLWKS-LEN 900
           PRF+++  ++   I+NV+W+ADHR++DGAT+AR + LWKS LEN
Sbjct: 441 PRFNSKGEVIKAQIMNVSWSADHRIIDGATMARFSNLWKSYLEN 484




Source: Taeniopygia guttata

Species: Taeniopygia guttata

Genus: Taeniopygia

Family: Estrildidae

Order: Passeriformes

Class: Aves

Phylum: Chordata

Superkingdom: Eukaryota

>gi|326925002|ref|XP_003208711.1| PREDICTED: lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial-like [Meleagris gallopavo] Back     alignment and taxonomy information
>gi|432853434|ref|XP_004067705.1| PREDICTED: lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|449268114|gb|EMC78984.1| hypothetical protein A306_13406, partial [Columba livia] Back     alignment and taxonomy information
>gi|355682807|gb|AER96987.1| dihydrolipoamide branched chain transacylase E2 [Mustela putorius furo] Back     alignment and taxonomy information
>gi|397474090|ref|XP_003808523.1| PREDICTED: lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial [Pan paniscus] gi|410254896|gb|JAA15415.1| dihydrolipoamide branched chain transacylase E2 [Pan troglodytes] gi|410254898|gb|JAA15416.1| dihydrolipoamide branched chain transacylase E2 [Pan troglodytes] gi|410254900|gb|JAA15417.1| dihydrolipoamide branched chain transacylase E2 [Pan troglodytes] gi|410293998|gb|JAA25599.1| dihydrolipoamide branched chain transacylase E2 [Pan troglodytes] gi|410294000|gb|JAA25600.1| dihydrolipoamide branched chain transacylase E2 [Pan troglodytes] Back     alignment and taxonomy information
>gi|392494079|ref|NP_001909.3| lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial precursor [Homo sapiens] gi|400668|sp|P11182.3|ODB2_HUMAN RecName: Full=Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial; AltName: Full=Branched-chain alpha-keto acid dehydrogenase complex component E2; Short=BCKAD-E2; Short=BCKADE2; AltName: Full=Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto acid dehydrogenase complex; AltName: Full=Dihydrolipoamide branched chain transacylase; AltName: Full=Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase; Flags: Precursor gi|30490|emb|CAA47285.1| transacylase [Homo sapiens] gi|16741763|gb|AAH16675.1| Dihydrolipoamide branched chain transacylase E2 [Homo sapiens] gi|30583583|gb|AAP36036.1| dihydrolipoamide branched chain transacylase (E2 component of branched chain keto acid dehydrogenase complex; maple syrup urine disease) [Homo sapiens] gi|61359897|gb|AAX41783.1| dihydrolipoamide branched chain transacylase [synthetic construct] gi|61359903|gb|AAX41784.1| dihydrolipoamide branched chain transacylase [synthetic construct] gi|119593369|gb|EAW72963.1| dihydrolipoamide branched chain transacylase E2 [Homo sapiens] gi|189053756|dbj|BAG36008.1| unnamed protein product [Homo sapiens] Back     alignment and taxonomy information
>gi|426330491|ref|XP_004026244.1| PREDICTED: lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial [Gorilla gorilla gorilla] Back     alignment and taxonomy information
>gi|45382815|ref|NP_989987.1| lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial precursor [Gallus gallus] gi|12964602|dbj|BAB32667.1| branched-chain alpha-keto acid dihydrolipoyl acyltransferase [Gallus gallus] Back     alignment and taxonomy information
>gi|179354|gb|AAA35589.1| branched chain acyltransferase precursor [Homo sapiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1045
UNIPROTKB|P11182482 DBT "Lipoamide acyltransferase 0.208 0.452 0.436 2.5e-86
ZFIN|ZDB-GENE-050320-85493 dbt "dihydrolipoamide branched 0.208 0.442 0.445 7.1e-85
MGI|MGI:105386482 Dbt "dihydrolipoamide branched 0.237 0.514 0.411 8.5e-83
UNIPROTKB|P11181482 DBT "Lipoamide acyltransferase 0.208 0.452 0.436 1.1e-82
UNIPROTKB|F1S563482 DBT "Uncharacterized protein" 0.237 0.514 0.399 1.2e-82
UNIPROTKB|E2RQG4482 DBT "Uncharacterized protein" 0.208 0.452 0.427 3.2e-82
UNIPROTKB|F1P1X9493 DBT "Uncharacterized protein" 0.208 0.442 0.440 1.4e-81
WB|WBGene00014054448 ZK669.4 [Caenorhabditis elegan 0.248 0.580 0.391 1.1e-75
TIGR_CMR|SO_2341535 SO_2341 "alpha keto acid dehyd 0.228 0.446 0.419 6.3e-71
UNIPROTKB|G4MSC5523 MGG_04449 "Branched-chain alph 0.204 0.409 0.388 1.2e-70
UNIPROTKB|P11182 DBT "Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 503 (182.1 bits), Expect = 2.5e-86, Sum P(4) = 2.5e-86
 Identities = 96/220 (43%), Positives = 148/220 (67%)

Query:   682 PIRGYVKGMFKSMTEANTIPSLRLTEEVDTTQLRDVKNQVSALYQEKFRLKLTYMPFFIK 741
             PI+G+ K M K+M+ A  IP     +E+D T+L  ++ ++  +   +  +KL++MPFF+K
Sbjct:   255 PIKGFQKAMVKTMSAALKIPHFGYCDEIDLTELVKLREELKPIAFAR-GIKLSFMPFFLK 313

Query:   742 ALSLCMTEHPILNASIDPTQENILVNPDHNISIAIDTKHGLVVPNIKSVNKLCLLDITRE 801
             A SL + + PILNAS+D   +NI     HNI IA+DT+ GL+VPN+K+V    + DI  E
Sbjct:   314 AASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQICSIFDIATE 373

Query:   802 LLRIQGCSHEGKVLPRDIQGGTISMSNVGNVGGTLVQPIIVPGQVCIVAFGKIQLLPRFD 861
             L R+Q     G++   D+ GGT ++SN+G++GGT  +P+I+P +V I A G I+ +PRF+
Sbjct:   374 LNRLQKLGSVGQLSTTDLTGGTFTLSNIGSIGGTFAKPVIMPPEVAIGALGSIKAIPRFN 433

Query:   862 AEMRIVAKCILNVTWAADHRVVDGATVARAATLWKS-LEN 900
              +  +    I+NV+W+ADHRV+DGAT++R + LWKS LEN
Sbjct:   434 QKGEVYKAQIMNVSWSADHRVIDGATMSRFSNLWKSYLEN 473


GO:0046949 "fatty-acyl-CoA biosynthetic process" evidence=IEA
GO:0048037 "cofactor binding" evidence=IEA
GO:0043754 "dihydrolipoyllysine-residue (2-methylpropanoyl)transferase activity" evidence=IEA
GO:0005947 "mitochondrial alpha-ketoglutarate dehydrogenase complex" evidence=TAS
GO:0005759 "mitochondrial matrix" evidence=TAS
GO:0009083 "branched-chain amino acid catabolic process" evidence=TAS
GO:0034641 "cellular nitrogen compound metabolic process" evidence=TAS
GO:0044281 "small molecule metabolic process" evidence=TAS
GO:0042645 "mitochondrial nucleoid" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0005739 "mitochondrion" evidence=IDA
GO:0015630 "microtubule cytoskeleton" evidence=IDA
ZFIN|ZDB-GENE-050320-85 dbt "dihydrolipoamide branched chain transacylase E2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:105386 Dbt "dihydrolipoamide branched chain transacylase E2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P11181 DBT "Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1S563 DBT "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2RQG4 DBT "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1P1X9 DBT "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
WB|WBGene00014054 ZK669.4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
TIGR_CMR|SO_2341 SO_2341 "alpha keto acid dehydrogenase complex, E2 component" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|G4MSC5 MGG_04449 "Branched-chain alpha-keto acid lipoamide acyltransferase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.3.10.691

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1045
PLN02528416 PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase 1e-107
PRK11855547 PRK11855, PRK11855, dihydrolipoamide acetyltransfe 1e-86
COG0508404 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogena 5e-69
PRK11856411 PRK11856, PRK11856, branched-chain alpha-keto acid 1e-68
pfam00198212 pfam00198, 2-oxoacid_dh, 2-oxoacid dehydrogenases 4e-64
PLN02528416 PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase 8e-51
pfam00198212 pfam00198, 2-oxoacid_dh, 2-oxoacid dehydrogenases 7e-47
PRK11854633 PRK11854, aceF, pyruvate dehydrogenase dihydrolipo 7e-45
PRK11855547 PRK11855, PRK11855, dihydrolipoamide acetyltransfe 4e-43
TIGR01348546 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase 1e-41
PRK11857306 PRK11857, PRK11857, dihydrolipoamide acetyltransfe 2e-37
PLN02528416 PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase 1e-36
TIGR01347403 TIGR01347, sucB, 2-oxoglutarate dehydrogenase comp 3e-36
PRK11856411 PRK11856, PRK11856, branched-chain alpha-keto acid 2e-35
TIGR01349436 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase 5e-33
TIGR02927579 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena 1e-31
PRK11856411 PRK11856, PRK11856, branched-chain alpha-keto acid 4e-31
COG0508404 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogena 1e-30
PRK11855547 PRK11855, PRK11855, dihydrolipoamide acetyltransfe 1e-25
PTZ00144418 PTZ00144, PTZ00144, dihydrolipoamide succinyltrans 8e-25
PRK11857306 PRK11857, PRK11857, dihydrolipoamide acetyltransfe 1e-24
PLN02744539 PLN02744, PLN02744, dihydrolipoyllysine-residue ac 1e-24
COG0508404 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogena 2e-23
PRK11854633 PRK11854, aceF, pyruvate dehydrogenase dihydrolipo 5e-23
PRK05704407 PRK05704, PRK05704, dihydrolipoamide succinyltrans 4e-21
cd0684974 cd06849, lipoyl_domain, Lipoyl domain of the dihyd 1e-20
TIGR01348546 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase 2e-20
cd0684974 cd06849, lipoyl_domain, Lipoyl domain of the dihyd 4e-20
PRK14843347 PRK14843, PRK14843, dihydrolipoamide acetyltransfe 1e-19
TIGR01349436 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase 5e-19
PLN02226463 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E 2e-18
PRK11855547 PRK11855, PRK11855, dihydrolipoamide acetyltransfe 4e-17
PRK11855547 PRK11855, PRK11855, dihydrolipoamide acetyltransfe 3e-16
TIGR02927579 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena 2e-15
PTZ00144418 PTZ00144, PTZ00144, dihydrolipoamide succinyltrans 2e-15
PLN02744539 PLN02744, PLN02744, dihydrolipoyllysine-residue ac 4e-15
pfam0036473 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme 3e-14
pfam0036473 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme 1e-13
TIGR01347403 TIGR01347, sucB, 2-oxoglutarate dehydrogenase comp 3e-13
TIGR01349436 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase 3e-13
TIGR01348546 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase 4e-12
PTZ00144418 PTZ00144, PTZ00144, dihydrolipoamide succinyltrans 4e-12
PRK11854633 PRK11854, aceF, pyruvate dehydrogenase dihydrolipo 1e-11
PTZ00144418 PTZ00144, PTZ00144, dihydrolipoamide succinyltrans 1e-11
PLN02744539 PLN02744, PLN02744, dihydrolipoyllysine-residue ac 2e-11
PLN02226463 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E 3e-11
PRK05704407 PRK05704, PRK05704, dihydrolipoamide succinyltrans 4e-11
TIGR01347403 TIGR01347, sucB, 2-oxoglutarate dehydrogenase comp 8e-11
PRK14843347 PRK14843, PRK14843, dihydrolipoamide acetyltransfe 8e-11
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 6e-10
PRK05704407 PRK05704, PRK05704, dihydrolipoamide succinyltrans 2e-09
PRK11854633 PRK11854, aceF, pyruvate dehydrogenase dihydrolipo 1e-08
PRK11854633 PRK11854, aceF, pyruvate dehydrogenase dihydrolipo 2e-08
TIGR02927579 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena 2e-08
pfam0281739 pfam02817, E3_binding, e3 binding domain 1e-07
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 2e-07
PRK11854633 PRK11854, aceF, pyruvate dehydrogenase dihydrolipo 4e-07
PRK11854633 PRK11854, aceF, pyruvate dehydrogenase dihydrolipo 4e-07
PRK11857306 PRK11857, PRK11857, dihydrolipoamide acetyltransfe 7e-06
PRK14875371 PRK14875, PRK14875, acetoin dehydrogenase E2 subun 3e-05
PRK14875371 PRK14875, PRK14875, acetoin dehydrogenase E2 subun 3e-05
cd0666373 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_ 2e-04
cd0666373 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_ 2e-04
COG0511140 COG0511, AccB, Biotin carboxyl carrier protein [Li 2e-04
COG0511140 COG0511, AccB, Biotin carboxyl carrier protein [Li 2e-04
cd0685067 cd06850, biotinyl_domain, The biotinyl-domain or b 5e-04
cd0685067 cd06850, biotinyl_domain, The biotinyl-domain or b 5e-04
TIGR01348546 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase 6e-04
TIGR027121201 TIGR02712, urea_carbox, urea carboxylase 7e-04
TIGR027121201 TIGR02712, urea_carbox, urea carboxylase 7e-04
pfam0281739 pfam02817, E3_binding, e3 binding domain 0.002
COG4770645 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase 0.002
COG4770645 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase 0.002
>gnl|CDD|215289 PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase E2 component Back     alignment and domain information
 Score =  339 bits (872), Expect = e-107
 Identities = 157/457 (34%), Positives = 229/457 (50%), Gaps = 61/457 (13%)

Query: 450 FNLADIGEGIREVNIKEWNGNVTEGARINEFDVVCEVESDKASVTITSRYKGTVRKVYYG 509
             LA  GEGI E  +  W   V EG ++ EF  +CEV+SDKA++ ITSRYKG V ++ + 
Sbjct: 1   VPLAQTGEGIAECELLRWF--VKEGDQVEEFQPLCEVQSDKATIEITSRYKGKVAQINFS 58

Query: 510 EGDVALVGKPLLDIEVEDEGVAAEEADSLDRKAAPGVSEVNTPDTSDQPNET-------- 561
            GD+  VG+ LL I VED      ++  L   ++  VS   + +     +          
Sbjct: 59  PGDIVKVGETLLKIMVEDSQHLRSDSLLLPTDSSNIVSLAESDERGSNLSGVLSTPAVRH 118

Query: 562 LHKDPNKIDTKELRGTGKQGRVLKEDIITYMNSPSDETNPAHTAHVREASNVISIRGYVK 621
           L K    ID  ++ GTGK GRVLKED++ Y                             K
Sbjct: 119 LAKQ-YGIDLNDILGTGKDGRVLKEDVLKYAAQ--------------------------K 151

Query: 622 GMFKSMTEANTIPSLRLTEEVDTTQLRDVKKEDIITYMNSPSDETNPAHTAHVREASNVI 681
           G+ K  + A         E   +                S  D+T              I
Sbjct: 152 GVVKDSSSAEEATIAEQEEFSTSVSTPT---------EQSYEDKT--------------I 188

Query: 682 PIRGYVKGMFKSMTEANTIPSLRLTEEVDTTQLRDVKNQVSALYQEKFRLKLTYMPFFIK 741
           P+RG+ + M K+MT A  +P     EE++   L ++K            +K T++PF IK
Sbjct: 189 PLRGFQRAMVKTMTAAAKVPHFHYVEEINVDALVELKASFQEN-NTDPTVKHTFLPFLIK 247

Query: 742 ALSLCMTEHPILNASIDPTQENILVNPDHNISIAIDTKHGLVVPNIKSVNKLCLLDITRE 801
           +LS+ ++++P+LN+  +     I +   HNI +A+ T+HGLVVPNIK+V  L LL+IT+E
Sbjct: 248 SLSMALSKYPLLNSCFNEETSEIRLKGSHNIGVAMATEHGLVVPNIKNVQSLSLLEITKE 307

Query: 802 LLRIQGCSHEGKVLPRDIQGGTISMSNVGNVGGTLVQPIIVPGQVCIVAFGKIQLLPRFD 861
           L R+Q  + E K+ P DI GGTI++SN+G +GG    P++   +V I+A G+IQ +PRF 
Sbjct: 308 LSRLQHLAAENKLNPEDITGGTITLSNIGAIGGKFGSPVLNLPEVAIIALGRIQKVPRFV 367

Query: 862 AEMRIVAKCILNVTWAADHRVVDGATVARAATLWKSL 898
            +  +    I+ VT  ADHRV+DGATVAR    WKS 
Sbjct: 368 DDGNVYPASIMTVTIGADHRVLDGATVARFCNEWKSY 404


Length = 416

>gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|223582 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|237001 PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>gnl|CDD|215782 pfam00198, 2-oxoacid_dh, 2-oxoacid dehydrogenases acyltransferase (catalytic domain) Back     alignment and domain information
>gnl|CDD|215289 PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase E2 component Back     alignment and domain information
>gnl|CDD|215782 pfam00198, 2-oxoacid_dh, 2-oxoacid dehydrogenases acyltransferase (catalytic domain) Back     alignment and domain information
>gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|233366 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>gnl|CDD|237002 PRK11857, PRK11857, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|215289 PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase E2 component Back     alignment and domain information
>gnl|CDD|233365 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) Back     alignment and domain information
>gnl|CDD|237001 PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>gnl|CDD|233367 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>gnl|CDD|237001 PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>gnl|CDD|223582 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|237002 PRK11857, PRK11857, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|215397 PLN02744, PLN02744, dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex Back     alignment and domain information
>gnl|CDD|223582 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>gnl|CDD|235571 PRK05704, PRK05704, dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>gnl|CDD|133458 cd06849, lipoyl_domain, Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>gnl|CDD|233366 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>gnl|CDD|133458 cd06849, lipoyl_domain, Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>gnl|CDD|184847 PRK14843, PRK14843, dihydrolipoamide acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|233367 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>gnl|CDD|177871 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E2 component Back     alignment and domain information
>gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|215397 PLN02744, PLN02744, dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex Back     alignment and domain information
>gnl|CDD|201182 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme Back     alignment and domain information
>gnl|CDD|201182 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme Back     alignment and domain information
>gnl|CDD|233365 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) Back     alignment and domain information
>gnl|CDD|233367 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>gnl|CDD|233366 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|215397 PLN02744, PLN02744, dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex Back     alignment and domain information
>gnl|CDD|177871 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E2 component Back     alignment and domain information
>gnl|CDD|235571 PRK05704, PRK05704, dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>gnl|CDD|233365 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) Back     alignment and domain information
>gnl|CDD|184847 PRK14843, PRK14843, dihydrolipoamide acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|235571 PRK05704, PRK05704, dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>gnl|CDD|202412 pfam02817, E3_binding, e3 binding domain Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>gnl|CDD|237002 PRK11857, PRK11857, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|184875 PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|184875 PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|133456 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>gnl|CDD|133456 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>gnl|CDD|223585 COG0511, AccB, Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|223585 COG0511, AccB, Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|133459 cd06850, biotinyl_domain, The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>gnl|CDD|133459 cd06850, biotinyl_domain, The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>gnl|CDD|233366 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>gnl|CDD|233980 TIGR02712, urea_carbox, urea carboxylase Back     alignment and domain information
>gnl|CDD|233980 TIGR02712, urea_carbox, urea carboxylase Back     alignment and domain information
>gnl|CDD|202412 pfam02817, E3_binding, e3 binding domain Back     alignment and domain information
>gnl|CDD|227111 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|227111 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1045
TIGR02927590 SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo 100.0
TIGR01348546 PDHac_trf_long pyruvate dehydrogenase complex dihy 100.0
PRK11854633 aceF pyruvate dehydrogenase dihydrolipoyltransacet 100.0
PRK11855547 dihydrolipoamide acetyltransferase; Reviewed 100.0
PRK05704407 dihydrolipoamide succinyltransferase; Validated 100.0
TIGR01347403 sucB 2-oxoglutarate dehydrogenase complex dihydrol 100.0
PLN02744539 dihydrolipoyllysine-residue acetyltransferase comp 100.0
PLN02528416 2-oxoisovalerate dehydrogenase E2 component 100.0
KOG0558|consensus474 100.0
COG0508404 AceF Pyruvate/2-oxoglutarate dehydrogenase complex 100.0
TIGR01349435 PDHac_trf_mito pyruvate dehydrogenase complex dihy 100.0
KOG0557|consensus470 100.0
PLN02226463 2-oxoglutarate dehydrogenase E2 component 100.0
PTZ00144418 dihydrolipoamide succinyltransferase; Provisional 100.0
PRK14843347 dihydrolipoamide acetyltransferase; Provisional 100.0
PRK11856411 branched-chain alpha-keto acid dehydrogenase subun 100.0
KOG0559|consensus457 100.0
PRK11857306 dihydrolipoamide acetyltransferase; Reviewed 100.0
KOG0557|consensus470 100.0
PLN02226463 2-oxoglutarate dehydrogenase E2 component 100.0
PTZ00144418 dihydrolipoamide succinyltransferase; Provisional 100.0
PF00198231 2-oxoacid_dh: 2-oxoacid dehydrogenases acyltransfe 100.0
TIGR02927590 SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo 100.0
TIGR01348546 PDHac_trf_long pyruvate dehydrogenase complex dihy 100.0
PRK14843347 dihydrolipoamide acetyltransferase; Provisional 100.0
PRK11854633 aceF pyruvate dehydrogenase dihydrolipoyltransacet 100.0
PRK12270 1228 kgd alpha-ketoglutarate decarboxylase; Reviewed 100.0
PRK11855547 dihydrolipoamide acetyltransferase; Reviewed 100.0
PRK11857306 dihydrolipoamide acetyltransferase; Reviewed 100.0
PF00198231 2-oxoacid_dh: 2-oxoacid dehydrogenases acyltransfe 100.0
PRK05704407 dihydrolipoamide succinyltransferase; Validated 100.0
TIGR01347403 sucB 2-oxoglutarate dehydrogenase complex dihydrol 100.0
PLN02528416 2-oxoisovalerate dehydrogenase E2 component 100.0
PLN02744539 dihydrolipoyllysine-residue acetyltransferase comp 100.0
KOG0559|consensus457 100.0
TIGR01349435 PDHac_trf_mito pyruvate dehydrogenase complex dihy 100.0
COG0508404 AceF Pyruvate/2-oxoglutarate dehydrogenase complex 100.0
KOG0558|consensus474 100.0
PRK12270 1228 kgd alpha-ketoglutarate decarboxylase; Reviewed 100.0
PRK11856411 branched-chain alpha-keto acid dehydrogenase subun 99.97
PF0036474 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: 99.64
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 99.64
PF0036474 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: 99.6
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 99.59
PRK0674883 hypothetical protein; Validated 99.53
PRK11892464 pyruvate dehydrogenase subunit beta; Provisional 99.49
PRK0674883 hypothetical protein; Validated 99.46
PRK0588971 putative acetyl-CoA carboxylase biotin carboxyl ca 99.36
cd0666373 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar 99.31
PRK11892464 pyruvate dehydrogenase subunit beta; Provisional 99.31
PRK0822570 acetyl-CoA carboxylase biotin carboxyl carrier pro 99.27
PRK0588971 putative acetyl-CoA carboxylase biotin carboxyl ca 99.26
COG0511140 AccB Biotin carboxyl carrier protein [Lipid metabo 99.24
cd0666373 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar 99.22
PF0281739 E3_binding: e3 binding domain; InterPro: IPR004167 99.21
PRK0822570 acetyl-CoA carboxylase biotin carboxyl carrier pro 99.13
PRK06549130 acetyl-CoA carboxylase biotin carboxyl carrier pro 99.11
COG0511140 AccB Biotin carboxyl carrier protein [Lipid metabo 99.1
PRK0705180 hypothetical protein; Validated 99.06
PRK05641153 putative acetyl-CoA carboxylase biotin carboxyl ca 99.04
PRK06549130 acetyl-CoA carboxylase biotin carboxyl carrier pro 99.0
PLN02983274 biotin carboxyl carrier protein of acetyl-CoA carb 98.99
PRK0705180 hypothetical protein; Validated 98.97
TIGR00531156 BCCP acetyl-CoA carboxylase, biotin carboxyl carri 98.97
cd0685067 biotinyl_domain The biotinyl-domain or biotin carb 98.96
PRK05641153 putative acetyl-CoA carboxylase biotin carboxyl ca 98.91
PRK06302155 acetyl-CoA carboxylase biotin carboxyl carrier pro 98.9
PRK14042596 pyruvate carboxylase subunit B; Provisional 98.87
PLN02983274 biotin carboxyl carrier protein of acetyl-CoA carb 98.85
PF0281739 E3_binding: e3 binding domain; InterPro: IPR004167 98.85
cd0685067 biotinyl_domain The biotinyl-domain or biotin carb 98.85
cd0684974 lipoyl_domain Lipoyl domain of the dihydrolipoyl a 98.84
TIGR00531156 BCCP acetyl-CoA carboxylase, biotin carboxyl carri 98.8
cd0684974 lipoyl_domain Lipoyl domain of the dihydrolipoyl a 98.75
PRK06302155 acetyl-CoA carboxylase biotin carboxyl carrier pro 98.74
TIGR027121201 urea_carbox urea carboxylase. Members of this fami 98.72
PRK14042596 pyruvate carboxylase subunit B; Provisional 98.71
PF00302206 CAT: Chloramphenicol acetyltransferase; InterPro: 98.71
TIGR01108582 oadA oxaloacetate decarboxylase alpha subunit. Thi 98.65
TIGR012351143 pyruv_carbox pyruvate carboxylase. This enzyme pla 98.64
PRK14040593 oxaloacetate decarboxylase; Provisional 98.62
PRK13757219 chloramphenicol acetyltransferase; Provisional 98.59
TIGR027121201 urea_carbox urea carboxylase. Members of this fami 98.56
TIGR01108582 oadA oxaloacetate decarboxylase alpha subunit. Thi 98.5
PRK14040593 oxaloacetate decarboxylase; Provisional 98.48
PRK09282592 pyruvate carboxylase subunit B; Validated 98.47
TIGR012351143 pyruv_carbox pyruvate carboxylase. This enzyme pla 98.43
PRK129991146 pyruvate carboxylase; Reviewed 98.4
COG4770645 Acetyl/propionyl-CoA carboxylase, alpha subunit [L 98.33
COG10381149 PycA Pyruvate carboxylase [Energy production and c 98.31
PRK09282592 pyruvate carboxylase subunit B; Validated 98.3
PRK129991146 pyruvate carboxylase; Reviewed 98.18
COG4770645 Acetyl/propionyl-CoA carboxylase, alpha subunit [L 98.12
KOG0369|consensus1176 98.01
COG10381149 PycA Pyruvate carboxylase [Energy production and c 97.92
cd0684896 GCS_H Glycine cleavage H-protein. Glycine cleavage 97.87
cd0684896 GCS_H Glycine cleavage H-protein. Glycine cleavage 97.73
COG4845219 Chloramphenicol O-acetyltransferase [Defense mecha 97.63
TIGR03077110 not_gcvH glycine cleavage protein H-like protein, 97.58
KOG0369|consensus1176 97.51
PRK01202127 glycine cleavage system protein H; Provisional 97.48
KOG0238|consensus670 97.47
PRK00624114 glycine cleavage system protein H; Provisional 97.44
TIGR03077110 not_gcvH glycine cleavage protein H-like protein, 97.29
PRK13380144 glycine cleavage system protein H; Provisional 97.21
KOG0368|consensus 2196 97.16
PRK00624114 glycine cleavage system protein H; Provisional 97.12
KOG0238|consensus670 97.05
TIGR00998334 8a0101 efflux pump membrane protein (multidrug res 96.99
PRK10559310 p-hydroxybenzoic acid efflux subunit AaeA; Provisi 96.96
PRK13380144 glycine cleavage system protein H; Provisional 96.93
KOG0368|consensus 2196 96.85
TIGR01730322 RND_mfp RND family efflux transporter, MFP subunit 96.84
PRK09783409 copper/silver efflux system membrane fusion protei 96.76
PF1353350 Biotin_lipoyl_2: Biotin-lipoyl like 96.75
PRK10476346 multidrug resistance protein MdtN; Provisional 96.69
TIGR00527127 gcvH glycine cleavage system H protein. The genome 96.68
PRK01202127 glycine cleavage system protein H; Provisional 96.65
TIGR00998334 8a0101 efflux pump membrane protein (multidrug res 96.61
PRK10559310 p-hydroxybenzoic acid efflux subunit AaeA; Provisi 96.57
PRK15136390 multidrug efflux system protein EmrA; Provisional 96.55
PRK09578385 periplasmic multidrug efflux lipoprotein precursor 96.49
TIGR01730322 RND_mfp RND family efflux transporter, MFP subunit 96.48
PF1353350 Biotin_lipoyl_2: Biotin-lipoyl like 96.47
PRK03598331 putative efflux pump membrane fusion protein; Prov 96.37
TIGR00527127 gcvH glycine cleavage system H protein. The genome 96.28
PRK09783409 copper/silver efflux system membrane fusion protei 96.25
PRK09859385 multidrug efflux system protein MdtE; Provisional 96.2
PF01597122 GCV_H: Glycine cleavage H-protein; InterPro: IPR00 96.2
PRK10476346 multidrug resistance protein MdtN; Provisional 96.18
PRK15030397 multidrug efflux system transporter AcrA; Provisio 96.07
PRK09578385 periplasmic multidrug efflux lipoprotein precursor 95.95
PRK15136390 multidrug efflux system protein EmrA; Provisional 95.91
PRK11578370 macrolide transporter subunit MacA; Provisional 95.89
PRK1278484 hypothetical protein; Provisional 95.89
PRK03598331 putative efflux pump membrane fusion protein; Prov 95.88
PRK11556415 multidrug efflux system subunit MdtA; Provisional 95.84
COG0509131 GcvH Glycine cleavage system H protein (lipoate-bi 95.71
PRK09859385 multidrug efflux system protein MdtE; Provisional 95.66
PF12700328 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 95.51
PRK1278484 hypothetical protein; Provisional 95.51
PF01597122 GCV_H: Glycine cleavage H-protein; InterPro: IPR00 95.45
PRK15030397 multidrug efflux system transporter AcrA; Provisio 95.43
PF00302206 CAT: Chloramphenicol acetyltransferase; InterPro: 95.35
PRK13757219 chloramphenicol acetyltransferase; Provisional 95.28
TIGR02971327 heterocyst_DevB ABC exporter membrane fusion prote 95.26
PRK11556415 multidrug efflux system subunit MdtA; Provisional 95.13
PRK11578370 macrolide transporter subunit MacA; Provisional 95.11
COG0509131 GcvH Glycine cleavage system H protein (lipoate-bi 94.9
TIGR03309256 matur_yqeB selenium-dependent molybdenum hydroxyla 94.51
PF01398114 JAB: JAB1/Mov34/MPN/PAD-1 ubiquitin protease; Inte 94.32
cd08057157 MPN_euk_non_mb Mpr1p, Pad1p N-terminal (MPN) domai 94.07
TIGR03309256 matur_yqeB selenium-dependent molybdenum hydroxyla 94.01
TIGR00999265 8a0102 Membrane Fusion Protein cluster 2 (function 93.21
PF13375101 RnfC_N: RnfC Barrel sandwich hybrid domain 92.71
cd08067187 MPN_2A_DUB Mov34/MPN/PAD-1 family: Histone H2A deu 92.49
cd06250359 M14_PaAOTO_like An uncharacterized subgroup of the 92.3
cd06251287 M14_ASTE_ASPA_like_1 A functionally uncharacterize 92.2
PF13375101 RnfC_N: RnfC Barrel sandwich hybrid domain 92.17
cd06253298 M14_ASTE_ASPA_like_3 A functionally uncharacterize 91.82
cd07767116 MPN Mpr1p, Pad1p N-terminal (MPN) domains. MPN (al 91.02
smart00232135 JAB_MPN JAB/MPN domain. Domain in Jun kinase activ 90.4
PLN03246303 26S proteasome regulatory subunit; Provisional 90.16
TIGR02994325 ectoine_eutE ectoine utilization protein EutE. Mem 89.61
cd08062280 MPN_RPN7_8 Mpr1p, Pad1p N-terminal (MPN) domains w 89.56
COG3608331 Predicted deacylase [General function prediction o 89.46
cd06253298 M14_ASTE_ASPA_like_3 A functionally uncharacterize 89.46
PF13437105 HlyD_3: HlyD family secretion protein 89.09
cd06252316 M14_ASTE_ASPA_like_2 A functionally uncharacterize 88.85
cd08058119 MPN_euk_mb Mpr1p, Pad1p N-terminal (MPN) domains w 88.67
cd06251287 M14_ASTE_ASPA_like_1 A functionally uncharacterize 88.66
PF05896257 NQRA: Na(+)-translocating NADH-quinone reductase s 88.48
PF00529305 HlyD: HlyD family secretion protein the correspond 87.51
cd06250359 M14_PaAOTO_like An uncharacterized subgroup of the 87.3
PF13437105 HlyD_3: HlyD family secretion protein 87.12
COG3608331 Predicted deacylase [General function prediction o 86.75
TIGR02994325 ectoine_eutE ectoine utilization protein EutE. Mem 85.85
PF00529305 HlyD: HlyD family secretion protein the correspond 85.46
TIGR02971327 heterocyst_DevB ABC exporter membrane fusion prote 85.45
cd08063288 MPN_CSN6 Mpr1p, Pad1p N-terminal (MPN) domains wit 85.2
cd06252316 M14_ASTE_ASPA_like_2 A functionally uncharacterize 85.08
PF12700328 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 85.06
cd06254288 M14_ASTE_ASPA_like_4 A functionally uncharacterize 84.93
PF09891150 DUF2118: Uncharacterized protein conserved in arch 84.17
PF09891150 DUF2118: Uncharacterized protein conserved in arch 83.68
cd08066173 MPN_AMSH_like Mov34/MPN/PAD-1 family. AMSH (associ 83.24
KOG3373|consensus172 82.63
COG1726447 NqrA Na+-transporting NADH:ubiquinone oxidoreducta 82.21
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 81.17
TIGR01936447 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translo 80.58
TIGR03794421 NHPM_micro_HlyD NHPM bacteriocin system secretion 80.43
TIGR01000457 bacteriocin_acc bacteriocin secretion accessory pr 80.18
>TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
Probab=100.00  E-value=1.3e-94  Score=867.82  Aligned_cols=539  Identities=24%  Similarity=0.375  Sum_probs=413.4

Q ss_pred             EEEEccCCCCCCceEEEEEEeccCCCCCeecCCCeEEEEEcCCceeEEeCCCCeEEEEEeeCCCCeecCCCeEEEEEecC
Q psy6394         188 IQFKLADIGEGIREVNIKEWNGNVTEGARINEFDVVCEVESDKASVTITSRYKGTVRKVYYGEGDVALVGKPLLDIEVED  267 (1045)
Q Consensus       188 ~~~~~P~lg~~~~eg~i~~w~~~v~~Gd~V~~gd~l~~vetdKa~~~i~s~~~G~v~~i~~~~g~~v~vG~~l~~i~~~~  267 (1045)
                      ++|+||+||++|.||+|++|+  |++||.|++||+||+|||||++++|+||.+|+|.++++++|+.|++|++|+.|+..+
T Consensus         3 ~~i~~P~lg~~~~eg~i~~w~--v~~Gd~V~~g~~l~~vEtdKa~~ev~a~~~G~v~~i~v~~Gd~v~vG~~ia~i~~~~   80 (590)
T TIGR02927         3 FSVEMPALGESVTEGTITQWL--KAEGDTVELDEPLLEVSTDKVDTEIPSPAAGVILEIKAEEDDTVDIGGEIAIIGEAG   80 (590)
T ss_pred             eeEECCCCCCCccEEEEEEEE--ECCCCEEeCCCeEEEEEecceEEEecCCCCEEEEEEeecCCCEEeeeeeEEEEeecc
Confidence            579999999999999999999  999999999999999999999999999999999999999999999999999997543


Q ss_pred             ccccccccccccccCCCCCCCCCCCCCCCCCCccccCCCCCCCCCCCCCCCCCCCCCCccccccccCccccccccccccc
Q psy6394         268 EGVAAEEADSLDRKAAPGVSEVNTPDTSDQPNETLHKEPNKVNREPIAHKPDVTPDLSRDSAVSHLNQPVNLNKNKWKIL  347 (1045)
Q Consensus       268 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  347 (1045)
                      +.........    .++.      +++...++..    ..+.    . .++..+.     ..     .            
T Consensus        81 ~~~~~~~~~~----~~~~------~~~~~~~~~~----~~~~----~-~~~~~~~-----~~-----~------------  119 (590)
T TIGR02927        81 EASAEAGAED----SAAA------AEPEEAPAEE----APKE----E-PKAAPAE-----SV-----E------------  119 (590)
T ss_pred             cccccccccc----cccc------cccccccccc----cccc----c-ccccccc-----cc-----c------------
Confidence            3211000000    0000      0000000000    0000    0 0000000     00     0            


Q ss_pred             cChHHHHHHHHcCCCcccccccCCCcceehhhHHhhhcCCCccccccccccccccceeEEecceeeecccccccccCCCC
Q psy6394         348 ATPSVRRMIKHYEIDTKELRGTGKQGRVLKEDIITYMNSPIDETNLAHTAHVREASNVISIRGYVKGMFKSMTEAHGHHL  427 (1045)
Q Consensus       348 atP~vRrlA~e~gidls~v~gTG~~Gri~k~DVl~~~~~~~~~~~~~~~~~~~~~~~~~~l~g~r~~m~k~Mt~S~~~~~  427 (1045)
                      .+|                                                                             
T Consensus       120 ~a~-----------------------------------------------------------------------------  122 (590)
T TIGR02927       120 QAP-----------------------------------------------------------------------------  122 (590)
T ss_pred             ccc-----------------------------------------------------------------------------
Confidence            000                                                                             


Q ss_pred             CCCCcccccccccc--cccceeEEEEecCCCCCcceeEEEEeeeccCCCCeeccCCeEeEEeccceeeEEecCCCEEEEE
Q psy6394         428 STPPLQCHHHLHTS--CIRHKLIQFNLADIGEGIREVNIKEWNGNVTEGARINEFDVVCEVESDKASVTITSRYKGTVRK  505 (1045)
Q Consensus       428 s~~~~~~~~~~~~s--~~~~~~~~i~~P~lge~~~eg~i~~w~~~v~~Gd~V~~gd~l~~vetdKa~~ei~ap~~G~v~~  505 (1045)
                               .++..  ....+.++|+||+||++|+||+|.+|+  |++||.|++||+||+|||||+++||+||++|+|.+
T Consensus       123 ---------~~~~~~~~~~~~~~~~~~P~lg~~~~eg~i~~w~--v~~Gd~V~~g~~l~~vEtdKa~~ev~s~~~G~v~~  191 (590)
T TIGR02927       123 ---------AESSAPSQGGGAATDIEMPELGESVTEGTITQWL--KAVGDKIEVDEPILEVSTDKVDTEIPSPVAGTILE  191 (590)
T ss_pred             ---------cccccccccCCCceEEEcCCCCCCcceEEEEEEE--eCCCCEecCCCEeEEEEecceeeEEcCCCCeEEEE
Confidence                     00000  001224789999999999999999999  99999999999999999999999999999999999


Q ss_pred             EeeCCCCEEecCCceEEEeecCccccc------cc-c------ccccc--c-----CCC--------CCC----CC----
Q psy6394         506 VYYGEGDVALVGKPLLDIEVEDEGVAA------EE-A------DSLDR--K-----AAP--------GVS----EV----  549 (1045)
Q Consensus       506 i~~~~G~~v~vg~~l~~i~~~~~~~~~------~~-~------~~~~~--~-----~~~--------~~~----~~----  549 (1045)
                      |++++|+.|++|++|++|+.+++..+.      .. .      .+.+.  .     ..+        ...    ..    
T Consensus       192 i~v~~G~~v~vG~~l~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  271 (590)
T TIGR02927       192 ILAEEDDTVDVGAEIAKIGDAGAAAAEDAKAEEEAEAKAEAKPEEKPDPKKDEAAEPEPDEPEAEKAEKKEEKAAAAPAA  271 (590)
T ss_pred             EecCCCCEecCCCEEEEEecCCCccccccccccccccccccccCCCCccccccccccccccccccccccccccccccccc
Confidence            999999999999999999754322100      00 0      00000  0     000        000    00    


Q ss_pred             -CCCCCCCCccccccCCCCCCCcCccccCCCCCccchHhHHhhhCCCCCCCCCCccccccccccceeecccccccccccc
Q psy6394         550 -NTPDTSDQPNETLHKDPNKIDTKELRGTGKQGRVLKEDIITYMNSPSDETNPAHTAHVREASNVISIRGYVKGMFKSMT  628 (1045)
Q Consensus       550 -~~~~~~asP~vr~la~e~gidls~v~gTG~~GrI~k~DV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  628 (1045)
                       ....+++||++||||+|+||||+.|+|||++|||+|+||++|+.........+.++++..+                  
T Consensus       272 ~~~~~~~asP~aR~lA~e~gvdl~~v~GtG~~GrI~k~DV~~~~~~~~~~~~~~~~~~~~~~------------------  333 (590)
T TIGR02927       272 NSDGSPYVTPLVRKLAAEHGIDLNSVKGTGIGGRIRKQDVLAAAEGAKAAAEAPAAEAAAAA------------------  333 (590)
T ss_pred             cccCcccCCchhHHHHHHcCCCHHHCCCCCCCCeEeHHHHHHHHhccccccccccccccccC------------------
Confidence             1124678999999999999999999999999999999999997532111000000000000                  


Q ss_pred             ccccCCCccccccccccccccccchhhhcccCCCCCCCCCCcccccCCcceeeecCchhhHHHHHhhhc-CCCCeeEEee
Q psy6394         629 EANTIPSLRLTEEVDTTQLRDVKKEDIITYMNSPSDETNPAHTAHVREASNVIPIRGYVKGMFKSMTEA-NTIPSLRLTE  707 (1045)
Q Consensus       629 ~~~~~p~~~l~~~~d~~~~~~v~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~pls~~rk~ia~~m~~S-~~iP~~~~~~  707 (1045)
                           +                      .....+.  ..+... ......+.+||++|||.||++|++| +++||+|++.
T Consensus       334 -----~----------------------~~~~~~~--~~~~~~-~~~~~~~~~pls~~rk~ia~~m~~S~~~iPh~~~~~  383 (590)
T TIGR02927       334 -----P----------------------AAAAAAS--ASPAPA-KAHLRGTTQKANRIREITAKKTREALQASAQLTQLH  383 (590)
T ss_pred             -----c----------------------ccccccc--CCCccc-cccccCceeeccHHHHHHHHHHHHHhccCCeEEEEe
Confidence                 0                      0000000  000000 0001245689999999999999999 7899999999


Q ss_pred             cccchHHHHHHHHHHHHHHhccCcccChHHHHHHHHHHHHHhCCccceEEcCCCceEEEcCCccEEEEEecCCCeeeeee
Q psy6394         708 EVDTTQLRDVKNQVSALYQEKFRLKLTYMPFFIKALSLCMTEHPILNASIDPTQENILVNPDHNISIAIDTKHGLVVPNI  787 (1045)
Q Consensus       708 evD~t~l~~~r~~~~~~~~~~~~~klT~~~~likAva~aL~~~P~lNa~~~~~~~~i~~~~~vnIgiAV~t~~GL~vPvI  787 (1045)
                      ++|+++|+++|+++++.+.+..+.|+|+++||+||+++||++||.||++|+++++.|++++++||||||++++||+||||
T Consensus       384 evdvt~l~~~R~~l~~~~~~~~~~kls~~~~iiKA~a~AL~~~P~~Na~~~~~~~~i~~~~~vnigvAv~t~~GL~vPvI  463 (590)
T TIGR02927       384 EVDMTKIAALRARAKAAFAEKEGVNLTFLPFFAKAVIDALKAHPNVNASYNADTKEITYHAAEHLGFAVDTDAGLLSPVI  463 (590)
T ss_pred             EEEcHHHHHHHHHHHhhhHHhcCCcccHHHHHHHHHHHHHHhCCHhheEEecCCCEEEEeCCccEEEEEECCCCcEeccc
Confidence            99999999999999976555423899999999999999999999999999876778999999999999999999999999


Q ss_pred             cccccccHHHHHHHHHHHHhccccCCCCCCccCCCceEeeccCCccceeecccccccceeeEeeccceeEeEec--cCC-
Q psy6394         788 KSVNKLCLLDITRELLRIQGCSHEGKVLPRDIQGGTISMSNVGNVGGTLVQPIIVPGQVCIVAFGKIQLLPRFD--AEM-  864 (1045)
Q Consensus       788 r~ad~~sl~ei~~~l~~l~~~ar~~kl~~~d~~ggTftISNlG~~G~~~~tpii~~pq~ailavG~i~~~p~~~--~~g-  864 (1045)
                      ||+|+++|.+|++++++|++++|+|||+++||+||||||||+|+||+++|+|||||||+||||+|+++++|+|+  .+| 
T Consensus       464 k~a~~~sl~~ia~~i~~l~~kAr~gkL~p~e~~GgTfTISNlG~~G~~~~tpIIn~PqvaILgvG~i~~~pv~~~~~~g~  543 (590)
T TIGR02927       464 HNAGDLSLGEIAKAIADIAARARNGKLKPDDLAGGTFTITNIGSEGALFDTPILIPPQAAILGTGAIVKRPRVITDEDGI  543 (590)
T ss_pred             CCcccCCHHHHHHHHHHHHHHHHcCCCChHHhCCCeEEEECCCCCCccceeceecCCCeEEEEcccceEEEEEeccCCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999984  344 


Q ss_pred             -ceeEEEeeeEEEeccceeecchhhhhhhhhhhhcccccccCCcc
Q psy6394         865 -RIVAKCILNVTWAADHRVVDGATVARAATLWKSLENILVNPDHN  908 (1045)
Q Consensus       865 -~i~~~~~m~lslt~DhRviDGa~aa~fl~~~~~~~~ile~p~v~  908 (1045)
                       .+++|++|++||+||||||||+++|+||+.|+++   ||+|.++
T Consensus       544 ~~~~~~~~m~lsls~DHRviDGa~aa~Fl~~lk~~---LE~~~~~  585 (590)
T TIGR02927       544 DSIAIRQMCHLPLTYDHQLIDGADAGRFLTTIKDR---LEEAAFE  585 (590)
T ss_pred             ccEEEEeeEEEeeeccchhcCcHHHHHHHHHHHHH---HhCcccc
Confidence             4999999999999999999999999999999999   9997654



This model represents an Actinobacterial clade of E2 enzyme, a component of the 2-oxoglutarate dehydrogenase complex involved in the TCA cycle. These proteins have multiple domains including the catalytic domain (pfam00198), one or two biotin domains (pfam00364) and an E3-component binding domain (pfam02817).

>TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>PRK11855 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>PRK05704 dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>TIGR01347 sucB 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) Back     alignment and domain information
>PLN02744 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex Back     alignment and domain information
>PLN02528 2-oxoisovalerate dehydrogenase E2 component Back     alignment and domain information
>KOG0558|consensus Back     alignment and domain information
>COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>KOG0557|consensus Back     alignment and domain information
>PLN02226 2-oxoglutarate dehydrogenase E2 component Back     alignment and domain information
>PTZ00144 dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>PRK14843 dihydrolipoamide acetyltransferase; Provisional Back     alignment and domain information
>PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>KOG0559|consensus Back     alignment and domain information
>PRK11857 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>KOG0557|consensus Back     alignment and domain information
>PLN02226 2-oxoglutarate dehydrogenase E2 component Back     alignment and domain information
>PTZ00144 dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>PF00198 2-oxoacid_dh: 2-oxoacid dehydrogenases acyltransferase (catalytic domain); InterPro: IPR001078 This domain is found in the lipoamide acyltransferase component of the branched-chain alpha-keto acid dehydrogenase complex 2 Back     alignment and domain information
>TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>PRK14843 dihydrolipoamide acetyltransferase; Provisional Back     alignment and domain information
>PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>PRK11855 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>PRK11857 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>PF00198 2-oxoacid_dh: 2-oxoacid dehydrogenases acyltransferase (catalytic domain); InterPro: IPR001078 This domain is found in the lipoamide acyltransferase component of the branched-chain alpha-keto acid dehydrogenase complex 2 Back     alignment and domain information
>PRK05704 dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>TIGR01347 sucB 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) Back     alignment and domain information
>PLN02528 2-oxoisovalerate dehydrogenase E2 component Back     alignment and domain information
>PLN02744 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex Back     alignment and domain information
>KOG0559|consensus Back     alignment and domain information
>TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>KOG0558|consensus Back     alignment and domain information
>PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PRK06748 hypothetical protein; Validated Back     alignment and domain information
>PRK11892 pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>PRK06748 hypothetical protein; Validated Back     alignment and domain information
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>PRK11892 pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>PF02817 E3_binding: e3 binding domain; InterPro: IPR004167 A small domain of the E2 subunit of 2-oxo-acid dehydrogenases that is responsible for the binding of the E3 subunit Back     alignment and domain information
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>PRK07051 hypothetical protein; Validated Back     alignment and domain information
>PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase Back     alignment and domain information
>PRK07051 hypothetical protein; Validated Back     alignment and domain information
>TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein Back     alignment and domain information
>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase Back     alignment and domain information
>PF02817 E3_binding: e3 binding domain; InterPro: IPR004167 A small domain of the E2 subunit of 2-oxo-acid dehydrogenases that is responsible for the binding of the E3 subunit Back     alignment and domain information
>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein Back     alignment and domain information
>cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>PF00302 CAT: Chloramphenicol acetyltransferase; InterPro: IPR001707 Chloramphenicol acetyltransferase (CAT) (2 Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK13757 chloramphenicol acetyltransferase; Provisional Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>KOG0369|consensus Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>cd06848 GCS_H Glycine cleavage H-protein Back     alignment and domain information
>cd06848 GCS_H Glycine cleavage H-protein Back     alignment and domain information
>COG4845 Chloramphenicol O-acetyltransferase [Defense mechanisms] Back     alignment and domain information
>TIGR03077 not_gcvH glycine cleavage protein H-like protein, Chlamydial Back     alignment and domain information
>KOG0369|consensus Back     alignment and domain information
>PRK01202 glycine cleavage system protein H; Provisional Back     alignment and domain information
>KOG0238|consensus Back     alignment and domain information
>PRK00624 glycine cleavage system protein H; Provisional Back     alignment and domain information
>TIGR03077 not_gcvH glycine cleavage protein H-like protein, Chlamydial Back     alignment and domain information
>PRK13380 glycine cleavage system protein H; Provisional Back     alignment and domain information
>KOG0368|consensus Back     alignment and domain information
>PRK00624 glycine cleavage system protein H; Provisional Back     alignment and domain information
>KOG0238|consensus Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) Back     alignment and domain information
>PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional Back     alignment and domain information
>PRK13380 glycine cleavage system protein H; Provisional Back     alignment and domain information
>KOG0368|consensus Back     alignment and domain information
>TIGR01730 RND_mfp RND family efflux transporter, MFP subunit Back     alignment and domain information
>PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional Back     alignment and domain information
>PF13533 Biotin_lipoyl_2: Biotin-lipoyl like Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>TIGR00527 gcvH glycine cleavage system H protein Back     alignment and domain information
>PRK01202 glycine cleavage system protein H; Provisional Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) Back     alignment and domain information
>PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional Back     alignment and domain information
>PRK15136 multidrug efflux system protein EmrA; Provisional Back     alignment and domain information
>PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed Back     alignment and domain information
>TIGR01730 RND_mfp RND family efflux transporter, MFP subunit Back     alignment and domain information
>PF13533 Biotin_lipoyl_2: Biotin-lipoyl like Back     alignment and domain information
>PRK03598 putative efflux pump membrane fusion protein; Provisional Back     alignment and domain information
>TIGR00527 gcvH glycine cleavage system H protein Back     alignment and domain information
>PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional Back     alignment and domain information
>PRK09859 multidrug efflux system protein MdtE; Provisional Back     alignment and domain information
>PF01597 GCV_H: Glycine cleavage H-protein; InterPro: IPR002930 This is a family of glycine cleavage H-proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>PRK15030 multidrug efflux system transporter AcrA; Provisional Back     alignment and domain information
>PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed Back     alignment and domain information
>PRK15136 multidrug efflux system protein EmrA; Provisional Back     alignment and domain information
>PRK11578 macrolide transporter subunit MacA; Provisional Back     alignment and domain information
>PRK12784 hypothetical protein; Provisional Back     alignment and domain information
>PRK03598 putative efflux pump membrane fusion protein; Provisional Back     alignment and domain information
>PRK11556 multidrug efflux system subunit MdtA; Provisional Back     alignment and domain information
>COG0509 GcvH Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09859 multidrug efflux system protein MdtE; Provisional Back     alignment and domain information
>PF12700 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 4DK0_A 4DK1_C 3FPP_B 2K32_A 2K33_A 3OW7_B 3OOC_A 3T53_B 4DNT_C Back     alignment and domain information
>PRK12784 hypothetical protein; Provisional Back     alignment and domain information
>PF01597 GCV_H: Glycine cleavage H-protein; InterPro: IPR002930 This is a family of glycine cleavage H-proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes Back     alignment and domain information
>PRK15030 multidrug efflux system transporter AcrA; Provisional Back     alignment and domain information
>PF00302 CAT: Chloramphenicol acetyltransferase; InterPro: IPR001707 Chloramphenicol acetyltransferase (CAT) (2 Back     alignment and domain information
>PRK13757 chloramphenicol acetyltransferase; Provisional Back     alignment and domain information
>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family Back     alignment and domain information
>PRK11556 multidrug efflux system subunit MdtA; Provisional Back     alignment and domain information
>PRK11578 macrolide transporter subunit MacA; Provisional Back     alignment and domain information
>COG0509 GcvH Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03309 matur_yqeB selenium-dependent molybdenum hydroxylase system protein, YqeB family Back     alignment and domain information
>PF01398 JAB: JAB1/Mov34/MPN/PAD-1 ubiquitin protease; InterPro: IPR000555 Members of this family are found in proteasome regulatory subunits, eukaryotic initiation factor 3 (eIF3) subunits and regulators of transcription factors Back     alignment and domain information
>cd08057 MPN_euk_non_mb Mpr1p, Pad1p N-terminal (MPN) domains without catalytic isopeptidase activity (non metal-binding); eukaryotic Back     alignment and domain information
>TIGR03309 matur_yqeB selenium-dependent molybdenum hydroxylase system protein, YqeB family Back     alignment and domain information
>TIGR00999 8a0102 Membrane Fusion Protein cluster 2 (function with RND porters) Back     alignment and domain information
>PF13375 RnfC_N: RnfC Barrel sandwich hybrid domain Back     alignment and domain information
>cd08067 MPN_2A_DUB Mov34/MPN/PAD-1 family: Histone H2A deubiquitinase Back     alignment and domain information
>cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PF13375 RnfC_N: RnfC Barrel sandwich hybrid domain Back     alignment and domain information
>cd06253 M14_ASTE_ASPA_like_3 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd07767 MPN Mpr1p, Pad1p N-terminal (MPN) domains Back     alignment and domain information
>smart00232 JAB_MPN JAB/MPN domain Back     alignment and domain information
>PLN03246 26S proteasome regulatory subunit; Provisional Back     alignment and domain information
>TIGR02994 ectoine_eutE ectoine utilization protein EutE Back     alignment and domain information
>cd08062 MPN_RPN7_8 Mpr1p, Pad1p N-terminal (MPN) domains without catalytic isopeptidase activity, found in 19S proteasomal subunits Rpn7 and Rpn8 Back     alignment and domain information
>COG3608 Predicted deacylase [General function prediction only] Back     alignment and domain information
>cd06253 M14_ASTE_ASPA_like_3 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PF13437 HlyD_3: HlyD family secretion protein Back     alignment and domain information
>cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd08058 MPN_euk_mb Mpr1p, Pad1p N-terminal (MPN) domains with catalytic isopeptidase activity (metal-binding); eukaryotic Back     alignment and domain information
>cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PF05896 NQRA: Na(+)-translocating NADH-quinone reductase subunit A (NQRA); InterPro: IPR008703 This family consists of several bacterial Na+-translocating NADH-quinone reductase subunit A (NQRA) proteins Back     alignment and domain information
>PF00529 HlyD: HlyD family secretion protein the corresponding Prosite entry Back     alignment and domain information
>cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PF13437 HlyD_3: HlyD family secretion protein Back     alignment and domain information
>COG3608 Predicted deacylase [General function prediction only] Back     alignment and domain information
>TIGR02994 ectoine_eutE ectoine utilization protein EutE Back     alignment and domain information
>PF00529 HlyD: HlyD family secretion protein the corresponding Prosite entry Back     alignment and domain information
>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family Back     alignment and domain information
>cd08063 MPN_CSN6 Mpr1p, Pad1p N-terminal (MPN) domains without catalytic isopeptidase activity, found in COP9 signalosome complex subunit 6 Back     alignment and domain information
>cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PF12700 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 4DK0_A 4DK1_C 3FPP_B 2K32_A 2K33_A 3OW7_B 3OOC_A 3T53_B 4DNT_C Back     alignment and domain information
>cd06254 M14_ASTE_ASPA_like_4 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PF09891 DUF2118: Uncharacterized protein conserved in archaea (DUF2118); InterPro: IPR019217 This entry represents a family of hypothetical proteins of unknown function Back     alignment and domain information
>PF09891 DUF2118: Uncharacterized protein conserved in archaea (DUF2118); InterPro: IPR019217 This entry represents a family of hypothetical proteins of unknown function Back     alignment and domain information
>cd08066 MPN_AMSH_like Mov34/MPN/PAD-1 family Back     alignment and domain information
>KOG3373|consensus Back     alignment and domain information
>COG1726 NqrA Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrA [Energy production and conversion] Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit Back     alignment and domain information
>TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1045
2ihw_A262 Crystal Structure Of A Cubic Core Of The Dihydrolip 2e-51
2ihw_A262 Crystal Structure Of A Cubic Core Of The Dihydrolip 2e-37
1b5s_A242 Dihydrolipoyl Transacetylase (E.C.2.3.1.12) Catalyt 2e-28
1b5s_A242 Dihydrolipoyl Transacetylase (E.C.2.3.1.12) Catalyt 3e-17
3duf_I428 Snapshots Of Catalysis In The E1 Subunit Of The Pyr 3e-28
3duf_I428 Snapshots Of Catalysis In The E1 Subunit Of The Pyr 2e-17
1k8o_A93 Solution Structure Of The Lipoic Acid-Bearing Domai 2e-23
1k8o_A93 Solution Structure Of The Lipoic Acid-Bearing Domai 6e-23
3mae_A256 Crystal Structure Of Probable Dihydrolipamide Acety 1e-19
3mae_A256 Crystal Structure Of Probable Dihydrolipamide Acety 2e-09
1c4t_A233 Catalytic Domain From Trimeric Dihydrolipoamide Suc 7e-19
1c4t_A233 Catalytic Domain From Trimeric Dihydrolipoamide Suc 3e-11
1dpc_A243 Crystallographic And Enzymatic Investigations On Th 2e-17
1dpc_A243 Crystallographic And Enzymatic Investigations On Th 6e-10
3rqc_A224 Crystal Structure Of The Catalytic Core Of The 2-Ox 6e-17
3rqc_A224 Crystal Structure Of The Catalytic Core Of The 2-Ox 4e-11
1dpd_A243 Crystallographic And Enzymatic Investigations On Th 2e-16
1dpd_A243 Crystallographic And Enzymatic Investigations On Th 6e-09
1eaa_A243 Atomic Structure Of The Cubic Core Of The Pyruvate 3e-16
1eaa_A243 Atomic Structure Of The Cubic Core Of The Pyruvate 3e-09
1dpb_A243 Crystallographic And Enzymatic Investigations On Th 2e-15
1dpb_A243 Crystallographic And Enzymatic Investigations On Th 5e-08
3b8k_A239 Structure Of The Truncated Human Dihydrolipoyl Acet 2e-15
3b8k_A239 Structure Of The Truncated Human Dihydrolipoyl Acet 3e-13
1lab_A80 Three-Dimensional Structure Of The Lipoyl Domain Fr 1e-10
1lab_A80 Three-Dimensional Structure Of The Lipoyl Domain Fr 5e-10
3l60_A250 Crystal Structure Of Branched-Chain Alpha-Keto Acid 1e-08
3l60_A250 Crystal Structure Of Branched-Chain Alpha-Keto Acid 2e-08
2l5t_A77 Solution Nmr Structure Of E2 Lipoyl Domain From The 1e-07
2l5t_A77 Solution Nmr Structure Of E2 Lipoyl Domain From The 4e-07
2xt6_A 1113 Crystal Structure Of Mycobacterium Smegmatis Alpha- 2e-05
2xt6_A 1113 Crystal Structure Of Mycobacterium Smegmatis Alpha- 5e-04
2coo_A70 Solution Structure Of The E3_binding Domain Of Dihy 4e-05
1zwv_A58 Solution Structure Of The Subunit Binding Domain (H 5e-05
1w85_I49 The Crystal Structure Of Pyruvate Dehydrogenase E1 2e-04
1w3d_A55 Nmr Structure Of The Peripheral-Subunit Binding Dom 2e-04
1w4g_A47 Peripheral-Subunit Binding Domains From Mesophilic, 2e-04
1w4f_A47 Peripheral-Subunit Binding Domains From Mesophilic, 3e-04
3rnm_E58 The Crystal Structure Of The Subunit Binding Of Hum 3e-04
2pdd_A43 The High Resolution Structure Of The Peripheral Sub 4e-04
2pde_A43 The High Resolution Structure Of The Peripheral Sub 8e-04
1ebd_C41 Dihydrolipoamide Dehydrogenase Complexed With The B 8e-04
>pdb|2IHW|A Chain A, Crystal Structure Of A Cubic Core Of The Dihydrolipoamide Acyltransferase (E2b) Component In The Branched-Chain Alpha-Ketoacid Dehydrogenase Complex (Bckdc), Apo Form Length = 262 Back     alignment and structure

Iteration: 1

Score = 201 bits (510), Expect = 2e-51, Method: Compositional matrix adjust. Identities = 96/220 (43%), Positives = 148/220 (67%), Gaps = 2/220 (0%) Query: 682 PIRGYVKGMFKSMTEANTIPSLRLTEEVDTTQLRDVKNQVSALYQEKFRLKLTYMPFFIK 741 P++G+ K M K+M+ A IP +EVD T+L ++ ++ + + +KL++MPFF+K Sbjct: 35 PVKGFHKAMVKTMSAALKIPHFGYCDEVDLTELVKLREELKPIAFAR-GIKLSFMPFFLK 93 Query: 742 ALSLCMTEHPILNASIDPTQENILVNPDHNISIAIDTKHGLVVPNIKSVNKLCLLDITRE 801 A SL + + PILNAS+D +NI HNI IA+DT+ GL+VPN+K+V + +I E Sbjct: 94 AASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQIRSIFEIATE 153 Query: 802 LLRIQGCSHEGKVLPRDIQGGTISMSNVGNVGGTLVQPIIVPGQVCIVAFGKIQLLPRFD 861 L R+Q G++ D+ GGT ++SN+G++GGT +P+I+P +V I A G I+ LPRF+ Sbjct: 154 LNRLQKLGSAGQLSTNDLIGGTFTLSNIGSIGGTYAKPVILPPEVAIGALGTIKALPRFN 213 Query: 862 AEMRIVAKCILNVTWAADHRVVDGATVARAATLWKS-LEN 900 + + I+NV+W+ADHR++DGATV+R + LWKS LEN Sbjct: 214 EKGEVCKAQIMNVSWSADHRIIDGATVSRFSNLWKSYLEN 253
>pdb|2IHW|A Chain A, Crystal Structure Of A Cubic Core Of The Dihydrolipoamide Acyltransferase (E2b) Component In The Branched-Chain Alpha-Ketoacid Dehydrogenase Complex (Bckdc), Apo Form Length = 262 Back     alignment and structure
>pdb|1B5S|A Chain A, Dihydrolipoyl Transacetylase (E.C.2.3.1.12) Catalytic Domain (Residues 184-425) From Bacillus Stearothermophilus Length = 242 Back     alignment and structure
>pdb|1B5S|A Chain A, Dihydrolipoyl Transacetylase (E.C.2.3.1.12) Catalytic Domain (Residues 184-425) From Bacillus Stearothermophilus Length = 242 Back     alignment and structure
>pdb|3DUF|I Chain I, Snapshots Of Catalysis In The E1 Subunit Of The Pyruvate Dehydrogenase Multi-Enzyme Complex Length = 428 Back     alignment and structure
>pdb|3DUF|I Chain I, Snapshots Of Catalysis In The E1 Subunit Of The Pyruvate Dehydrogenase Multi-Enzyme Complex Length = 428 Back     alignment and structure
>pdb|1K8O|A Chain A, Solution Structure Of The Lipoic Acid-Bearing Domain Of The E2 Component Of Human, Mitochondrial Branched-Chain Alpha- Ketoacid Dehydrogenase Length = 93 Back     alignment and structure
>pdb|1K8O|A Chain A, Solution Structure Of The Lipoic Acid-Bearing Domain Of The E2 Component Of Human, Mitochondrial Branched-Chain Alpha- Ketoacid Dehydrogenase Length = 93 Back     alignment and structure
>pdb|3MAE|A Chain A, Crystal Structure Of Probable Dihydrolipamide Acetyltransferase From Listeria Monocytogenes 4b F2365 Length = 256 Back     alignment and structure
>pdb|3MAE|A Chain A, Crystal Structure Of Probable Dihydrolipamide Acetyltransferase From Listeria Monocytogenes 4b F2365 Length = 256 Back     alignment and structure
>pdb|1C4T|A Chain A, Catalytic Domain From Trimeric Dihydrolipoamide Succinyltransferase Length = 233 Back     alignment and structure
>pdb|1C4T|A Chain A, Catalytic Domain From Trimeric Dihydrolipoamide Succinyltransferase Length = 233 Back     alignment and structure
>pdb|1DPC|A Chain A, Crystallographic And Enzymatic Investigations On The Role Of Ser558, His610 And Asn614 In The Catalytic Mechanism Of Azotobacter Vinelandii Dihydrolipoamide Acetyltransferase (E2p) Length = 243 Back     alignment and structure
>pdb|1DPC|A Chain A, Crystallographic And Enzymatic Investigations On The Role Of Ser558, His610 And Asn614 In The Catalytic Mechanism Of Azotobacter Vinelandii Dihydrolipoamide Acetyltransferase (E2p) Length = 243 Back     alignment and structure
>pdb|3RQC|A Chain A, Crystal Structure Of The Catalytic Core Of The 2-Oxoacid Dehydrogenase Multienzyme Complex From Thermoplasma Acidophilum Length = 224 Back     alignment and structure
>pdb|3RQC|A Chain A, Crystal Structure Of The Catalytic Core Of The 2-Oxoacid Dehydrogenase Multienzyme Complex From Thermoplasma Acidophilum Length = 224 Back     alignment and structure
>pdb|1DPD|A Chain A, Crystallographic And Enzymatic Investigations On The Role Of Ser558, His610 And Asn614 In The Catalytic Mechanism Of Azotobacter Vinelandii Dihydrolipoamide Acetyltransferase (E2p) Length = 243 Back     alignment and structure
>pdb|1DPD|A Chain A, Crystallographic And Enzymatic Investigations On The Role Of Ser558, His610 And Asn614 In The Catalytic Mechanism Of Azotobacter Vinelandii Dihydrolipoamide Acetyltransferase (E2p) Length = 243 Back     alignment and structure
>pdb|1EAA|A Chain A, Atomic Structure Of The Cubic Core Of The Pyruvate Dehydrogenase Multienzyme Complex Length = 243 Back     alignment and structure
>pdb|1EAA|A Chain A, Atomic Structure Of The Cubic Core Of The Pyruvate Dehydrogenase Multienzyme Complex Length = 243 Back     alignment and structure
>pdb|1DPB|A Chain A, Crystallographic And Enzymatic Investigations On The Role Of Ser558, His610 And Asn614 In The Catalytic Mechanism Of Azotobacter Vinelandii Dihydrolipoamide Acetyltransferase (E2p) Length = 243 Back     alignment and structure
>pdb|1DPB|A Chain A, Crystallographic And Enzymatic Investigations On The Role Of Ser558, His610 And Asn614 In The Catalytic Mechanism Of Azotobacter Vinelandii Dihydrolipoamide Acetyltransferase (E2p) Length = 243 Back     alignment and structure
>pdb|3B8K|A Chain A, Structure Of The Truncated Human Dihydrolipoyl Acetyltransferase (E2) Length = 239 Back     alignment and structure
>pdb|3B8K|A Chain A, Structure Of The Truncated Human Dihydrolipoyl Acetyltransferase (E2) Length = 239 Back     alignment and structure
>pdb|1LAB|A Chain A, Three-Dimensional Structure Of The Lipoyl Domain From Bacillus Stearothermophilus Pyruvate Dehydrogenase Multienzyme Complex Length = 80 Back     alignment and structure
>pdb|1LAB|A Chain A, Three-Dimensional Structure Of The Lipoyl Domain From Bacillus Stearothermophilus Pyruvate Dehydrogenase Multienzyme Complex Length = 80 Back     alignment and structure
>pdb|3L60|A Chain A, Crystal Structure Of Branched-Chain Alpha-Keto Acid Dehydrogenase Subunit E2 From Mycobacterium Tuberculosis Length = 250 Back     alignment and structure
>pdb|3L60|A Chain A, Crystal Structure Of Branched-Chain Alpha-Keto Acid Dehydrogenase Subunit E2 From Mycobacterium Tuberculosis Length = 250 Back     alignment and structure
>pdb|2L5T|A Chain A, Solution Nmr Structure Of E2 Lipoyl Domain From Thermoplasma Acidophilum Length = 77 Back     alignment and structure
>pdb|2L5T|A Chain A, Solution Nmr Structure Of E2 Lipoyl Domain From Thermoplasma Acidophilum Length = 77 Back     alignment and structure
>pdb|2XT6|A Chain A, Crystal Structure Of Mycobacterium Smegmatis Alpha-Ketoglutarate Decarboxylase Homodimer (Orthorhombic Form) Length = 1113 Back     alignment and structure
>pdb|2XT6|A Chain A, Crystal Structure Of Mycobacterium Smegmatis Alpha-Ketoglutarate Decarboxylase Homodimer (Orthorhombic Form) Length = 1113 Back     alignment and structure
>pdb|2COO|A Chain A, Solution Structure Of The E3_binding Domain Of Dihydrolipoamide Branched Chaintransacylase Length = 70 Back     alignment and structure
>pdb|1ZWV|A Chain A, Solution Structure Of The Subunit Binding Domain (Hbsbd) Of The Human Mitochondrial Branched-Chain Alpha-Ketoacid Dehydrogenase Length = 58 Back     alignment and structure
>pdb|1W85|I Chain I, The Crystal Structure Of Pyruvate Dehydrogenase E1 Bound To The Peripheral Subunit Binding Domain Of E2 Length = 49 Back     alignment and structure
>pdb|3RNM|E Chain E, The Crystal Structure Of The Subunit Binding Of Human Dihydrolipoamide Transacylase (E2b) Bound To Human Dihydrolipoamide Dehydrogenase (E3) Length = 58 Back     alignment and structure
>pdb|2PDD|A Chain A, The High Resolution Structure Of The Peripheral Subunit- Binding Domain Of Dihydrolipoamide Acetyltransferase From The Pyruvate Dehydrogenase Multienzyme Complex Of Bacillus Stearothermophilus Length = 43 Back     alignment and structure
>pdb|2PDE|A Chain A, The High Resolution Structure Of The Peripheral Subunit-Binding Domain Of Dihydrolipoamide Acetyltransferase From The Pyruvate Dehydrogenase Multienzyme Complex Of Bacillus Stearothermophilus Length = 43 Back     alignment and structure
>pdb|1EBD|C Chain C, Dihydrolipoamide Dehydrogenase Complexed With The Binding Domain Of The Dihydrolipoamide Acetylase Length = 41 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1045
2ii3_A262 Lipoamide acyltransferase component of branched-C 1e-79
2ii3_A262 Lipoamide acyltransferase component of branched-C 1e-54
3dva_I428 Dihydrolipoyllysine-residue acetyltransferase comp 8e-77
3dva_I428 Dihydrolipoyllysine-residue acetyltransferase comp 2e-35
3dva_I428 Dihydrolipoyllysine-residue acetyltransferase comp 3e-29
1dpb_A243 Dihydrolipoyl-transacetylase; dihydrolipoamide ace 6e-53
1dpb_A243 Dihydrolipoyl-transacetylase; dihydrolipoamide ace 2e-35
3l60_A250 Branched-chain alpha-keto acid dehydrogenase; stru 6e-50
3l60_A250 Branched-chain alpha-keto acid dehydrogenase; stru 1e-33
3rqc_A224 Probable lipoamide acyltransferase; alpha beta fol 1e-44
3rqc_A224 Probable lipoamide acyltransferase; alpha beta fol 2e-30
3b8k_A239 PDCE2;, dihydrolipoyllysine-residue acetyltransfer 2e-43
3b8k_A239 PDCE2;, dihydrolipoyllysine-residue acetyltransfer 5e-32
3mae_A256 2-oxoisovalerate dehydrogenase E2 component, dihyd 4e-39
3mae_A256 2-oxoisovalerate dehydrogenase E2 component, dihyd 3e-23
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehy 2e-32
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehy 6e-32
1scz_A233 E2, dihydrolipoamide succinyltransferase; COA-depe 6e-27
1scz_A233 E2, dihydrolipoamide succinyltransferase; COA-depe 9e-17
2l5t_A77 Lipoamide acyltransferase; E2 lipoyl domain; NMR { 2e-21
2l5t_A77 Lipoamide acyltransferase; E2 lipoyl domain; NMR { 5e-21
1zy8_K229 Pyruvate dehydrogenase protein X component, mitoch 7e-21
1zy8_K229 Pyruvate dehydrogenase protein X component, mitoch 8e-18
3cla_A213 Type III chloramphenicol acetyltransferase; transf 1e-18
3cla_A213 Type III chloramphenicol acetyltransferase; transf 9e-12
1q23_A219 Chloramphenicol acetyltransferase; CAT I, trimer, 3e-18
1q23_A219 Chloramphenicol acetyltransferase; CAT I, trimer, 3e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-10
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
3rnm_E58 Lipoamide acyltransferase component of branched-C 3e-12
3rnm_E58 Lipoamide acyltransferase component of branched-C 9e-06
2coo_A70 Lipoamide acyltransferase component of branched- c 3e-11
2coo_A70 Lipoamide acyltransferase component of branched- c 1e-05
2eq7_C40 2-oxoglutarate dehydrogenase E2 component; protein 2e-10
2eq7_C40 2-oxoglutarate dehydrogenase E2 component; protein 1e-04
2xt6_A 1113 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET 7e-10
2xt6_A 1113 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET 5e-08
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase comp 1e-09
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase comp 4e-09
1bal_A51 Dihydrolipoamide succinyltransferase; glycolysis; 3e-09
1bal_A51 Dihydrolipoamide succinyltransferase; glycolysis; 2e-04
1w85_I49 Dihydrolipoyllysine-residue acetyltransferase comp 3e-09
1w4i_A62 Pyruvate dehydrogenase E2; transferase, peripheral 5e-09
1w4i_A62 Pyruvate dehydrogenase E2; transferase, peripheral 4e-04
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase COM 7e-09
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase COM 7e-09
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, 4e-08
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, 1e-07
2i9d_A217 Chloramphenicol acetyltransferase; structural geno 4e-08
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl dom 5e-08
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl dom 1e-07
2dne_A108 Dihydrolipoyllysine-residue acetyltransferase comp 9e-08
2dne_A108 Dihydrolipoyllysine-residue acetyltransferase comp 9e-08
2eq9_C41 Pyruvate dehydrogenase complex, dihydrolipoamide a 2e-07
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic 5e-07
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic 5e-07
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component 7e-07
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component 9e-07
2eq8_C40 Pyruvate dehydrogenase complex, dihydrolipoamide a 9e-07
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, 1e-06
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, 1e-06
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, 4e-06
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, 4e-06
3va7_A1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 6e-06
3va7_A1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 2e-04
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase COM 2e-05
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase COM 2e-05
1z6h_A72 Biotin/lipoyl attachment protein; solution structu 3e-05
1z6h_A72 Biotin/lipoyl attachment protein; solution structu 3e-05
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; bio 3e-04
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; bio 3e-04
>2ii3_A Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex...; cubic core, HOMO trimer, oxidized COA-bound form; HET: CAO; 2.17A {Bos taurus} PDB: 2ihw_A* 2ii4_A* 2ii5_A* Length = 262 Back     alignment and structure
 Score =  259 bits (665), Expect = 1e-79
 Identities = 96/223 (43%), Positives = 148/223 (66%), Gaps = 2/223 (0%)

Query: 680 VIPIRGYVKGMFKSMTEANTIPSLRLTEEVDTTQLRDVKNQVSALYQEKFRLKLTYMPFF 739
             P++G+ K M K+M+ A  IP     +EVD T+L  ++ ++  +   +  +KL++MPFF
Sbjct: 33  TEPVKGFHKAMVKTMSAALKIPHFGYCDEVDLTELVKLREELKPIAFAR-GIKLSFMPFF 91

Query: 740 IKALSLCMTEHPILNASIDPTQENILVNPDHNISIAIDTKHGLVVPNIKSVNKLCLLDIT 799
           +KA SL + + PILNAS+D   +NI     HNI IA+DT+ GL+VPN+K+V    + +I 
Sbjct: 92  LKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQIRSIFEIA 151

Query: 800 RELLRIQGCSHEGKVLPRDIQGGTISMSNVGNVGGTLVQPIIVPGQVCIVAFGKIQLLPR 859
            EL R+Q     G++   D+ GGT ++SN+G++GGT  +P+I+P +V I A G I+ LPR
Sbjct: 152 TELNRLQKLGSAGQLSTNDLIGGTFTLSNIGSIGGTYAKPVILPPEVAIGALGTIKALPR 211

Query: 860 FDAEMRIVAKCILNVTWAADHRVVDGATVARAATLWKS-LENI 901
           F+ +  +    I+NV+W+ADHR++DGATV+R + LWKS LEN 
Sbjct: 212 FNEKGEVCKAQIMNVSWSADHRIIDGATVSRFSNLWKSYLENP 254


>2ii3_A Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex...; cubic core, HOMO trimer, oxidized COA-bound form; HET: CAO; 2.17A {Bos taurus} PDB: 2ihw_A* 2ii4_A* 2ii5_A* Length = 262 Back     alignment and structure
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 Back     alignment and structure
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 Back     alignment and structure
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 Back     alignment and structure
>1dpb_A Dihydrolipoyl-transacetylase; dihydrolipoamide acetyltransferase; 2.50A {Azotobacter vinelandii} SCOP: c.43.1.1 PDB: 1dpd_A 1eaa_A 1eab_A* 1eac_A* 1ead_A* 1eae_A* 1eaf_A 1dpc_A Length = 243 Back     alignment and structure
>1dpb_A Dihydrolipoyl-transacetylase; dihydrolipoamide acetyltransferase; 2.50A {Azotobacter vinelandii} SCOP: c.43.1.1 PDB: 1dpd_A 1eaa_A 1eab_A* 1eac_A* 1ead_A* 1eae_A* 1eaf_A 1dpc_A Length = 243 Back     alignment and structure
>3l60_A Branched-chain alpha-keto acid dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.00A {Mycobacterium tuberculosis} Length = 250 Back     alignment and structure
>3l60_A Branched-chain alpha-keto acid dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.00A {Mycobacterium tuberculosis} Length = 250 Back     alignment and structure
>3rqc_A Probable lipoamide acyltransferase; alpha beta fold; 4.01A {Thermoplasma acidophilum dsm 1728} Length = 224 Back     alignment and structure
>3rqc_A Probable lipoamide acyltransferase; alpha beta fold; 4.01A {Thermoplasma acidophilum dsm 1728} Length = 224 Back     alignment and structure
>3b8k_A PDCE2;, dihydrolipoyllysine-residue acetyltransferase; central beta-sheet surrounded by five alpha-helices; 8.80A {Homo sapiens} Length = 239 Back     alignment and structure
>3b8k_A PDCE2;, dihydrolipoyllysine-residue acetyltransferase; central beta-sheet surrounded by five alpha-helices; 8.80A {Homo sapiens} Length = 239 Back     alignment and structure
>3mae_A 2-oxoisovalerate dehydrogenase E2 component, dihydrolipamide acetyltransferase; 2-oxoacid dehydrogenases acyltransferase; 2.50A {Listeria monocytogenes} Length = 256 Back     alignment and structure
>3mae_A 2-oxoisovalerate dehydrogenase E2 component, dihydrolipamide acetyltransferase; 2-oxoacid dehydrogenases acyltransferase; 2.50A {Listeria monocytogenes} Length = 256 Back     alignment and structure
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Length = 93 Back     alignment and structure
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Length = 93 Back     alignment and structure
>1scz_A E2, dihydrolipoamide succinyltransferase; COA-dependent acyltransferase, CAT-like, alpha and beta (2 L mixed beta-sheeet of 6 strands; 2.20A {Escherichia coli} SCOP: c.43.1.1 PDB: 1e2o_A 1c4t_A Length = 233 Back     alignment and structure
>1scz_A E2, dihydrolipoamide succinyltransferase; COA-dependent acyltransferase, CAT-like, alpha and beta (2 L mixed beta-sheeet of 6 strands; 2.20A {Escherichia coli} SCOP: c.43.1.1 PDB: 1e2o_A 1c4t_A Length = 233 Back     alignment and structure
>2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Length = 77 Back     alignment and structure
>2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Length = 77 Back     alignment and structure
>3cla_A Type III chloramphenicol acetyltransferase; transferase (acyltransferase); HET: CLM; 1.75A {Escherichia coli} SCOP: c.43.1.1 PDB: 1cla_A* 2cla_A 4cla_A* 1cia_A 1qca_A* Length = 213 Back     alignment and structure
>3cla_A Type III chloramphenicol acetyltransferase; transferase (acyltransferase); HET: CLM; 1.75A {Escherichia coli} SCOP: c.43.1.1 PDB: 1cla_A* 2cla_A 4cla_A* 1cia_A 1qca_A* Length = 213 Back     alignment and structure
>1q23_A Chloramphenicol acetyltransferase; CAT I, trimer, fusidic acid; HET: FUA; 2.18A {Escherichia coli} SCOP: c.43.1.1 PDB: 1noc_B 1pd5_A* 3u9b_A 3u9f_A* Length = 219 Back     alignment and structure
>1q23_A Chloramphenicol acetyltransferase; CAT I, trimer, fusidic acid; HET: FUA; 2.18A {Escherichia coli} SCOP: c.43.1.1 PDB: 1noc_B 1pd5_A* 3u9b_A 3u9f_A* Length = 219 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3rnm_E Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex,...; protein-protein interaction, redox protein; HET: FAD NHE; 2.40A {Homo sapiens} PDB: 1zwv_A Length = 58 Back     alignment and structure
>3rnm_E Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex,...; protein-protein interaction, redox protein; HET: FAD NHE; 2.40A {Homo sapiens} PDB: 1zwv_A Length = 58 Back     alignment and structure
>2coo_A Lipoamide acyltransferase component of branched- chain alpha-keto acid dehydrogenase...; E3_binding domain; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2coo_A Lipoamide acyltransferase component of branched- chain alpha-keto acid dehydrogenase...; E3_binding domain; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2eq7_C 2-oxoglutarate dehydrogenase E2 component; protein-protein complex, oxidoreductase; HET: FAD NAD; 1.80A {Thermus thermophilus} Length = 40 Back     alignment and structure
>2eq7_C 2-oxoglutarate dehydrogenase E2 component; protein-protein complex, oxidoreductase; HET: FAD NAD; 1.80A {Thermus thermophilus} Length = 40 Back     alignment and structure
>2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} Length = 1113 Back     alignment and structure
>2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} Length = 1113 Back     alignment and structure
>2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Length = 85 Back     alignment and structure
>2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Length = 85 Back     alignment and structure
>1bal_A Dihydrolipoamide succinyltransferase; glycolysis; NMR {Escherichia coli} SCOP: a.9.1.1 PDB: 1bbl_A 1w4h_A 2wav_A 2wxc_A 2btg_A 2bth_A 2cyu_A Length = 51 Back     alignment and structure
>1bal_A Dihydrolipoamide succinyltransferase; glycolysis; NMR {Escherichia coli} SCOP: a.9.1.1 PDB: 1bbl_A 1w4h_A 2wav_A 2wxc_A 2btg_A 2bth_A 2cyu_A Length = 51 Back     alignment and structure
>1w85_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: a.9.1.1 PDB: 1w88_I* 1w4g_A 1w4e_A 1w4f_A 2pdd_A 2pde_A 1ebd_C* Length = 49 Back     alignment and structure
>1w4i_A Pyruvate dehydrogenase E2; transferase, peripheral-subunit binding domain, ultrafast folding, homologues,; NMR {Pyrobaculum aerophilum} PDB: 1w4j_A 1w4k_A Length = 62 Back     alignment and structure
>1w4i_A Pyruvate dehydrogenase E2; transferase, peripheral-subunit binding domain, ultrafast folding, homologues,; NMR {Pyrobaculum aerophilum} PDB: 1w4j_A 1w4k_A Length = 62 Back     alignment and structure
>1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Length = 128 Back     alignment and structure
>1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Length = 128 Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Length = 80 Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Length = 80 Back     alignment and structure
>2i9d_A Chloramphenicol acetyltransferase; structural genomics, PSI- protein structure initiative, midwest center for structural genomics; 2.30A {Bacteroides thetaiotaomicron} Length = 217 Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Length = 81 Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Length = 81 Back     alignment and structure
>2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2eq9_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 2.09A {Thermus thermophilus} Length = 41 Back     alignment and structure
>2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Length = 79 Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Length = 79 Back     alignment and structure
>2eq8_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 1.94A {Thermus thermophilus} Length = 40 Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Length = 1236 Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Length = 1236 Back     alignment and structure
>3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Length = 87 Back     alignment and structure
>3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Length = 87 Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Length = 72 Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Length = 72 Back     alignment and structure
>2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Length = 99 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1045
3dva_I428 Dihydrolipoyllysine-residue acetyltransferase comp 100.0
3mae_A256 2-oxoisovalerate dehydrogenase E2 component, dihyd 100.0
2ii3_A262 Lipoamide acyltransferase component of branched-C 100.0
1dpb_A243 Dihydrolipoyl-transacetylase; dihydrolipoamide ace 100.0
3l60_A250 Branched-chain alpha-keto acid dehydrogenase; stru 100.0
1scz_A233 E2, dihydrolipoamide succinyltransferase; COA-depe 100.0
3rqc_A224 Probable lipoamide acyltransferase; alpha beta fol 100.0
3b8k_A239 PDCE2;, dihydrolipoyllysine-residue acetyltransfer 100.0
1scz_A233 E2, dihydrolipoamide succinyltransferase; COA-depe 100.0
3mae_A256 2-oxoisovalerate dehydrogenase E2 component, dihyd 100.0
1dpb_A243 Dihydrolipoyl-transacetylase; dihydrolipoamide ace 100.0
2xt6_A 1113 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET 100.0
2ii3_A262 Lipoamide acyltransferase component of branched-C 100.0
3l60_A250 Branched-chain alpha-keto acid dehydrogenase; stru 100.0
3b8k_A239 PDCE2;, dihydrolipoyllysine-residue acetyltransfer 100.0
3rqc_A224 Probable lipoamide acyltransferase; alpha beta fol 100.0
3dva_I428 Dihydrolipoyllysine-residue acetyltransferase comp 100.0
1q23_A219 Chloramphenicol acetyltransferase; CAT I, trimer, 100.0
3cla_A213 Type III chloramphenicol acetyltransferase; transf 100.0
2i9d_A217 Chloramphenicol acetyltransferase; structural geno 100.0
2xt6_A 1113 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET 99.97
1q23_A219 Chloramphenicol acetyltransferase; CAT I, trimer, 99.95
1zy8_K229 Pyruvate dehydrogenase protein X component, mitoch 99.95
3cla_A213 Type III chloramphenicol acetyltransferase; transf 99.94
2i9d_A217 Chloramphenicol acetyltransferase; structural geno 99.92
1zy8_K229 Pyruvate dehydrogenase protein X component, mitoch 99.91
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase COM 99.7
2dne_A108 Dihydrolipoyllysine-residue acetyltransferase comp 99.68
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase COM 99.66
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic 99.66
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehy 99.63
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase COM 99.61
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic 99.59
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase COM 99.59
2dne_A108 Dihydrolipoyllysine-residue acetyltransferase comp 99.58
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase c 99.57
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehy 99.55
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, 99.52
2l5t_A77 Lipoamide acyltransferase; E2 lipoyl domain; NMR { 99.52
1pmr_A80 Dihydrolipoyl succinyltransferase; 2-oxoglutarate 99.51
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase c 99.5
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component 99.45
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, 99.45
2l5t_A77 Lipoamide acyltransferase; E2 lipoyl domain; NMR { 99.44
1pmr_A80 Dihydrolipoyl succinyltransferase; 2-oxoglutarate 99.42
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl dom 99.4
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component 99.37
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl dom 99.3
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase comp 99.29
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase comp 99.17
2jku_A94 Propionyl-COA carboxylase alpha chain, mitochondri 99.15
1z6h_A72 Biotin/lipoyl attachment protein; solution structu 99.12
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, 99.12
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, 99.05
2eq9_C41 Pyruvate dehydrogenase complex, dihydrolipoamide a 99.04
3rnm_E58 Lipoamide acyltransferase component of branched-C 99.02
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, 99.02
1z6h_A72 Biotin/lipoyl attachment protein; solution structu 99.01
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; bioti 99.0
2eq8_C40 Pyruvate dehydrogenase complex, dihydrolipoamide a 99.0
2jku_A94 Propionyl-COA carboxylase alpha chain, mitochondri 99.0
2eq7_C40 2-oxoglutarate dehydrogenase E2 component; protein 98.99
1bdo_A80 Acetyl-COA carboxylase; BCCPSC, carboxyl transfera 98.98
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; bio 98.97
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta s 98.97
1w85_I49 Dihydrolipoyllysine-residue acetyltransferase comp 98.95
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, 98.93
1bal_A51 Dihydrolipoamide succinyltransferase; glycolysis; 98.93
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; bioti 98.88
1bdo_A80 Acetyl-COA carboxylase; BCCPSC, carboxyl transfera 98.87
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta s 98.85
3n6r_A681 Propionyl-COA carboxylase, alpha subunit; protein 98.84
2coo_A70 Lipoamide acyltransferase component of branched- c 98.83
2f60_K64 Pyruvate dehydrogenase protein X component; protei 98.82
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; bio 98.81
3va7_A1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 98.77
1w4i_A62 Pyruvate dehydrogenase E2; transferase, peripheral 98.77
3hbl_A1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 98.75
3u9t_A675 MCC alpha, methylcrotonyl-COA carboxylase, alpha-s 98.73
3n6r_A681 Propionyl-COA carboxylase, alpha subunit; protein 98.69
2eq9_C41 Pyruvate dehydrogenase complex, dihydrolipoamide a 98.65
3va7_A1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 98.63
2eq7_C40 2-oxoglutarate dehydrogenase E2 component; protein 98.62
2eq8_C40 Pyruvate dehydrogenase complex, dihydrolipoamide a 98.6
3rnm_E58 Lipoamide acyltransferase component of branched-C 98.59
1bal_A51 Dihydrolipoamide succinyltransferase; glycolysis; 98.59
3hbl_A1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 98.58
1zko_A136 Glycine cleavage system H protein; TM0212, structu 98.57
3u9t_A675 MCC alpha, methylcrotonyl-COA carboxylase, alpha-s 98.54
1w85_I49 Dihydrolipoyllysine-residue acetyltransferase comp 98.5
2k32_A116 A; NMR {Campylobacter jejuni} PDB: 2k33_A* 98.46
3bg3_A718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 98.44
2coo_A70 Lipoamide acyltransferase component of branched- c 98.4
2qf7_A1165 Pyruvate carboxylase protein; multi-domain, multi- 98.35
1w4i_A62 Pyruvate dehydrogenase E2; transferase, peripheral 98.3
2k32_A116 A; NMR {Campylobacter jejuni} PDB: 2k33_A* 98.29
1zko_A136 Glycine cleavage system H protein; TM0212, structu 98.29
2f60_K64 Pyruvate dehydrogenase protein X component; protei 98.26
3bg3_A718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 98.23
3a7l_A128 H-protein, glycine cleavage system H protein; lipo 98.17
2qf7_A1165 Pyruvate carboxylase protein; multi-domain, multi- 98.15
1hpc_A131 H protein of the glycine cleavage system; transit 98.14
1onl_A128 Glycine cleavage system H protein; hybrid barrel-s 98.14
1hpc_A131 H protein of the glycine cleavage system; transit 97.73
1onl_A128 Glycine cleavage system H protein; hybrid barrel-s 97.73
3a7l_A128 H-protein, glycine cleavage system H protein; lipo 97.7
3ne5_B413 Cation efflux system protein CUSB; transmembrane h 97.3
2f1m_A277 Acriflavine resistance protein A; helical hairpin, 97.21
3klr_A125 Glycine cleavage system H protein; antiparallel be 97.19
3lnn_A359 Membrane fusion protein (MFP) heavy metal cation Z 97.15
3fpp_A341 Macrolide-specific efflux protein MACA; hexameric 97.11
3mxu_A143 Glycine cleavage system H protein; seattle structu 97.01
3ne5_B413 Cation efflux system protein CUSB; transmembrane h 97.0
2f1m_A277 Acriflavine resistance protein A; helical hairpin, 96.97
3tzu_A137 GCVH, glycine cleavage system H protein 1; ssgcid, 96.9
3lnn_A359 Membrane fusion protein (MFP) heavy metal cation Z 96.87
3klr_A125 Glycine cleavage system H protein; antiparallel be 96.85
3fpp_A341 Macrolide-specific efflux protein MACA; hexameric 96.8
1vf7_A369 Multidrug resistance protein MEXA; alpha hairpin, 96.75
3mxu_A143 Glycine cleavage system H protein; seattle structu 96.67
3hgb_A155 Glycine cleavage system H protein; ssgcid, niaid, 96.55
3tzu_A137 GCVH, glycine cleavage system H protein 1; ssgcid, 96.53
1vf7_A369 Multidrug resistance protein MEXA; alpha hairpin, 96.41
3hgb_A155 Glycine cleavage system H protein; ssgcid, niaid, 96.02
4dk0_A369 Putative MACA; alpha-hairpin, lipoyl, beta-barrel, 95.74
4dk0_A369 Putative MACA; alpha-hairpin, lipoyl, beta-barrel, 95.02
3cdx_A354 Succinylglutamatedesuccinylase/aspartoacylase; str 94.53
3na6_A331 Succinylglutamate desuccinylase/aspartoacylase; st 94.29
3fmc_A368 Putative succinylglutamate desuccinylase / aspart; 93.61
2o95_A187 26S proteasome non-ATPase regulatory subunit 7; PS 93.55
3cdx_A354 Succinylglutamatedesuccinylase/aspartoacylase; str 92.88
3na6_A331 Succinylglutamate desuccinylase/aspartoacylase; st 92.65
1f3z_A161 EIIA-GLC, glucose-specific phosphocarrier; phospho 92.09
3fmc_A368 Putative succinylglutamate desuccinylase / aspart; 91.72
2gpr_A154 Glucose-permease IIA component; phosphotransferase 90.79
1f3z_A161 EIIA-GLC, glucose-specific phosphocarrier; phospho 90.06
1ax3_A162 Iiaglc, glucose permease IIA domain; phosphotransf 89.84
4e0q_A141 COP9 signalosome complex subunit 6; MPN (MPR1P and 89.54
2gpr_A154 Glucose-permease IIA component; phosphotransferase 88.67
2qj8_A332 MLR6093 protein; structural genomics, joint center 88.19
4b4t_U338 RPN8, 26S proteasome regulatory subunit RPN8; hydr 86.46
1ax3_A162 Iiaglc, glucose permease IIA domain; phosphotransf 86.44
2xha_A193 NUSG, transcription antitermination protein NUSG; 86.14
2qj8_A332 MLR6093 protein; structural genomics, joint center 82.82
2xha_A193 NUSG, transcription antitermination protein NUSG; 82.01
4b4t_V306 26S proteasome regulatory subunit RPN11; hydrolase 80.25
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Back     alignment and structure
Probab=100.00  E-value=6.4e-80  Score=715.98  Aligned_cols=401  Identities=32%  Similarity=0.513  Sum_probs=39.5

Q ss_pred             eEEEEecCCCCCcceeEEEEeeeccCCCCeeccCCeEeEEeccceeeEEecCCCEEEEEEeeCCCCEEecCCceEEEeec
Q psy6394         447 LIQFNLADIGEGIREVNIKEWNGNVTEGARINEFDVVCEVESDKASVTITSRYKGTVRKVYYGEGDVALVGKPLLDIEVE  526 (1045)
Q Consensus       447 ~~~i~~P~lge~~~eg~i~~w~~~v~~Gd~V~~gd~l~~vetdKa~~ei~ap~~G~v~~i~~~~G~~v~vg~~l~~i~~~  526 (1045)
                      .++|+||+||++|+||+|++|+  |++||.|++||+||+|||||++++|+||++|+|.++++++|+.|.+|++|+.|+.+
T Consensus         2 ~~~i~mP~lg~~~~eg~i~~w~--v~~Gd~V~~gd~l~~vEt~K~~~~i~ap~~G~v~~i~v~~G~~V~~G~~l~~i~~~   79 (428)
T 3dva_I            2 AFEFKLPDIGEGIHEGEIVKWF--VKPGDEVNEDDVLCEVQNDKAVVEIPSPVKGKVLEILVPEGTVATVGQTLITLDAP   79 (428)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             CeeEEcCCCCCCCccEEEEEEE--cCCCCEECCCCEEEEEEeCCeeEEEecCCCeEEEEEEeCCCCEeCCCCEEEEEecC
Confidence            4689999999999999999999  99999999999999999999999999999999999999999999999999999865


Q ss_pred             Cccccccc-----cc---cccc-c--CC------CC--C--C-CCCCCCCCCCccccccCCCCCCCcCccccCCCCCccc
Q psy6394         527 DEGVAAEE-----AD---SLDR-K--AA------PG--V--S-EVNTPDTSDQPNETLHKDPNKIDTKELRGTGKQGRVL  584 (1045)
Q Consensus       527 ~~~~~~~~-----~~---~~~~-~--~~------~~--~--~-~~~~~~~~asP~vr~la~e~gidls~v~gTG~~GrI~  584 (1045)
                      ++..+...     ..   +.+. .  +.      +.  .  . ......+++||++||||+|+||||+.|+|||++|||+
T Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~asP~~R~lA~e~gvdl~~v~gtG~~GrI~  159 (428)
T 3dva_I           80 GYENMTFKGQEQEEAKKEEKTETVSKEEKVDAVAPNAPAAEAEAGPNRRVIAMPSVRKYAREKGVDIRLVQGTGKNGRVL  159 (428)
T ss_dssp             ------------------------------------------------CCCCCHHHHHHHHHTTCCGGGSCCCSTTSCCC
T ss_pred             CccccccccccccccccCCCcccCCccccccCCCccccccccccccccccccCHHHHHHHHHcCCCHHHCCCCCCCCcee
Confidence            44321110     00   0000 0  00      00  0  0 0012346899999999999999999999999999999


Q ss_pred             hHhHHhhhCCCCCCCCCCccccccccccceeeccccccccccccccccCCCccccccccccccccccchhhhcccCCCCC
Q psy6394         585 KEDIITYMNSPSDETNPAHTAHVREASNVISIRGYVKGMFKSMTEANTIPSLRLTEEVDTTQLRDVKKEDIITYMNSPSD  664 (1045)
Q Consensus       585 k~DV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~l~~~~d~~~~~~v~~~~~~~~~~~~~~  664 (1045)
                      |+||++|++.......++.+++  .                                                 ...++ 
T Consensus       160 k~DV~~~~~~~~~~~~~~~~~~--~-------------------------------------------------~~~~~-  187 (428)
T 3dva_I          160 KEDIDAFLAGGAKPAPAAAEEK--A-------------------------------------------------APAAA-  187 (428)
T ss_dssp             TTTTTTTSCC----------------------------------------------------------------------
T ss_pred             HHHHHHHhhccccccccccccc--c-------------------------------------------------ccCCC-
Confidence            9999999764321100000000  0                                                 00000 


Q ss_pred             CCCCCcccccCCcceeeecCchhhHHHHHhhhc-CCCCeeEEeecccchHHHHHHHHHHHHHHhccCcccChHHHHHHHH
Q psy6394         665 ETNPAHTAHVREASNVIPIRGYVKGMFKSMTEA-NTIPSLRLTEEVDTTQLRDVKNQVSALYQEKFRLKLTYMPFFIKAL  743 (1045)
Q Consensus       665 ~~~p~~~~~~~~~~~~~pls~~rk~ia~~m~~S-~~iP~~~~~~evD~t~l~~~r~~~~~~~~~~~~~klT~~~~likAv  743 (1045)
                        .+. ........+++||++|||.||++|.+| +++||+|++.+||+|+|+++|+++++..++.+ .|+||++|++||+
T Consensus       188 --~~~-~~~~~~~~~~~p~s~~Rk~ia~~m~~S~~~~P~~~~~~evDvt~l~~~rk~~~~~~~~~g-~kls~~~~~ikAv  263 (428)
T 3dva_I          188 --KPA-TTEGEFPETREKMSGIRRAIAKAMVHSKHTAPHVTLMDEADVTKLVAHRKKFKAIAAEKG-IKLTFLPYVVKAL  263 (428)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --Ccc-ccccCCccccccCcHHHHHHHHHHHHhcccCCeEEEEEEEeHHHHHHHHHHhhhhHhhcC-CCcCHHHHHHHHH
Confidence              000 000112366789999999999999999 79999999999999999999999997655556 9999999999999


Q ss_pred             HHHHHhCCccceEEcCCCceEEEcCCccEEEEEecCCCeeeeeecccccccHHHHHHHHHHHHhccccCCCCCCccCCCc
Q psy6394         744 SLCMTEHPILNASIDPTQENILVNPDHNISIAIDTKHGLVVPNIKSVNKLCLLDITRELLRIQGCSHEGKVLPRDIQGGT  823 (1045)
Q Consensus       744 a~aL~~~P~lNa~~~~~~~~i~~~~~vnIgiAV~t~~GL~vPvIr~ad~~sl~ei~~~l~~l~~~ar~~kl~~~d~~ggT  823 (1045)
                      ++||++||+||++|++++++|++++++|||+||++++||++|||++++.+++.+|+++++++.+++|+|+|+++|++|||
T Consensus       264 a~Al~~~P~~Na~~~~~~~~i~~~~~v~igiAV~t~~GL~vPvi~~a~~~sl~eia~~~~~l~~~ar~gkL~~~e~~ggt  343 (428)
T 3dva_I          264 VSALREYPVLNTSIDDETEEIIQKHYYNIGIAADTDRGLLVPVIKHADRKPIFALAQEINELAEKARDGKLTPGEMKGAS  343 (428)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             HHHHHhCHHhhheEecCCCeEEEcCccCeEEEEEcCCceEEeeeccCCCCCHHHHHHHHHHHHHHHHcCCCCccccCCCE
Confidence            99999999999999865578999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eEeeccCCccceeecccccccceeeEeeccceeEeEeccCCceeEEEeeeEEEeccceeecchhhhhhhhhhhhcccccc
Q psy6394         824 ISMSNVGNVGGTLVQPIIVPGQVCIVAFGKIQLLPRFDAEMRIVAKCILNVTWAADHRVVDGATVARAATLWKSLENILV  903 (1045)
Q Consensus       824 ftISNlG~~G~~~~tpii~~pq~ailavG~i~~~p~~~~~g~i~~~~~m~lslt~DhRviDGa~aa~fl~~~~~~~~ile  903 (1045)
                      |||||+|+||+++|+||||+||+|||++|+++++|++ .+|++++|++|+++|+||||||||+++++||+.|+++   |+
T Consensus       344 ftISnlG~~G~~~ftpIin~pq~aIl~vG~i~~~pv~-~~g~i~~r~~m~lsls~DHRviDG~~aa~Fl~~lk~~---Le  419 (428)
T 3dva_I          344 CTITNIGSAGGQWFTPVINHPEVAILGIGRIAEKPIV-RDGEIVAAPMLALSLSFDHRMIDGATAQKALNHIKRL---LS  419 (428)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             EEEEcCCCCCccceEeecCCCCceEEEccccEEEEEE-ECCEEEEeeeEEEEEEecccccchHHHHHHHHHHHHH---Hh
Confidence            9999999999999999999999999999999999999 6889999999999999999999999999999999999   99


Q ss_pred             cCCcce
Q psy6394         904 NPDHNI  909 (1045)
Q Consensus       904 ~p~v~I  909 (1045)
                      +|..++
T Consensus       420 ~P~~ll  425 (428)
T 3dva_I          420 DPELLL  425 (428)
T ss_dssp             ------
T ss_pred             CHHHHh
Confidence            998664



>3mae_A 2-oxoisovalerate dehydrogenase E2 component, dihydrolipamide acetyltransferase; 2-oxoacid dehydrogenases acyltransferase; 2.50A {Listeria monocytogenes} Back     alignment and structure
>2ii3_A Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex...; cubic core, HOMO trimer, oxidized COA-bound form; HET: CAO; 2.17A {Bos taurus} PDB: 2ihw_A* 2ii4_A* 2ii5_A* Back     alignment and structure
>1dpb_A Dihydrolipoyl-transacetylase; dihydrolipoamide acetyltransferase; 2.50A {Azotobacter vinelandii} SCOP: c.43.1.1 PDB: 1dpd_A 1eaa_A 1eab_A* 1eac_A* 1ead_A* 1eae_A* 1eaf_A 1dpc_A Back     alignment and structure
>3l60_A Branched-chain alpha-keto acid dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: c.43.1.0 Back     alignment and structure
>1scz_A E2, dihydrolipoamide succinyltransferase; COA-dependent acyltransferase, CAT-like, alpha and beta (2 L mixed beta-sheeet of 6 strands; 2.20A {Escherichia coli} SCOP: c.43.1.1 PDB: 1e2o_A 1c4t_A Back     alignment and structure
>3rqc_A Probable lipoamide acyltransferase; alpha beta fold; 4.01A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3b8k_A PDCE2;, dihydrolipoyllysine-residue acetyltransferase; central beta-sheet surrounded by five alpha-helices; 8.80A {Homo sapiens} Back     alignment and structure
>1scz_A E2, dihydrolipoamide succinyltransferase; COA-dependent acyltransferase, CAT-like, alpha and beta (2 L mixed beta-sheeet of 6 strands; 2.20A {Escherichia coli} SCOP: c.43.1.1 PDB: 1e2o_A 1c4t_A Back     alignment and structure
>3mae_A 2-oxoisovalerate dehydrogenase E2 component, dihydrolipamide acetyltransferase; 2-oxoacid dehydrogenases acyltransferase; 2.50A {Listeria monocytogenes} Back     alignment and structure
>1dpb_A Dihydrolipoyl-transacetylase; dihydrolipoamide acetyltransferase; 2.50A {Azotobacter vinelandii} SCOP: c.43.1.1 PDB: 1dpd_A 1eaa_A 1eab_A* 1eac_A* 1ead_A* 1eae_A* 1eaf_A 1dpc_A Back     alignment and structure
>2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} Back     alignment and structure
>2ii3_A Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex...; cubic core, HOMO trimer, oxidized COA-bound form; HET: CAO; 2.17A {Bos taurus} PDB: 2ihw_A* 2ii4_A* 2ii5_A* Back     alignment and structure
>3l60_A Branched-chain alpha-keto acid dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: c.43.1.0 Back     alignment and structure
>3b8k_A PDCE2;, dihydrolipoyllysine-residue acetyltransferase; central beta-sheet surrounded by five alpha-helices; 8.80A {Homo sapiens} Back     alignment and structure
>3rqc_A Probable lipoamide acyltransferase; alpha beta fold; 4.01A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Back     alignment and structure
>1q23_A Chloramphenicol acetyltransferase; CAT I, trimer, fusidic acid; HET: FUA; 2.18A {Escherichia coli} SCOP: c.43.1.1 PDB: 1noc_B 1pd5_A* 3u9b_A 3u9f_A* Back     alignment and structure
>3cla_A Type III chloramphenicol acetyltransferase; transferase (acyltransferase); HET: CLM; 1.75A {Escherichia coli} SCOP: c.43.1.1 PDB: 1cla_A* 2cla_A 4cla_A* 1cia_A 1qca_A* Back     alignment and structure
>2i9d_A Chloramphenicol acetyltransferase; structural genomics, PSI- protein structure initiative, midwest center for structural genomics; 2.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} Back     alignment and structure
>1q23_A Chloramphenicol acetyltransferase; CAT I, trimer, fusidic acid; HET: FUA; 2.18A {Escherichia coli} SCOP: c.43.1.1 PDB: 1noc_B 1pd5_A* 3u9b_A 3u9f_A* Back     alignment and structure
>3cla_A Type III chloramphenicol acetyltransferase; transferase (acyltransferase); HET: CLM; 1.75A {Escherichia coli} SCOP: c.43.1.1 PDB: 1cla_A* 2cla_A 4cla_A* 1cia_A 1qca_A* Back     alignment and structure
>2i9d_A Chloramphenicol acetyltransferase; structural genomics, PSI- protein structure initiative, midwest center for structural genomics; 2.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Back     alignment and structure
>2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Back     alignment and structure
>3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Back     alignment and structure
>2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Back     alignment and structure
>1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Back     alignment and structure
>2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Back     alignment and structure
>2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Back     alignment and structure
>1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Back     alignment and structure
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Back     alignment and structure
>1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Back     alignment and structure
>1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Back     alignment and structure
>2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Back     alignment and structure
>2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Back     alignment and structure
>2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eq9_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 2.09A {Thermus thermophilus} Back     alignment and structure
>3rnm_E Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex,...; protein-protein interaction, redox protein; HET: FAD NHE; 2.40A {Homo sapiens} SCOP: a.9.1.0 PDB: 1zwv_A Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Back     alignment and structure
>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A Back     alignment and structure
>2eq8_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 1.94A {Thermus thermophilus} Back     alignment and structure
>2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} Back     alignment and structure
>2eq7_C 2-oxoglutarate dehydrogenase E2 component; protein-protein complex, oxidoreductase; HET: FAD NAD; 1.80A {Thermus thermophilus} Back     alignment and structure
>1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A Back     alignment and structure
>2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Back     alignment and structure
>1w85_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: a.9.1.1 PDB: 1w88_I* 1w4g_A 1w4e_A 1w4f_A 2pdd_A 2pde_A 1ebd_C* Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bal_A Dihydrolipoamide succinyltransferase; glycolysis; NMR {Escherichia coli} SCOP: a.9.1.1 PDB: 1bbl_A 1w4h_A 2wav_A 2wxc_A 2btg_A 2bth_A 2cyu_A Back     alignment and structure
>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A Back     alignment and structure
>1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A Back     alignment and structure
>1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Back     alignment and structure
>2coo_A Lipoamide acyltransferase component of branched- chain alpha-keto acid dehydrogenase...; E3_binding domain; NMR {Homo sapiens} Back     alignment and structure
>2f60_K Pyruvate dehydrogenase protein X component; protein-binding protein, E3BD, protein binding; 1.55A {Homo sapiens} PDB: 2f5z_K Back     alignment and structure
>2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Back     alignment and structure
>1w4i_A Pyruvate dehydrogenase E2; transferase, peripheral-subunit binding domain, ultrafast folding, homologues,; NMR {Pyrobaculum aerophilum} PDB: 1w4j_A 1w4k_A Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Back     alignment and structure
>2eq9_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 2.09A {Thermus thermophilus} Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Back     alignment and structure
>2eq7_C 2-oxoglutarate dehydrogenase E2 component; protein-protein complex, oxidoreductase; HET: FAD NAD; 1.80A {Thermus thermophilus} Back     alignment and structure
>2eq8_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 1.94A {Thermus thermophilus} Back     alignment and structure
>3rnm_E Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex,...; protein-protein interaction, redox protein; HET: FAD NHE; 2.40A {Homo sapiens} SCOP: a.9.1.0 PDB: 1zwv_A Back     alignment and structure
>1bal_A Dihydrolipoamide succinyltransferase; glycolysis; NMR {Escherichia coli} SCOP: a.9.1.1 PDB: 1bbl_A 1w4h_A 2wav_A 2wxc_A 2btg_A 2bth_A 2cyu_A Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* Back     alignment and structure
>1zko_A Glycine cleavage system H protein; TM0212, structural genomi center for structural genomics, JCSG, protein structure INI PSI; HET: MSE; 1.65A {Thermotoga maritima} PDB: 2ka7_A Back     alignment and structure
>1w85_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: a.9.1.1 PDB: 1w88_I* 1w4g_A 1w4e_A 1w4f_A 2pdd_A 2pde_A 1ebd_C* Back     alignment and structure
>2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>2coo_A Lipoamide acyltransferase component of branched- chain alpha-keto acid dehydrogenase...; E3_binding domain; NMR {Homo sapiens} Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Back     alignment and structure
>1w4i_A Pyruvate dehydrogenase E2; transferase, peripheral-subunit binding domain, ultrafast folding, homologues,; NMR {Pyrobaculum aerophilum} PDB: 1w4j_A 1w4k_A Back     alignment and structure
>2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* Back     alignment and structure
>1zko_A Glycine cleavage system H protein; TM0212, structural genomi center for structural genomics, JCSG, protein structure INI PSI; HET: MSE; 1.65A {Thermotoga maritima} PDB: 2ka7_A Back     alignment and structure
>2f60_K Pyruvate dehydrogenase protein X component; protein-binding protein, E3BD, protein binding; 1.55A {Homo sapiens} PDB: 2f5z_K Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>3a7l_A H-protein, glycine cleavage system H protein; lipoic acid, lipoyl, transport protein; 1.30A {Escherichia coli} PDB: 3a7a_B 3ab9_A* 3a8i_E* 3a8j_E* 3a8k_E* Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Back     alignment and structure
>1hpc_A H protein of the glycine cleavage system; transit peptide; HET: LPA; 2.00A {Pisum sativum} SCOP: b.84.1.1 PDB: 1dxm_A* 1htp_A* Back     alignment and structure
>1onl_A Glycine cleavage system H protein; hybrid barrel-sandwich structure, structural genomics, riken structural genomics/proteomics initiative; 2.50A {Thermus thermophilus} SCOP: b.84.1.1 Back     alignment and structure
>1hpc_A H protein of the glycine cleavage system; transit peptide; HET: LPA; 2.00A {Pisum sativum} SCOP: b.84.1.1 PDB: 1dxm_A* 1htp_A* Back     alignment and structure
>1onl_A Glycine cleavage system H protein; hybrid barrel-sandwich structure, structural genomics, riken structural genomics/proteomics initiative; 2.50A {Thermus thermophilus} SCOP: b.84.1.1 Back     alignment and structure
>3a7l_A H-protein, glycine cleavage system H protein; lipoic acid, lipoyl, transport protein; 1.30A {Escherichia coli} PDB: 3a7a_B 3ab9_A* 3a8i_E* 3a8j_E* 3a8k_E* Back     alignment and structure
>3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B Back     alignment and structure
>2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} Back     alignment and structure
>3klr_A Glycine cleavage system H protein; antiparallel beta sheet, beta sandwich, oxidoreductase; HET: GOL; 0.88A {Bos taurus} SCOP: b.84.1.0 PDB: 2edg_A Back     alignment and structure
>3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} Back     alignment and structure
>3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} Back     alignment and structure
>3mxu_A Glycine cleavage system H protein; seattle structural genomics center for infectious disease, S CAT-scratch disease, bacteremia; HET: CIT; 1.80A {Bartonella henselae} Back     alignment and structure
>3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B Back     alignment and structure
>2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} Back     alignment and structure
>3tzu_A GCVH, glycine cleavage system H protein 1; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Mycobacterium marinum} Back     alignment and structure
>3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} Back     alignment and structure
>3klr_A Glycine cleavage system H protein; antiparallel beta sheet, beta sandwich, oxidoreductase; HET: GOL; 0.88A {Bos taurus} SCOP: b.84.1.0 PDB: 2edg_A Back     alignment and structure
>3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} Back     alignment and structure
>1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A Back     alignment and structure
>3mxu_A Glycine cleavage system H protein; seattle structural genomics center for infectious disease, S CAT-scratch disease, bacteremia; HET: CIT; 1.80A {Bartonella henselae} Back     alignment and structure
>3hgb_A Glycine cleavage system H protein; ssgcid, niaid, decode, UW, SBRI, lipoyl; 1.75A {Mycobacterium tuberculosis} PDB: 3ift_A Back     alignment and structure
>3tzu_A GCVH, glycine cleavage system H protein 1; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Mycobacterium marinum} Back     alignment and structure
>1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A Back     alignment and structure
>3hgb_A Glycine cleavage system H protein; ssgcid, niaid, decode, UW, SBRI, lipoyl; 1.75A {Mycobacterium tuberculosis} PDB: 3ift_A Back     alignment and structure
>4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A Back     alignment and structure
>4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A Back     alignment and structure
>3cdx_A Succinylglutamatedesuccinylase/aspartoacylase; structural genomics, PSI-2, protein structure initiative; 2.10A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3na6_A Succinylglutamate desuccinylase/aspartoacylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.00A {Ruegeria SP} Back     alignment and structure
>3fmc_A Putative succinylglutamate desuccinylase / aspart; S genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Shewanella amazonensis} PDB: 3lwu_A* Back     alignment and structure
>2o95_A 26S proteasome non-ATPase regulatory subunit 7; PSMD7, MOV34, JAB1/MPN, metal-free dimer, UN function; HET: SO4 12P ETE PG4 PGE; 1.95A {Homo sapiens} PDB: 2o96_A Back     alignment and structure
>3cdx_A Succinylglutamatedesuccinylase/aspartoacylase; structural genomics, PSI-2, protein structure initiative; 2.10A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3na6_A Succinylglutamate desuccinylase/aspartoacylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.00A {Ruegeria SP} Back     alignment and structure
>1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A Back     alignment and structure
>3fmc_A Putative succinylglutamate desuccinylase / aspart; S genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Shewanella amazonensis} PDB: 3lwu_A* Back     alignment and structure
>2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 Back     alignment and structure
>1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A Back     alignment and structure
>1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A Back     alignment and structure
>4e0q_A COP9 signalosome complex subunit 6; MPN (MPR1P and PAD1P N-terminal) domain, unknown function; 2.50A {Drosophila melanogaster} Back     alignment and structure
>2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 Back     alignment and structure
>2qj8_A MLR6093 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.00A {Mesorhizobium loti} Back     alignment and structure
>4b4t_U RPN8, 26S proteasome regulatory subunit RPN8; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A Back     alignment and structure
>2xha_A NUSG, transcription antitermination protein NUSG; 1.91A {Thermotoga maritima} Back     alignment and structure
>2qj8_A MLR6093 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.00A {Mesorhizobium loti} Back     alignment and structure
>2xha_A NUSG, transcription antitermination protein NUSG; 1.91A {Thermotoga maritima} Back     alignment and structure
>4b4t_V 26S proteasome regulatory subunit RPN11; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1045
d1scza_233 c.43.1.1 (A:) Dihydrolipoamide succinyltransferase 2e-42
d1scza_233 c.43.1.1 (A:) Dihydrolipoamide succinyltransferase 7e-28
d1q23a_214 c.43.1.1 (A:) Chloramphenicol acetyltransferase, C 8e-34
d1q23a_214 c.43.1.1 (A:) Chloramphenicol acetyltransferase, C 6e-23
d1b5sa_242 c.43.1.1 (A:) Dihydrolipoamide acetyltransferase { 8e-34
d1b5sa_242 c.43.1.1 (A:) Dihydrolipoamide acetyltransferase { 3e-25
d3claa_213 c.43.1.1 (A:) Chloramphenicol acetyltransferase, C 2e-30
d3claa_213 c.43.1.1 (A:) Chloramphenicol acetyltransferase, C 4e-22
d1dpba_243 c.43.1.1 (A:) Dihydrolipoamide acetyltransferase { 6e-26
d1dpba_243 c.43.1.1 (A:) Dihydrolipoamide acetyltransferase { 4e-18
d1k8ma_87 b.84.1.1 (A:) Lipoyl domain of the mitochondrial b 7e-18
d1k8ma_87 b.84.1.1 (A:) Lipoyl domain of the mitochondrial b 2e-17
d1laba_80 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 7e-16
d1laba_80 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 2e-15
d1ghja_79 b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate 2e-14
d1ghja_79 b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate 7e-14
d1pmra_80 b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate 2e-14
d1pmra_80 b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate 7e-14
d1gjxa_81 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 1e-13
d1gjxa_81 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 6e-13
d1y8ob1102 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoa 3e-13
d1y8ob1102 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoa 1e-12
d1qjoa_80 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 2e-12
d1qjoa_80 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 6e-12
d1iyua_79 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 8e-11
d1iyua_79 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 3e-10
d1w85i_42 a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl 9e-11
d1w85i_42 a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl 2e-04
d2cyua139 a.9.1.1 (A:2-40) E3-binding domain of dihydrolipoa 4e-08
d2cyua139 a.9.1.1 (A:2-40) E3-binding domain of dihydrolipoa 4e-04
d1dcza_77 b.84.1.1 (A:) Biotin carboxyl carrier domain of tr 2e-06
d1dcza_77 b.84.1.1 (A:) Biotin carboxyl carrier domain of tr 2e-06
d1bdoa_80 b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carbox 3e-05
d1bdoa_80 b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carbox 3e-05
>d1scza_ c.43.1.1 (A:) Dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} Length = 233 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: CoA-dependent acyltransferases
superfamily: CoA-dependent acyltransferases
family: CAT-like
domain: Dihydrolipoamide succinyltransferase
species: Escherichia coli [TaxId: 562]
 Score =  152 bits (385), Expect = 2e-42
 Identities = 56/222 (25%), Positives = 114/222 (51%), Gaps = 5/222 (2%)

Query: 681 IPIRGYVKGMFKSMTEA-NTIPSLRLTEEVDTTQLRDVKNQVSALYQEKFRLKLTYMPFF 739
           +P+    K + + + EA N+   L    EV+   + D++ Q    ++++  ++L +M F+
Sbjct: 7   VPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFY 66

Query: 740 IKALSLCMTEHPILNASIDPTQENILVNPDHNISIAIDTKHGLVVPNIKSVNKLCLLDIT 799
           +KA+   +  +P +NASID   ++++ +   ++S+A+ T  GLV P ++ V+ L + DI 
Sbjct: 67  VKAVVEALKRYPEVNASID--GDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMADIE 124

Query: 800 RELLRIQGCSHEGKVLPRDIQGGTISMSNVGNVGGTLVQPIIVPGQVCIVAFGKIQLLPR 859
           +++  +     +GK+   D+ GG  +++N G  G  +  PII P Q  I+    I+  P 
Sbjct: 125 KKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPM 184

Query: 860 FDAEMRIVAKCILNVTWAADHRVVDGATVARAATLWKS-LEN 900
                ++    ++ +  + DHR++DG          K  LE+
Sbjct: 185 AV-NGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLED 225


>d1scza_ c.43.1.1 (A:) Dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} Length = 233 Back     information, alignment and structure
>d1q23a_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} Length = 214 Back     information, alignment and structure
>d1q23a_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} Length = 214 Back     information, alignment and structure
>d1b5sa_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 242 Back     information, alignment and structure
>d1b5sa_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 242 Back     information, alignment and structure
>d3claa_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} Length = 213 Back     information, alignment and structure
>d3claa_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} Length = 213 Back     information, alignment and structure
>d1dpba_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Length = 243 Back     information, alignment and structure
>d1dpba_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Length = 243 Back     information, alignment and structure
>d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 80 Back     information, alignment and structure
>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 80 Back     information, alignment and structure
>d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Length = 79 Back     information, alignment and structure
>d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Length = 79 Back     information, alignment and structure
>d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Length = 80 Back     information, alignment and structure
>d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Length = 80 Back     information, alignment and structure
>d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Length = 81 Back     information, alignment and structure
>d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Length = 81 Back     information, alignment and structure
>d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Length = 80 Back     information, alignment and structure
>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Length = 80 Back     information, alignment and structure
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Length = 79 Back     information, alignment and structure
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Length = 79 Back     information, alignment and structure
>d1w85i_ a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 42 Back     information, alignment and structure
>d1w85i_ a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 42 Back     information, alignment and structure
>d2cyua1 a.9.1.1 (A:2-40) E3-binding domain of dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} Length = 39 Back     information, alignment and structure
>d2cyua1 a.9.1.1 (A:2-40) E3-binding domain of dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} Length = 39 Back     information, alignment and structure
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Length = 77 Back     information, alignment and structure
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Length = 77 Back     information, alignment and structure
>d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Length = 80 Back     information, alignment and structure
>d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Length = 80 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1045
d1scza_233 Dihydrolipoamide succinyltransferase {Escherichia 100.0
d1dpba_243 Dihydrolipoamide acetyltransferase {Azotobacter vi 100.0
d1b5sa_242 Dihydrolipoamide acetyltransferase {Bacillus stear 100.0
d1dpba_243 Dihydrolipoamide acetyltransferase {Azotobacter vi 100.0
d1b5sa_242 Dihydrolipoamide acetyltransferase {Bacillus stear 100.0
d1scza_233 Dihydrolipoamide succinyltransferase {Escherichia 100.0
d1q23a_214 Chloramphenicol acetyltransferase, CAT {Escherichi 99.97
d3claa_213 Chloramphenicol acetyltransferase, CAT {Escherichi 99.96
d1q23a_214 Chloramphenicol acetyltransferase, CAT {Escherichi 99.9
d3claa_213 Chloramphenicol acetyltransferase, CAT {Escherichi 99.88
d1y8ob1102 Lipoyl domain of dihydrolipoamide acetyltransferas 99.84
d1k8ma_87 Lipoyl domain of the mitochondrial branched-chain 99.82
d1ghja_79 Lipoyl domain of the 2-oxoglutarate dehydrogenase 99.81
d1laba_80 Lipoyl domain of dihydrolipoamide acetyltransferas 99.79
d1y8ob1102 Lipoyl domain of dihydrolipoamide acetyltransferas 99.79
d1ghja_79 Lipoyl domain of the 2-oxoglutarate dehydrogenase 99.78
d1k8ma_87 Lipoyl domain of the mitochondrial branched-chain 99.77
d1laba_80 Lipoyl domain of dihydrolipoamide acetyltransferas 99.76
d1pmra_80 Lipoyl domain of the 2-oxoglutarate dehydrogenase 99.75
d1qjoa_80 Lipoyl domain of dihydrolipoamide acetyltransferas 99.74
d1gjxa_81 Lipoyl domain of dihydrolipoamide acetyltransferas 99.74
d1pmra_80 Lipoyl domain of the 2-oxoglutarate dehydrogenase 99.72
d1qjoa_80 Lipoyl domain of dihydrolipoamide acetyltransferas 99.69
d1iyua_79 Lipoyl domain of dihydrolipoamide acetyltransferas 99.69
d1gjxa_81 Lipoyl domain of dihydrolipoamide acetyltransferas 99.67
d1iyua_79 Lipoyl domain of dihydrolipoamide acetyltransferas 99.64
d1dcza_77 Biotin carboxyl carrier domain of transcarboxylase 99.43
d1w85i_42 E3/E1 binding domain of dihydrolipoyl acetyltransf 99.41
d1dcza_77 Biotin carboxyl carrier domain of transcarboxylase 99.33
d2cyua139 E3-binding domain of dihydrolipoamide succinyltran 99.33
d1bdoa_80 Biotinyl domain of acetyl-CoA carboxylase {Escheri 99.23
d1w85i_42 E3/E1 binding domain of dihydrolipoyl acetyltransf 99.14
d1bdoa_80 Biotinyl domain of acetyl-CoA carboxylase {Escheri 99.11
d2cyua139 E3-binding domain of dihydrolipoamide succinyltran 99.04
d1onla_127 Protein H of glycine cleavage system {Thermus ther 96.28
d1hpca_131 Protein H of glycine cleavage system {Pea (Pisum s 96.14
d1onla_127 Protein H of glycine cleavage system {Thermus ther 95.71
d1hpca_131 Protein H of glycine cleavage system {Pea (Pisum s 95.59
d1vf7a_237 Multidrug resistance protein MexA domain {Pseudomo 90.17
d1vf7a_237 Multidrug resistance protein MexA domain {Pseudomo 89.66
>d1scza_ c.43.1.1 (A:) Dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: CoA-dependent acyltransferases
superfamily: CoA-dependent acyltransferases
family: CAT-like
domain: Dihydrolipoamide succinyltransferase
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=2.1e-58  Score=490.79  Aligned_cols=229  Identities=26%  Similarity=0.467  Sum_probs=214.5

Q ss_pred             cceeeecCchhhHHHHHhhhc-CCCCeeEEeecccchHHHHHHHHHHHHHHhccCcccChHHHHHHHHHHHHHhCCccce
Q psy6394         677 ASNVIPIRGYVKGMFKSMTEA-NTIPSLRLTEEVDTTQLRDVKNQVSALYQEKFRLKLTYMPFFIKALSLCMTEHPILNA  755 (1045)
Q Consensus       677 ~~~~~pls~~rk~ia~~m~~S-~~iP~~~~~~evD~t~l~~~r~~~~~~~~~~~~~klT~~~~likAva~aL~~~P~lNa  755 (1045)
                      .++++|++++||+||++|.+| +++||+|++.+||+++|+++|+++++...+..+.++|+++|++||++.||++||.+|+
T Consensus         3 ~ee~vpls~~rk~ia~~m~~S~~~iP~~~~~~evd~t~l~~~r~~~~~~~~~~~~~klt~~~~likA~a~aL~~~P~~Na   82 (233)
T d1scza_           3 SEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFYVKAVVEALKRYPEVNA   82 (233)
T ss_dssp             SCCCCCCCHHHHHHHHHHHHHHTTSCEEEEEEEEECHHHHHHHHHHHHHHHHHHSSCCCSHHHHHHHHHHHHHHCTTTTC
T ss_pred             CCcccCCcHHHHHHHHHHHHHhccCCeEEEEEEEEHHHHHHHHHHHHHhhHhhcCCccCHHHHHHHHHHHHHHhCchhhe
Confidence            356789999999999999999 8999999999999999999999998876655459999999999999999999999999


Q ss_pred             EEcCCCceEEEcCCccEEEEEecCCCeeeeeecccccccHHHHHHHHHHHHhccccCCCCCCccCCCceEeeccCCccce
Q psy6394         756 SIDPTQENILVNPDHNISIAIDTKHGLVVPNIKSVNKLCLLDITRELLRIQGCSHEGKVLPRDIQGGTISMSNVGNVGGT  835 (1045)
Q Consensus       756 ~~~~~~~~i~~~~~vnIgiAV~t~~GL~vPvIr~ad~~sl~ei~~~l~~l~~~ar~~kl~~~d~~ggTftISNlG~~G~~  835 (1045)
                      +|++  +++                                                                       
T Consensus        83 ~~~~--~~i-----------------------------------------------------------------------   89 (233)
T d1scza_          83 SIDG--DDV-----------------------------------------------------------------------   89 (233)
T ss_dssp             EEET--TEE-----------------------------------------------------------------------
T ss_pred             EEcC--CeE-----------------------------------------------------------------------
Confidence            9974  111                                                                       


Q ss_pred             eecccccccceeeEeeccceeEeEeccCCceeEEEeeeEEEeccceeecchhhhhhhhhhhhcccccccCCcceEEEEec
Q psy6394         836 LVQPIIVPGQVCIVAFGKIQLLPRFDAEMRIVAKCILNVTWAADHRVVDGATVARAATLWKSLENILVNPDHNISIAIDT  915 (1045)
Q Consensus       836 ~~tpii~~pq~ailavG~i~~~p~~~~~g~i~~~~~m~lslt~DhRviDGa~aa~fl~~~~~~~~ile~p~v~Igiav~~  915 (1045)
                                                                                        +.++++||||||++
T Consensus        90 ------------------------------------------------------------------~~~~~vnIgiAv~~  103 (233)
T d1scza_          90 ------------------------------------------------------------------VYHNYFDVSMAVST  103 (233)
T ss_dssp             ------------------------------------------------------------------ECCSSCCEEECEEE
T ss_pred             ------------------------------------------------------------------EEeccceEEEEEEc
Confidence                                                                              33355789999999


Q ss_pred             CCceeeeeecccCCCCHHHHHHHHHHHHhhhhcCCCCccccCCCceeeecCCCCCCcceeeeecCCceeEEEecceeEEe
Q psy6394         916 KHGLVVPNIKSVNKLSLLDITRELLRIQGCSHEGKVLPRDIQGGTISMSNVGNVGGTLVQPIIVPRQVCIVAFGKIQLLP  995 (1045)
Q Consensus       916 ~~GL~vPvi~~a~~~sl~~ia~~~~~l~~~a~~g~l~~~d~~ggTftiSNlG~~g~~~~~~iin~pq~ail~vG~i~~~p  995 (1045)
                      ++||+||||||||+||+.||++++++|++++|+|+|+++||+||||||||+||+|+++|+|||||||+||||+|+++++|
T Consensus       104 ~~GL~vPvI~~a~~~sl~eia~~~~~l~~~ar~~~L~~~d~~ggTfTISNlG~~g~~~~tpii~ppq~aIl~vG~i~~~p  183 (233)
T d1scza_         104 PRGLVTPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRP  183 (233)
T ss_dssp             TTEEECCEETTGGGCCHHHHHHHHHHHHHHTTTTCCCHHHHSCCSEEEEEGGGGTCCCCCCCCCTTCSEEEEEEEEEEEE
T ss_pred             CCCeEEeEeeccccCCHHHHHHHHHHHHHHhhcCCCCHHHhCCCcEEEEcCccccceeeeeecCCCCceEEecccceeec
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEecCceEEEEEEEEeeecccccccChHHHHHHHHHHHHhhcCcchhccC
Q psy6394         996 RFDAEMRVVAKCILNVTWAADHRVVDGATVARAATLWKSLVENPALLLTQ 1045 (1045)
Q Consensus       996 v~~~~~~~~~~~~m~ltls~DHRviDG~~aa~fl~~~k~~le~P~~ll~~ 1045 (1045)
                      ++.+| ++++|++|+||||||||+|||++||+||++|+++||||+.||+|
T Consensus       184 v~~~g-~i~~r~~~~lsls~DHRviDGa~aa~Fl~~l~~~lE~P~~lll~  232 (233)
T d1scza_         184 MAVNG-QVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLD  232 (233)
T ss_dssp             EEETT-EEEEEEEEEEEEEEETTTCCHHHHHHHHHHHHHHHHCTTHHHHT
T ss_pred             cccCC-eEEEEEEeEEEEEhhcchhccHHHHHHHHHHHHHHhCHHHHhhC
Confidence            99876 89999999999999999999999999999999999999999986



>d1dpba_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1b5sa_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1dpba_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1b5sa_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1scza_ c.43.1.1 (A:) Dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q23a_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3claa_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q23a_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3claa_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1w85i_ a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d2cyua1 a.9.1.1 (A:2-40) E3-binding domain of dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w85i_ a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cyua1 a.9.1.1 (A:2-40) E3-binding domain of dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onla_ b.84.1.1 (A:) Protein H of glycine cleavage system {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hpca_ b.84.1.1 (A:) Protein H of glycine cleavage system {Pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1onla_ b.84.1.1 (A:) Protein H of glycine cleavage system {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hpca_ b.84.1.1 (A:) Protein H of glycine cleavage system {Pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure