Psyllid ID: psy6765

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240------
MLLRQFVRHASLATKTVERGAYSILNDTHIQKFKQILSNDDNRVLTDEDSVKPYNVDWLKTQEGKSKLVLKPKTTEEVSAILRYCNEQKIAVCPQGGNTGVVAGGVPLYDEVIVSASLMNKILNFDELSGNVNSMSNALVTNRSLELSNTGVVVLGVPLYDEVIVSASLMNKILNFDELSGKSKLVLKPKTTEEVSAILRYCNEQKIAVCPQGGNTGVVAGGVPLYDEVIVSASLMNKILNFDELS
ccccccccccccccccccccccccccHHHHHHHHHHcccccccEEccccccccccccccccccccccEEEccccHHHHHHHHHHHHHccccEEEcccccccccccccccccEEEEcccccccEEEEccccEEEEcccHHHHHHHHHHHHcccEEEEccccccEEEEccccccccccccccccccEEEccccHHHHHHHHHHHHHcccEEEEcccccccccccccccccEEEEcccccccccccccc
cHHHHHHHHcHHHccccccccHHcccHHHHHHHHHHcccccccccccHHHHHHccHHHHHHHccccEEEEccccHHHHHHHHHHHHHcccEEEEccccccccccccccccEEEEEHHHHHHHEEccccccEEEEccHHHHHHHHHHHHHcccEEccccccccEEEcccccccHHHHHHHccccEEEEccccHHHHHHHHHHHHHccccEEEcccccccccccccccccEEEEHHHHHHHEcccccc
MLLRQFVRHASLATKTVERGAYSILNDTHIQKFKQILsnddnrvltdedsvkpynvdwlktqegksklvlkpktTEEVSAILRYCNEqkiavcpqggntgvvaggvpLYDEVIVSASLMNKILNFDELSGNVNSMSNALVTNrslelsntgvvvlgVPLYDEVIVSASLMNKILnfdelsgksklvlkpktTEEVSAILRYCNEqkiavcpqggntgvvaggvpLYDEVIVSASLMNKILNFDELS
MLLRQFVrhaslatktvergaySILNDTHIQKFKqilsnddnrvltdedsvkpynvdwlktqegksklvlkpktTEEVSAILRYCNEQKIAVCPQGGNTGVVAGGVPLYDEVIVSASLMNKILNFDELSGNVNSMSNALVTNRSLELSNTGVVVLGVPLYDEVIVSASLMNKILNFdelsgksklvlkpKTTEEVSAILRYCNEQKIAVCPQGGNTGVVAGGVPLYDEVIVSASLMNKILNFDELS
MLLRQFVRHASLATKTVERGAYSILNDTHIQKFKQILSNDDNRVLTDEDSVKPYNVDWLKTQEGKSKLVLKPKTTEEVSAILRYCNEQKIAVCPQGGNTGVVAGGVPLYDEVIVSASLMNKILNFDELSGNVNSMSNALVTNRSLELSNTGVVVLGVPLYDEVIVSASLMNKILNFDELSGKSKLVLKPKTTEEVSAILRYCNEQKIAVCPQGGNTGVVAGGVPLYDEVIVSASLMNKILNFDELS
*****FVRHASLATKTVERGAYSILNDTHIQKFKQILSNDDNRVLTDEDSVKPYNVDWLKTQEGKSKLVLKPKTTEEVSAILRYCNEQKIAVCPQGGNTGVVAGGVPLYDEVIVSASLMNKILNFDELSGNVNSMSNALVTNRSLELSNTGVVVLGVPLYDEVIVSASLMNKILNFDELSGKSKLVLKPKTTEEVSAILRYCNEQKIAVCPQGGNTGVVAGGVPLYDEVIVSASLMNKILNF****
**********************SILNDTHIQKFKQILSNDDNRVLTDEDSVKPYNVDWLKTQEGKSKLVLKPKTTEEVSAILRYCNEQKIAVCPQGGNTGVVAGGVPLYDEVIVSASLMNKILNFDELSGNVNSMSNALVTNRSLELSNTGVVVLGVPLYDEVIVSASLMNKILNFDELSGKSKLVLKPKTTEEVSAILRYCNEQKIAVCPQGGNTGVVAGGVPLYDEVIVSASLMNKILNFDE**
MLLRQFVRHASLATKTVERGAYSILNDTHIQKFKQILSNDDNRVLTDEDSVKPYNVDWLKTQEGKSKLVLKPKTTEEVSAILRYCNEQKIAVCPQGGNTGVVAGGVPLYDEVIVSASLMNKILNFDELSGNVNSMSNALVTNRSLELSNTGVVVLGVPLYDEVIVSASLMNKILNFDELSGKSKLVLKPKTTEEVSAILRYCNEQKIAVCPQGGNTGVVAGGVPLYDEVIVSASLMNKILNFDELS
MLLRQFVRHASLATKTVERGAYSILNDTHIQKFKQILSNDDNRVLTDEDSVKPYNVDWLKTQEGKSKLVLKPKTTEEVSAILRYCNEQKIAVCPQGGNTGVVAGGVPLYDEVIVSASLMNKILNFDELSGNVNSMSNALVTNRSLELSNTGVVVLGVPLYDEVIVSASLMNKILNFDELSGKSKLVLKPKTTEEVSAILRYCNEQKIAVCPQGGNTGVVAGGVPLYDEVIVSASLMNKILNF****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLRQFVRHASLATKTVERGAYSILNDTHIQKFKQILSNDDNRVLTDEDSVKPYNVDWLKTQEGKSKLVLKPKTTEEVSAILRYCNEQKIAVCPQGGNTGVVAGGVPLYDEVIVSASLMNKILNFDELSGNVNSMSNALVTNRSLELSNTGVVVLGVPLYDEVIVSASLMNKILNFDELSGKSKLVLKPKTTEEVSAILRYCNEQKIAVCPQGGNTGVVAGGVPLYDEVIVSASLMNKILNFDELS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query246 2.2.26 [Sep-21-2011]
A1L258 533 D-2-hydroxyglutarate dehy yes N/A 0.5 0.230 0.484 2e-29
Q7XI14 559 Probable D-2-hydroxygluta yes N/A 0.589 0.259 0.452 4e-29
B8B7X6 559 Probable D-2-hydroxygluta N/A N/A 0.589 0.259 0.452 4e-29
O23240 559 D-2-hydroxyglutarate dehy yes N/A 0.617 0.271 0.419 1e-28
Q1JPD3 544 D-2-hydroxyglutarate dehy yes N/A 0.451 0.204 0.456 1e-27
Q9C1X2 526 Putative D-lactate dehydr yes N/A 0.573 0.268 0.401 3e-27
Q8CIM3 535 D-2-hydroxyglutarate dehy yes N/A 0.451 0.207 0.473 8e-26
P84850 535 D-2-hydroxyglutarate dehy yes N/A 0.451 0.207 0.464 1e-25
Q8N465 521 D-2-hydroxyglutarate dehy yes N/A 0.451 0.213 0.456 3e-25
P46681 530 D-lactate dehydrogenase [ yes N/A 0.443 0.205 0.477 2e-24
>sp|A1L258|D2HDH_DANRE D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Danio rerio GN=d2hgdh PE=2 SV=1 Back     alignment and function desciption
 Score =  129 bits (323), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 86/126 (68%), Gaps = 3/126 (2%)

Query: 19  RGAYSILNDTHIQKFKQILSNDDNRVLTDEDSVKPYNVDWLKTQEGKSKLVLKPKTTEEV 78
           R  +S +    +  F+ +L     R +TD D +K  NVDWLKT +G S ++L+PKTTE V
Sbjct: 67  RLPFSRVTQEDLSFFRALLPG---RTITDPDLLKSSNVDWLKTVQGSSDVLLRPKTTEGV 123

Query: 79  SAILRYCNEQKIAVCPQGGNTGVVAGGVPLYDEVIVSASLMNKILNFDELSGNVNSMSNA 138
           S ILRYCNE+ +AVCPQGGNTG+V G VP++DE+I+S SLMN++  FD +SG +   +  
Sbjct: 124 SQILRYCNERNLAVCPQGGNTGLVGGSVPVFDEIILSTSLMNQVFAFDNISGILTCQAGC 183

Query: 139 LVTNRS 144
           ++ N S
Sbjct: 184 VLENLS 189
Catalyzes the oxidation of D-2-hydroxyglutarate to alpha-ketoglutarate.
Danio rerio (taxid: 7955)
EC: 1EC: .EC: 1EC: .EC: 9EC: 9EC: .EC: -
>sp|Q7XI14|D2HDH_ORYSJ Probable D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Oryza sativa subsp. japonica GN=D2HGDH PE=3 SV=1 Back     alignment and function description
>sp|B8B7X6|D2HDH_ORYSI Probable D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Oryza sativa subsp. indica GN=D2HGDH PE=3 SV=1 Back     alignment and function description
>sp|O23240|D2HDH_ARATH D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Arabidopsis thaliana GN=D2HGDH PE=1 SV=3 Back     alignment and function description
>sp|Q1JPD3|D2HDH_BOVIN D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Bos taurus GN=D2HGDH PE=2 SV=2 Back     alignment and function description
>sp|Q9C1X2|YN53_SCHPO Putative D-lactate dehydrogenase C713.03, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC713.03 PE=3 SV=1 Back     alignment and function description
>sp|Q8CIM3|D2HDH_MOUSE D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Mus musculus GN=D2hgdh PE=2 SV=3 Back     alignment and function description
>sp|P84850|D2HDH_RAT D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Rattus norvegicus GN=D2hgdh PE=3 SV=1 Back     alignment and function description
>sp|Q8N465|D2HDH_HUMAN D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Homo sapiens GN=D2HGDH PE=1 SV=3 Back     alignment and function description
>sp|P46681|DLD2_YEAST D-lactate dehydrogenase [cytochrome] 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DLD2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query246
156541395 509 PREDICTED: d-2-hydroxyglutarate dehydrog 0.552 0.267 0.478 7e-33
357608677217 hypothetical protein KGM_11925 [Danaus p 0.508 0.576 0.511 8e-32
312373900 366 hypothetical protein AND_16869 [Anophele 0.560 0.377 0.449 1e-31
251825187 506 D-2-hydroxyglutarate dehydrogenase [Daph 0.512 0.249 0.525 2e-31
321475578 508 hypothetical protein DAPPUDRAFT_307847 [ 0.512 0.248 0.525 2e-31
340372405 495 PREDICTED: d-2-hydroxyglutarate dehydrog 0.512 0.254 0.492 2e-31
380028530 504 PREDICTED: LOW QUALITY PROTEIN: d-2-hydr 0.609 0.297 0.436 3e-30
448105017 533 Piso0_002979 [Millerozyma farinosa CBS 7 0.577 0.266 0.468 4e-30
146420102 559 hypothetical protein PGUG_01680 [Meyeroz 0.532 0.234 0.484 6e-30
190345658 559 hypothetical protein PGUG_01680 [Meyeroz 0.532 0.234 0.484 7e-30
>gi|156541395|ref|XP_001600529.1| PREDICTED: d-2-hydroxyglutarate dehydrogenase, mitochondrial-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  146 bits (369), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 66/138 (47%), Positives = 99/138 (71%), Gaps = 2/138 (1%)

Query: 17  VERGAYSILNDTHIQKFKQILSNDDNRVLTDEDSVKPYNVDWLKTQEGKSKLVLKPKTTE 76
           VERG Y+++ D H   F  +L  +  RV+T+ D    YN+DWL+  +G S++VLKPK+TE
Sbjct: 42  VERGPYAVIGDAHASFFNGLLGPE--RVITEPDECDSYNIDWLRIVKGSSRVVLKPKSTE 99

Query: 77  EVSAILRYCNEQKIAVCPQGGNTGVVAGGVPLYDEVIVSASLMNKILNFDELSGNVNSMS 136
           EVSAILRYCNEQ++AVCPQ GNTG+V G VP++DEV++S  LMN+I++ DEL+G +   +
Sbjct: 100 EVSAILRYCNEQRLAVCPQSGNTGLVGGSVPVFDEVVISMRLMNQIISTDELAGVLVCEA 159

Query: 137 NALVTNRSLELSNTGVVV 154
             ++ +    L+  G+++
Sbjct: 160 GCVLQSLEEHLTRVGMMM 177

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|357608677|gb|EHJ66090.1| hypothetical protein KGM_11925 [Danaus plexippus] Back     alignment and taxonomy information
>gi|312373900|gb|EFR21569.1| hypothetical protein AND_16869 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|251825187|gb|ACT20727.1| D-2-hydroxyglutarate dehydrogenase [Daphnia pulex] Back     alignment and taxonomy information
>gi|321475578|gb|EFX86540.1| hypothetical protein DAPPUDRAFT_307847 [Daphnia pulex] Back     alignment and taxonomy information
>gi|340372405|ref|XP_003384734.1| PREDICTED: d-2-hydroxyglutarate dehydrogenase, mitochondrial-like [Amphimedon queenslandica] Back     alignment and taxonomy information
>gi|380028530|ref|XP_003697951.1| PREDICTED: LOW QUALITY PROTEIN: d-2-hydroxyglutarate dehydrogenase, mitochondrial-like [Apis florea] Back     alignment and taxonomy information
>gi|448105017|ref|XP_004200393.1| Piso0_002979 [Millerozyma farinosa CBS 7064] gi|448108161|ref|XP_004201024.1| Piso0_002979 [Millerozyma farinosa CBS 7064] gi|359381815|emb|CCE80652.1| Piso0_002979 [Millerozyma farinosa CBS 7064] gi|359382580|emb|CCE79887.1| Piso0_002979 [Millerozyma farinosa CBS 7064] Back     alignment and taxonomy information
>gi|146420102|ref|XP_001486009.1| hypothetical protein PGUG_01680 [Meyerozyma guilliermondii ATCC 6260] Back     alignment and taxonomy information
>gi|190345658|gb|EDK37582.2| hypothetical protein PGUG_01680 [Meyerozyma guilliermondii ATCC 6260] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query246
POMBASE|SPBC713.03 526 SPBC713.03 "mitochondrial D-la 0.556 0.260 0.412 1.3e-29
ZFIN|ZDB-GENE-070112-482 533 d2hgdh "D-2-hydroxyglutarate d 0.487 0.225 0.495 9.5e-29
DICTYBASE|DDB_G0270500 497 d2hgdh "D-2-hydroxyglutarate d 0.577 0.285 0.451 1.7e-28
TAIR|locus:2115230 559 D2HGDH "D-2-hydroxyglutarate d 0.617 0.271 0.419 2e-28
CGD|CAL0004623 527 AIP2 [Candida albicans (taxid: 0.577 0.269 0.427 4.2e-28
UNIPROTKB|Q5AEG8 527 AIP2 "Putative uncharacterized 0.577 0.269 0.427 4.2e-28
ASPGD|ASPL0000009987 557 AN11045 [Emericella nidulans ( 0.504 0.222 0.449 2.5e-26
FB|FBgn0023507 533 CG3835 [Drosophila melanogaste 0.556 0.257 0.432 4.5e-26
UNIPROTKB|Q1JPD3 544 D2HGDH "D-2-hydroxyglutarate d 0.548 0.248 0.391 4.9e-26
MGI|MGI:2138209 535 D2hgdh "D-2-hydroxyglutarate d 0.451 0.207 0.473 2.1e-24
POMBASE|SPBC713.03 SPBC713.03 "mitochondrial D-lactate dehydrogenase, cytochrome (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
 Score = 307 (113.1 bits), Expect = 1.3e-29, Sum P(2) = 1.3e-29
 Identities = 59/143 (41%), Positives = 93/143 (65%)

Query:    15 KTVERGA-YSILNDTHIQKFKQILSNDDNRV-----LTDEDSVKPYNVDWLKTQEGKSKL 68
             K++ R   Y+ L++  +Q FK I+  D + +      TD   +  +N+DW+    GK++L
Sbjct:    40 KSLHRDPKYAKLSEQDVQVFKSIIGKDGSLIDGLDKSTDPADLDAFNIDWMNKYRGKTQL 99

Query:    69 VLKPKTTEEVSAILRYCNEQKIAVCPQGGNTGVVAGGVPLYDEVIVSASLMNKILNFDEL 128
              LKPKTT++VS IL+YCN++K+AV PQGGNTG+V G VP++DE++++  LMN+I  FDE+
Sbjct:   100 ALKPKTTQQVSEILKYCNQKKLAVVPQGGNTGLVGGSVPVFDEIVLNLGLMNQIHTFDEI 159

Query:   129 SGNVNSMSNALVTNRSLELSNTG 151
             SG +   S  ++ N    L+  G
Sbjct:   160 SGVITLDSGVILENADNFLAEKG 182
GO:0004458 "D-lactate dehydrogenase (cytochrome) activity" evidence=ISO
GO:0005739 "mitochondrion" evidence=IDA
GO:0005759 "mitochondrial matrix" evidence=ISO
GO:0006089 "lactate metabolic process" evidence=IC
GO:0006091 "generation of precursor metabolites and energy" evidence=NAS
GO:0008762 "UDP-N-acetylmuramate dehydrogenase activity" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
ZFIN|ZDB-GENE-070112-482 d2hgdh "D-2-hydroxyglutarate dehydrogenase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0270500 d2hgdh "D-2-hydroxyglutarate dehydrogenase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2115230 D2HGDH "D-2-hydroxyglutarate dehydrogenase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
CGD|CAL0004623 AIP2 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5AEG8 AIP2 "Putative uncharacterized protein DLD2" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
ASPGD|ASPL0000009987 AN11045 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
FB|FBgn0023507 CG3835 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q1JPD3 D2HGDH "D-2-hydroxyglutarate dehydrogenase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:2138209 D2hgdh "D-2-hydroxyglutarate dehydrogenase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query246
COG0277 459 COG0277, GlcD, FAD/FMN-containing dehydrogenases [ 5e-19
COG0277 459 COG0277, GlcD, FAD/FMN-containing dehydrogenases [ 1e-15
pfam01565139 pfam01565, FAD_binding_4, FAD binding domain 5e-12
pfam01565139 pfam01565, FAD_binding_4, FAD binding domain 6e-12
TIGR00387 413 TIGR00387, glcD, glycolate oxidase, subunit GlcD 8e-11
TIGR00387 413 TIGR00387, glcD, glycolate oxidase, subunit GlcD 8e-11
PRK11230 499 PRK11230, PRK11230, glycolate oxidase subunit GlcD 1e-09
PRK11230 499 PRK11230, PRK11230, glycolate oxidase subunit GlcD 2e-06
PRK11183 564 PRK11183, PRK11183, D-lactate dehydrogenase; Provi 1e-04
TIGR01676 541 TIGR01676, GLDHase, galactonolactone dehydrogenase 1e-04
PLN02805 555 PLN02805, PLN02805, D-lactate dehydrogenase [cytoc 1e-04
PLN02805 555 PLN02805, PLN02805, D-lactate dehydrogenase [cytoc 6e-04
TIGR01678 438 TIGR01678, FAD_lactone_ox, sugar 1,4-lactone oxida 0.002
PLN02465 573 PLN02465, PLN02465, L-galactono-1,4-lactone dehydr 0.003
>gnl|CDD|223354 COG0277, GlcD, FAD/FMN-containing dehydrogenases [Energy production and conversion] Back     alignment and domain information 
 Score = 84.9 bits (210), Expect = 5e-19
 Identities = 37/95 (38%), Positives = 48/95 (50%), Gaps = 4/95 (4%)

Query: 33  FKQILSNDDNRVLTDEDSVKPYNVDWLKTQEGKSKLVLKPKTTEEVSAILRYCNEQKIAV 92
            K+IL      VLTD      Y  D    + G    V+ PK+ EEV+AILR  NE  I V
Sbjct: 2   LKRILGEL--NVLTDPADRAAYRTDASVYR-GLPLAVVFPKSEEEVAAILRLANENGIPV 58

Query: 93  CPQGGNTGVVAGGVPLYDEVIVSASLMNKILNFDE 127
            P+GG T +  G VP    V++  S +N+IL  D 
Sbjct: 59  VPRGGGTSLSGGAVPD-GGVVLDLSRLNRILEIDP 92

Length = 459
>gnl|CDD|223354 COG0277, GlcD, FAD/FMN-containing dehydrogenases [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|216574 pfam01565, FAD_binding_4, FAD binding domain Back     alignment and domain information
>gnl|CDD|216574 pfam01565, FAD_binding_4, FAD binding domain Back     alignment and domain information
>gnl|CDD|129482 TIGR00387, glcD, glycolate oxidase, subunit GlcD Back     alignment and domain information
>gnl|CDD|129482 TIGR00387, glcD, glycolate oxidase, subunit GlcD Back     alignment and domain information
>gnl|CDD|183043 PRK11230, PRK11230, glycolate oxidase subunit GlcD; Provisional Back     alignment and domain information
>gnl|CDD|183043 PRK11230, PRK11230, glycolate oxidase subunit GlcD; Provisional Back     alignment and domain information
>gnl|CDD|236872 PRK11183, PRK11183, D-lactate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|130737 TIGR01676, GLDHase, galactonolactone dehydrogenase Back     alignment and domain information
>gnl|CDD|178402 PLN02805, PLN02805, D-lactate dehydrogenase [cytochrome] Back     alignment and domain information
>gnl|CDD|178402 PLN02805, PLN02805, D-lactate dehydrogenase [cytochrome] Back     alignment and domain information
>gnl|CDD|233525 TIGR01678, FAD_lactone_ox, sugar 1,4-lactone oxidases Back     alignment and domain information
>gnl|CDD|215258 PLN02465, PLN02465, L-galactono-1,4-lactone dehydrogenase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 246
PRK11183 564 D-lactate dehydrogenase; Provisional 99.91
PRK11230 499 glycolate oxidase subunit GlcD; Provisional 99.91
PLN02805 555 D-lactate dehydrogenase [cytochrome] 99.9
KOG1232|consensus 511 99.88
COG0277 459 GlcD FAD/FMN-containing dehydrogenases [Energy pro 99.87
PF01565139 FAD_binding_4: FAD binding domain This is only a s 99.82
TIGR00387 413 glcD glycolate oxidase, subunit GlcD. This protein 99.77
PLN02441 525 cytokinin dehydrogenase 99.77
TIGR01676 541 GLDHase galactonolactone dehydrogenase. This model 99.76
TIGR01678 438 FAD_lactone_ox sugar 1,4-lactone oxidases. This mo 99.74
TIGR01677 557 pln_FAD_oxido plant-specific FAD-dependent oxidore 99.73
PLN02465 573 L-galactono-1,4-lactone dehydrogenase 99.68
TIGR01679 419 bact_FAD_ox FAD-linked oxidoreductase. This model 99.68
PRK13906307 murB UDP-N-acetylenolpyruvoylglucosamine reductase 99.67
PRK14652302 UDP-N-acetylenolpyruvoylglucosamine reductase; Pro 99.67
PRK12436305 UDP-N-acetylenolpyruvoylglucosamine reductase; Pro 99.66
KOG1231|consensus 505 99.61
TIGR00179284 murB UDP-N-acetylenolpyruvoylglucosamine reductase 99.59
PRK13905298 murB UDP-N-acetylenolpyruvoylglucosamine reductase 99.58
PRK11183 564 D-lactate dehydrogenase; Provisional 99.52
PRK11282 352 glcE glycolate oxidase FAD binding subunit; Provis 99.51
PRK14653297 UDP-N-acetylenolpyruvoylglucosamine reductase; Pro 99.46
PRK13903 363 murB UDP-N-acetylenolpyruvoylglucosamine reductase 99.44
KOG4730|consensus 518 99.44
PRK14649295 UDP-N-acetylenolpyruvoylglucosamine reductase; Pro 99.43
PF01565139 FAD_binding_4: FAD binding domain This is only a s 99.42
KOG1233|consensus 613 99.42
PRK11230 499 glycolate oxidase subunit GlcD; Provisional 99.4
PLN02805 555 D-lactate dehydrogenase [cytochrome] 99.39
COG0277 459 GlcD FAD/FMN-containing dehydrogenases [Energy pro 99.35
PRK14650302 UDP-N-acetylenolpyruvoylglucosamine reductase; Pro 99.29
KOG1233|consensus 613 99.29
PRK14648 354 UDP-N-acetylenolpyruvoylglucosamine reductase; Pro 99.28
TIGR00387 413 glcD glycolate oxidase, subunit GlcD. This protein 99.27
COG0812291 MurB UDP-N-acetylmuramate dehydrogenase [Cell enve 99.2
PRK00046 334 murB UDP-N-acetylenolpyruvoylglucosamine reductase 99.17
KOG1232|consensus 511 99.09
TIGR01678 438 FAD_lactone_ox sugar 1,4-lactone oxidases. This mo 99.08
PLN02441 525 cytokinin dehydrogenase 99.07
TIGR01676 541 GLDHase galactonolactone dehydrogenase. This model 99.03
TIGR01677 557 pln_FAD_oxido plant-specific FAD-dependent oxidore 98.98
PRK12436 305 UDP-N-acetylenolpyruvoylglucosamine reductase; Pro 98.91
TIGR01679 419 bact_FAD_ox FAD-linked oxidoreductase. This model 98.87
KOG1231|consensus 505 98.85
PLN02465 573 L-galactono-1,4-lactone dehydrogenase 98.8
TIGR00179 284 murB UDP-N-acetylenolpyruvoylglucosamine reductase 98.79
PRK13906 307 murB UDP-N-acetylenolpyruvoylglucosamine reductase 98.78
PRK14652 302 UDP-N-acetylenolpyruvoylglucosamine reductase; Pro 98.72
PRK13905 298 murB UDP-N-acetylenolpyruvoylglucosamine reductase 98.72
PRK14651273 UDP-N-acetylenolpyruvoylglucosamine reductase; Pro 98.64
PRK13904257 murB UDP-N-acetylenolpyruvoylglucosamine reductase 98.43
PRK13903 363 murB UDP-N-acetylenolpyruvoylglucosamine reductase 98.4
PRK14649 295 UDP-N-acetylenolpyruvoylglucosamine reductase; Pro 98.35
PRK14653 297 UDP-N-acetylenolpyruvoylglucosamine reductase; Pro 98.27
KOG4730|consensus 518 97.95
PRK14650 302 UDP-N-acetylenolpyruvoylglucosamine reductase; Pro 97.91
PRK14648 354 UDP-N-acetylenolpyruvoylglucosamine reductase; Pro 97.88
COG0812 291 MurB UDP-N-acetylmuramate dehydrogenase [Cell enve 97.66
PRK00046 334 murB UDP-N-acetylenolpyruvoylglucosamine reductase 97.64
PF00941171 FAD_binding_5: FAD binding domain in molybdopterin 96.42
PRK09799258 putative oxidoreductase; Provisional 96.2
PRK14651 273 UDP-N-acetylenolpyruvoylglucosamine reductase; Pro 96.11
TIGR03312257 Se_sel_red_FAD probable selenate reductase, FAD-bi 95.76
TIGR02963467 xanthine_xdhA xanthine dehydrogenase, small subuni 94.51
KOG1262|consensus 543 93.68
TIGR03195 321 4hydrxCoA_B 4-hydroxybenzoyl-CoA reductase, beta s 93.08
PRK09971 291 xanthine dehydrogenase subunit XdhB; Provisional 92.98
TIGR03199264 pucC xanthine dehydrogenase C subunit. This gene h 92.8
PRK13904 257 murB UDP-N-acetylenolpyruvoylglucosamine reductase 91.22
PLN02906 1319 xanthine dehydrogenase 88.34
PLN00192 1344 aldehyde oxidase 87.32
TIGR02969 1330 mam_aldehyde_ox aldehyde oxidase. Members of this 85.9
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 80.42
>PRK11183 D-lactate dehydrogenase; Provisional Back     alignment and domain information 
Probab=99.91  E-value=2.1e-24  Score=197.37  Aligned_cols=130  Identities=22%  Similarity=0.274  Sum_probs=119.2

Q ss_pred             HHHHHHHHHhhCCCCCCeecCccccccccccccccCCCCccEEEeCCCHHHHHHHHHHHHhCCCcEEEecCCCCCCCCcc
Q psy6765          27 DTHIQKFKQILSNDDNRVLTDEDSVKPYNVDWLKTQEGKSKLVLKPKTTEEVSAILRYCNEQKIAVCPQGGNTGVVAGGV  106 (246)
Q Consensus        27 ~~~~~~L~~~l~~~~~~v~~~~~~~~~~~~~~~~~~~~~p~~vv~P~s~~ev~~~v~~a~~~~i~v~~~GgG~~~~g~~~  106 (246)
                      .+++++|++++|  +++|++++..+..|++||.. ..+.|.+||+|.|++||+++|++|+++++||++||||||++||++
T Consensus         3 ~~li~~L~~IvG--~~~Vltd~~~l~~Y~~D~r~-~~g~P~AVV~P~SteEVa~IVklC~e~~vPVIPRGgGTGLtGGAv   79 (564)
T PRK11183          3 KALINELTRIVG--SSHVLTDPAKTERYRKGFRS-GQGDALAVVFPGTLLELWRVLQACVAADKIIIMQAANTGLTGGST   79 (564)
T ss_pred             HHHHHHHHHhcC--cccEecCHHHHHHhccCccc-cCCCCCEEEecCCHHHHHHHHHHHHHcCCeEEEeCCCcccccCcc
Confidence            567899999999  78999999999999999864 577899999999999999999999999999999999999999999


Q ss_pred             cCCC-----eEEEecCCCCCceeeeCCCCeEEEcCCccHHHHHHHHhhcCceeecCCCc
Q psy6765         107 PLYD-----EVIVSASLMNKILNFDELSGNVNSMSNALVTNRSLELSNTGVVVLGVPLY  160 (246)
Q Consensus       107 ~~~~-----gvvidl~~m~~i~~id~~~~~v~v~aG~~~~~l~~~L~~~gl~~~~~p~s  160 (246)
                      |..+     +|||||.+||+|+++| ++.+++|+||+++.+|.++|.++|++++.++++
T Consensus        80 P~~~~~dR~gVVIsl~RMNrIleID-~~~~VvVePGVtl~~LeeaLk~~Gl~p~sd~GS  137 (564)
T PRK11183         80 PNGNDYDRDIVIISTLRLDKIQLLN-NGKQVLALPGTTLYQLEKALKPLGREPHSVIGS  137 (564)
T ss_pred             cCCCCCcCCEEEEEhhHcCCcEEEC-CCCeEEEeCCCcHHHHHHHHHHhCCCCCCcccc
Confidence            9653     7999999999999999 567899999999999999999999988777754

>PRK11230 glycolate oxidase subunit GlcD; Provisional Back     alignment and domain information
>PLN02805 D-lactate dehydrogenase [cytochrome] Back     alignment and domain information
>KOG1232|consensus Back     alignment and domain information
>COG0277 GlcD FAD/FMN-containing dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PF01565 FAD_binding_4: FAD binding domain This is only a subset of the Pfam family; InterPro: IPR006094 Various enzymes use FAD as a co-factor, most of these enzymes are oxygen-dependent oxidoreductases, containing a covalently bound FAD group which is attached to a histidine via an 8-alpha-(N3-histidyl)-riboflavin linkage Back     alignment and domain information
>TIGR00387 glcD glycolate oxidase, subunit GlcD Back     alignment and domain information
>PLN02441 cytokinin dehydrogenase Back     alignment and domain information
>TIGR01676 GLDHase galactonolactone dehydrogenase Back     alignment and domain information
>TIGR01678 FAD_lactone_ox sugar 1,4-lactone oxidases Back     alignment and domain information
>TIGR01677 pln_FAD_oxido plant-specific FAD-dependent oxidoreductase Back     alignment and domain information
>PLN02465 L-galactono-1,4-lactone dehydrogenase Back     alignment and domain information
>TIGR01679 bact_FAD_ox FAD-linked oxidoreductase Back     alignment and domain information
>PRK13906 murB UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>PRK14652 UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>PRK12436 UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>KOG1231|consensus Back     alignment and domain information
>TIGR00179 murB UDP-N-acetylenolpyruvoylglucosamine reductase Back     alignment and domain information
>PRK13905 murB UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>PRK11183 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK11282 glcE glycolate oxidase FAD binding subunit; Provisional Back     alignment and domain information
>PRK14653 UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>PRK13903 murB UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>KOG4730|consensus Back     alignment and domain information
>PRK14649 UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>PF01565 FAD_binding_4: FAD binding domain This is only a subset of the Pfam family; InterPro: IPR006094 Various enzymes use FAD as a co-factor, most of these enzymes are oxygen-dependent oxidoreductases, containing a covalently bound FAD group which is attached to a histidine via an 8-alpha-(N3-histidyl)-riboflavin linkage Back     alignment and domain information
>KOG1233|consensus Back     alignment and domain information
>PRK11230 glycolate oxidase subunit GlcD; Provisional Back     alignment and domain information
>PLN02805 D-lactate dehydrogenase [cytochrome] Back     alignment and domain information
>COG0277 GlcD FAD/FMN-containing dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PRK14650 UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>KOG1233|consensus Back     alignment and domain information
>PRK14648 UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>TIGR00387 glcD glycolate oxidase, subunit GlcD Back     alignment and domain information
>COG0812 MurB UDP-N-acetylmuramate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK00046 murB UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>KOG1232|consensus Back     alignment and domain information
>TIGR01678 FAD_lactone_ox sugar 1,4-lactone oxidases Back     alignment and domain information
>PLN02441 cytokinin dehydrogenase Back     alignment and domain information
>TIGR01676 GLDHase galactonolactone dehydrogenase Back     alignment and domain information
>TIGR01677 pln_FAD_oxido plant-specific FAD-dependent oxidoreductase Back     alignment and domain information
>PRK12436 UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>TIGR01679 bact_FAD_ox FAD-linked oxidoreductase Back     alignment and domain information
>KOG1231|consensus Back     alignment and domain information
>PLN02465 L-galactono-1,4-lactone dehydrogenase Back     alignment and domain information
>TIGR00179 murB UDP-N-acetylenolpyruvoylglucosamine reductase Back     alignment and domain information
>PRK13906 murB UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>PRK14652 UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>PRK13905 murB UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>PRK14651 UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>PRK13904 murB UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>PRK13903 murB UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>PRK14649 UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>PRK14653 UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>KOG4730|consensus Back     alignment and domain information
>PRK14650 UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>PRK14648 UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>COG0812 MurB UDP-N-acetylmuramate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK00046 murB UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>PF00941 FAD_binding_5: FAD binding domain in molybdopterin dehydrogenase; InterPro: IPR002346 Oxidoreductases, that also bind molybdopterin, have essentially no similarity outside this common domain Back     alignment and domain information
>PRK09799 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK14651 UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>TIGR03312 Se_sel_red_FAD probable selenate reductase, FAD-binding subunit Back     alignment and domain information
>TIGR02963 xanthine_xdhA xanthine dehydrogenase, small subunit Back     alignment and domain information
>KOG1262|consensus Back     alignment and domain information
>TIGR03195 4hydrxCoA_B 4-hydroxybenzoyl-CoA reductase, beta subunit Back     alignment and domain information
>PRK09971 xanthine dehydrogenase subunit XdhB; Provisional Back     alignment and domain information
>TIGR03199 pucC xanthine dehydrogenase C subunit Back     alignment and domain information
>PRK13904 murB UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional Back     alignment and domain information
>PLN02906 xanthine dehydrogenase Back     alignment and domain information
>PLN00192 aldehyde oxidase Back     alignment and domain information
>TIGR02969 mam_aldehyde_ox aldehyde oxidase Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query246
3pm9_A 476 Crystal Structure Of A Putative Dehydrogenase (Rpa1 8e-14
3pm9_A 476 Crystal Structure Of A Putative Dehydrogenase (Rpa1 2e-11
1dii_A 521 Crystal Structure Of P-Cresol Methylhydroxylase At 2e-04
1wve_A 520 P-Cresol Methylhydroxylase: Alteration Of The Struc 2e-04
>pdb|3PM9|A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution Length = 476 Back     alignment and structure 
Iteration: 1

 Score = 73.9 bits (180), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 60/111 (54%), Gaps = 2/111 (1%)
Query: 30  IQKFKQILSNDDNRVLTDEDSVKPYNVDWLKTQEGKSKLVLKPKTTEEVSAILRYCNEQK 89
           I +F  I+   D   LTD   ++ Y  +      G S LVL+P +TEEV AI +  NE +
Sbjct: 18  IARFTAIVG--DKHALTDPLELEAYITEERNLYRGHSPLVLRPGSTEEVVAICKLANEAR 75
Query: 90  IAVCPQGGNTGVVAGGVPLYDEVIVSASLMNKILNFDELSGNVNSMSNALV 140
           +A+ PQGGNTG+V G  P   EV++S    +KI   D  S  +   + A++
Sbjct: 76  VALVPQGGNTGLVGGQTPHNGEVVISLKRXDKIREIDTSSNTITVEAGAIL 126
>pdb|3PM9|A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution Length = 476 Back     alignment and structure
>pdb|1DII|A Chain A, Crystal Structure Of P-Cresol Methylhydroxylase At 2.5 A Resolution Length = 521 Back     alignment and structure
>pdb|1WVE|A Chain A, P-Cresol Methylhydroxylase: Alteration Of The Structure Of The Flavoprotein Subunit Upon Its Binding To The Cytochrome Subunit Length = 520 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query246
3pm9_A 476 Putative oxidoreductase; putative D-2-hydroxygluta 2e-43
3pm9_A 476 Putative oxidoreductase; putative D-2-hydroxygluta 6e-29
1f0x_A 571 DLDH, D-lactate dehydrogenase; oxidoreductase; HET 6e-28
1f0x_A 571 DLDH, D-lactate dehydrogenase; oxidoreductase; HET 2e-19
2uuu_A 584 Alkyldihydroxyacetonephosphate synthase; transfera 6e-20
2uuu_A 584 Alkyldihydroxyacetonephosphate synthase; transfera 1e-15
1wvf_A 520 4-cresol dehydrogenase [hydroxylating] flavoprote 5e-19
1wvf_A 520 4-cresol dehydrogenase [hydroxylating] flavoprote 4e-13
1e8g_A 560 Vanillyl-alcohol oxidase; oxidoreductase, flavoenz 3e-16
1e8g_A 560 Vanillyl-alcohol oxidase; oxidoreductase, flavoenz 1e-12
2i0k_A 561 Oxidoreductase; MIX alpha beta, covalent FAD, flav 4e-15
2i0k_A 561 Oxidoreductase; MIX alpha beta, covalent FAD, flav 4e-12
3js8_A 540 Cholesterol oxidase; cholsterol, organic solvent s 5e-13
3js8_A 540 Cholesterol oxidase; cholsterol, organic solvent s 1e-10
1w1o_A 534 Cytokinin dehydrogenase 1; flavin, oxidoreductase, 2e-08
1w1o_A 534 Cytokinin dehydrogenase 1; flavin, oxidoreductase, 8e-04
4feh_A 481 Oxidoreductase DPRE1; alpha+beta, decaprenylphosph 9e-08
4feh_A 481 Oxidoreductase DPRE1; alpha+beta, decaprenylphosph 2e-04
2vfr_A 422 Xylitol oxidase, alditol oxidase; FAD, sugar, poly 2e-06
2vfr_A 422 Xylitol oxidase, alditol oxidase; FAD, sugar, poly 3e-04
2bvf_A 459 6-hydroxy-D-nicotine oxidase; autoflavinylation, e 7e-06
2bvf_A 459 6-hydroxy-D-nicotine oxidase; autoflavinylation, e 1e-04
2exr_A 524 Cytokinin dehydrogenase 7; AT5G21482.1, cytokinin 2e-04
2exr_A 524 Cytokinin dehydrogenase 7; AT5G21482.1, cytokinin 7e-04
3rja_A 473 Carbohydrate oxidase; protein-substrate analogue c 4e-04
1zr6_A 503 Glucooligosaccharide oxidase; alpha + beta, flavoe 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
>3pm9_A Putative oxidoreductase; putative D-2-hydroxyglutarate dehydrogenase, putative D-LACT dehydrogenase; HET: FAD; 2.57A {Rhodopseudomonas palustris} Length = 476 Back     alignment and structure
 Score =  151 bits (385), Expect = 2e-43
 Identities = 43/114 (37%), Positives = 61/114 (53%), Gaps = 2/114 (1%)

Query: 17  VERGAYSILNDTHIQKFKQILSNDDNRVLTDEDSVKPYNVDWLKTQEGKSKLVLKPKTTE 76
           V + +   L+   I +F  I+   D   LTD   ++ Y  +      G S LVL+P +TE
Sbjct: 5   VSQLSPVTLSPELIARFTAIV--GDKHALTDPLELEAYITEERNLYRGHSPLVLRPGSTE 62

Query: 77  EVSAILRYCNEQKIAVCPQGGNTGVVAGGVPLYDEVIVSASLMNKILNFDELSG 130
           EV AI +  NE ++A+ PQGGNTG+V G  P   EV++S   M+KI   D  S 
Sbjct: 63  EVVAICKLANEARVALVPQGGNTGLVGGQTPHNGEVVISLKRMDKIREIDTSSN 116
>3pm9_A Putative oxidoreductase; putative D-2-hydroxyglutarate dehydrogenase, putative D-LACT dehydrogenase; HET: FAD; 2.57A {Rhodopseudomonas palustris} Length = 476 Back     alignment and structure
>1f0x_A DLDH, D-lactate dehydrogenase; oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: d.58.32.2 d.145.1.1 Length = 571 Back     alignment and structure
>1f0x_A DLDH, D-lactate dehydrogenase; oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: d.58.32.2 d.145.1.1 Length = 571 Back     alignment and structure
>2uuu_A Alkyldihydroxyacetonephosphate synthase; transferase, lavoprotein, lipid synthesis, peroxisomal disor; HET: FAD PL3; 1.95A {Dictyostelium discoideum} PDB: 2uuv_A* Length = 584 Back     alignment and structure
>2uuu_A Alkyldihydroxyacetonephosphate synthase; transferase, lavoprotein, lipid synthesis, peroxisomal disor; HET: FAD PL3; 1.95A {Dictyostelium discoideum} PDB: 2uuv_A* Length = 584 Back     alignment and structure
>1wvf_A 4-cresol dehydrogenase [hydroxylating] flavoprote subunit; flavoprotein, electron-transfer, FAD, oxidoreductase; HET: FAD; 1.30A {Pseudomonas putida} SCOP: d.58.32.1 d.145.1.1 PDB: 1wve_A* 1dii_A* 1diq_A* Length = 520 Back     alignment and structure
>1wvf_A 4-cresol dehydrogenase [hydroxylating] flavoprote subunit; flavoprotein, electron-transfer, FAD, oxidoreductase; HET: FAD; 1.30A {Pseudomonas putida} SCOP: d.58.32.1 d.145.1.1 PDB: 1wve_A* 1dii_A* 1diq_A* Length = 520 Back     alignment and structure
>1e8g_A Vanillyl-alcohol oxidase; oxidoreductase, flavoenzyme, specificity; HET: FAD FCR; 2.1A {Penicillium simplicissimum} SCOP: d.58.32.1 d.145.1.1 PDB: 1e8f_A* 1e8h_A* 1qlt_A* 1qlu_A* 1vao_A* 1ahv_A* 1ahz_A* 1ahu_A* 2vao_A* 1w1j_A* 1dzn_A* 1w1l_A* 1e0y_A* 1w1k_A* 1w1m_A* Length = 560 Back     alignment and structure
>1e8g_A Vanillyl-alcohol oxidase; oxidoreductase, flavoenzyme, specificity; HET: FAD FCR; 2.1A {Penicillium simplicissimum} SCOP: d.58.32.1 d.145.1.1 PDB: 1e8f_A* 1e8h_A* 1qlt_A* 1qlu_A* 1vao_A* 1ahv_A* 1ahz_A* 1ahu_A* 2vao_A* 1w1j_A* 1dzn_A* 1w1l_A* 1e0y_A* 1w1k_A* 1w1m_A* Length = 560 Back     alignment and structure
>2i0k_A Oxidoreductase; MIX alpha beta, covalent FAD, flavoenzyme; HET: FAD; 1.60A {Brevibacterium sterolicum} SCOP: d.58.32.3 d.145.1.1 PDB: 1i19_A* Length = 561 Back     alignment and structure
>2i0k_A Oxidoreductase; MIX alpha beta, covalent FAD, flavoenzyme; HET: FAD; 1.60A {Brevibacterium sterolicum} SCOP: d.58.32.3 d.145.1.1 PDB: 1i19_A* Length = 561 Back     alignment and structure
>3js8_A Cholesterol oxidase; cholsterol, organic solvent stability, oxygen channel, FAD, flavoprotein, oxidoreductase; HET: FAD SUC; 1.54A {Chromobacterium SP} Length = 540 Back     alignment and structure
>3js8_A Cholesterol oxidase; cholsterol, organic solvent stability, oxygen channel, FAD, flavoprotein, oxidoreductase; HET: FAD SUC; 1.54A {Chromobacterium SP} Length = 540 Back     alignment and structure
>1w1o_A Cytokinin dehydrogenase 1; flavin, oxidoreductase, flavoprotein, FAD; HET: NAG FAD; 1.7A {Zea mays} SCOP: d.58.32.4 d.145.1.1 PDB: 1w1q_A* 1w1r_A* 1w1s_A* 3dq0_A* 2qkn_A* 3c0p_A* 3bw7_A* 2qpm_A* 3kjm_A* Length = 534 Back     alignment and structure
>1w1o_A Cytokinin dehydrogenase 1; flavin, oxidoreductase, flavoprotein, FAD; HET: NAG FAD; 1.7A {Zea mays} SCOP: d.58.32.4 d.145.1.1 PDB: 1w1q_A* 1w1r_A* 1w1s_A* 3dq0_A* 2qkn_A* 3c0p_A* 3bw7_A* 2qpm_A* 3kjm_A* Length = 534 Back     alignment and structure
>4feh_A Oxidoreductase DPRE1; alpha+beta, decaprenylphosphoryl-beta-D-RIBO; HET: FAD; 2.04A {Mycobacterium tuberculosis} PDB: 4fdo_A* 4fdn_A* 4fdp_A* 4ff6_A* Length = 481 Back     alignment and structure
>4feh_A Oxidoreductase DPRE1; alpha+beta, decaprenylphosphoryl-beta-D-RIBO; HET: FAD; 2.04A {Mycobacterium tuberculosis} PDB: 4fdo_A* 4fdn_A* 4fdp_A* 4ff6_A* Length = 481 Back     alignment and structure
>2vfr_A Xylitol oxidase, alditol oxidase; FAD, sugar, polyol, flavin, flavoprotein, oxidoreductase; HET: FAD; 1.1A {Streptomyces coelicolor} PDB: 2vfs_A* 2vft_A* 2vfu_A* 2vfv_A* Length = 422 Back     alignment and structure
>2vfr_A Xylitol oxidase, alditol oxidase; FAD, sugar, polyol, flavin, flavoprotein, oxidoreductase; HET: FAD; 1.1A {Streptomyces coelicolor} PDB: 2vfs_A* 2vft_A* 2vfu_A* 2vfv_A* Length = 422 Back     alignment and structure
>2bvf_A 6-hydroxy-D-nicotine oxidase; autoflavinylation, enantiomeric substrates, flavoenzymes, NI degradation; HET: FAD; 1.92A {Arthrobacter nicotinovorans} PDB: 2bvg_A* 2bvh_A* Length = 459 Back     alignment and structure
>2bvf_A 6-hydroxy-D-nicotine oxidase; autoflavinylation, enantiomeric substrates, flavoenzymes, NI degradation; HET: FAD; 1.92A {Arthrobacter nicotinovorans} PDB: 2bvg_A* 2bvh_A* Length = 459 Back     alignment and structure
>2exr_A Cytokinin dehydrogenase 7; AT5G21482.1, cytokinin oxidase/dehydrogenase, CKX, structura genomics, protein structure initiative; HET: MSE FAD; 1.70A {Arabidopsis thaliana} PDB: 2q4w_A* Length = 524 Back     alignment and structure
>2exr_A Cytokinin dehydrogenase 7; AT5G21482.1, cytokinin oxidase/dehydrogenase, CKX, structura genomics, protein structure initiative; HET: MSE FAD; 1.70A {Arabidopsis thaliana} PDB: 2q4w_A* Length = 524 Back     alignment and structure
>3rja_A Carbohydrate oxidase; protein-substrate analogue complex, FAD binding domain, BERB berberine-like domain, glucooligosaccharide oxidase; HET: FAD NAG ABL TRS; 2.10A {Microdochium nivale} PDB: 3rj8_A* Length = 473 Back     alignment and structure
>1zr6_A Glucooligosaccharide oxidase; alpha + beta, flavoenzyme, oxidoreductase; HET: NAG FAD; 1.55A {Acremonium strictum} PDB: 2axr_A* 3e0t_A* 3hsu_A* Length = 503 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query246
3pm9_A 476 Putative oxidoreductase; putative D-2-hydroxygluta 99.92
4bby_A 658 Alkyldihydroxyacetonephosphate synthase, peroxiso; 99.9
1wvf_A 520 4-cresol dehydrogenase [hydroxylating] flavoprote 99.89
1e8g_A 560 Vanillyl-alcohol oxidase; oxidoreductase, flavoenz 99.88
1f0x_A 571 DLDH, D-lactate dehydrogenase; oxidoreductase; HET 99.88
2uuu_A 584 Alkyldihydroxyacetonephosphate synthase; transfera 99.86
1w1o_A 534 Cytokinin dehydrogenase 1; flavin, oxidoreductase, 99.83
3tsh_A 500 Pollen allergen PHL P 4; flavoprotein, BI-covalent 99.82
1hsk_A326 UDP-N-acetylenolpyruvoylglucosamine reductase; pep 99.81
2exr_A 524 Cytokinin dehydrogenase 7; AT5G21482.1, cytokinin 99.81
3pop_A 501 GILR oxidase; FAD binding protein, gilvocarcin, gi 99.79
3rja_A 473 Carbohydrate oxidase; protein-substrate analogue c 99.77
2ipi_A 521 Aclacinomycin oxidoreductase (aknox); anthracyclin 99.76
3tx1_A322 UDP-N-acetylenolpyruvoylglucosamine reductase; str 99.76
2wdx_A 523 Putative hexose oxidase; oxidoreductase-antibiotic 99.76
2y3s_A 530 TAML; oxidoreductase; HET: FAD TIR; 1.67A {Strepto 99.76
2bvf_A 459 6-hydroxy-D-nicotine oxidase; autoflavinylation, e 99.75
4feh_A 481 Oxidoreductase DPRE1; alpha+beta, decaprenylphosph 99.75
3js8_A 540 Cholesterol oxidase; cholsterol, organic solvent s 99.74
3fw9_A 495 Reticuline oxidase; BI-covalent flavinylation, N-g 99.74
1zr6_A 503 Glucooligosaccharide oxidase; alpha + beta, flavoe 99.73
2i0k_A 561 Oxidoreductase; MIX alpha beta, covalent FAD, flav 99.73
3vte_A 518 Tetrahydrocannabinolic acid synthase; BI-covalent 99.71
2vfr_A 422 Xylitol oxidase, alditol oxidase; FAD, sugar, poly 99.7
4bby_A 658 Alkyldihydroxyacetonephosphate synthase, peroxiso; 99.58
1uxy_A 340 MURB, uridine diphospho-N-acetylenolpyruvylglucosa 99.54
3i99_A 357 UDP-N-acetylenolpyruvoylglucosamine reductase; str 99.53
3tsh_A 500 Pollen allergen PHL P 4; flavoprotein, BI-covalent 99.47
3pm9_A 476 Putative oxidoreductase; putative D-2-hydroxygluta 99.42
3pop_A 501 GILR oxidase; FAD binding protein, gilvocarcin, gi 99.42
3fw9_A 495 Reticuline oxidase; BI-covalent flavinylation, N-g 99.42
2gqt_A268 UDP-N-acetylenolpyruvylglucosamine reductase; pept 99.4
3rja_A 473 Carbohydrate oxidase; protein-substrate analogue c 99.39
3vte_A 518 Tetrahydrocannabinolic acid synthase; BI-covalent 99.38
2wdx_A 523 Putative hexose oxidase; oxidoreductase-antibiotic 99.38
2y3s_A 530 TAML; oxidoreductase; HET: FAD TIR; 1.67A {Strepto 99.36
2ipi_A 521 Aclacinomycin oxidoreductase (aknox); anthracyclin 99.36
1wvf_A 520 4-cresol dehydrogenase [hydroxylating] flavoprote 99.35
1f0x_A 571 DLDH, D-lactate dehydrogenase; oxidoreductase; HET 99.35
1zr6_A 503 Glucooligosaccharide oxidase; alpha + beta, flavoe 99.33
1e8g_A 560 Vanillyl-alcohol oxidase; oxidoreductase, flavoenz 99.32
2uuu_A 584 Alkyldihydroxyacetonephosphate synthase; transfera 99.31
2bvf_A 459 6-hydroxy-D-nicotine oxidase; autoflavinylation, e 99.29
2exr_A 524 Cytokinin dehydrogenase 7; AT5G21482.1, cytokinin 99.27
1hsk_A 326 UDP-N-acetylenolpyruvoylglucosamine reductase; pep 99.18
1w1o_A 534 Cytokinin dehydrogenase 1; flavin, oxidoreductase, 99.17
4feh_A 481 Oxidoreductase DPRE1; alpha+beta, decaprenylphosph 99.16
3tx1_A 322 UDP-N-acetylenolpyruvoylglucosamine reductase; str 99.05
3js8_A 540 Cholesterol oxidase; cholsterol, organic solvent s 99.03
2i0k_A 561 Oxidoreductase; MIX alpha beta, covalent FAD, flav 99.01
2vfr_A 422 Xylitol oxidase, alditol oxidase; FAD, sugar, poly 98.93
1uxy_A 340 MURB, uridine diphospho-N-acetylenolpyruvylglucosa 98.85
3i99_A 357 UDP-N-acetylenolpyruvoylglucosamine reductase; str 98.76
2gqt_A 268 UDP-N-acetylenolpyruvylglucosamine reductase; pept 98.64
1ffv_C 287 CUTM, flavoprotein of carbon monoxide dehydrogenas 97.19
2yvs_A219 Glycolate oxidase subunit GLCE; oxidoreductase; 2. 96.9
1n62_C 288 Carbon monoxide dehydrogenase medium chain; CODH, 96.47
3nvz_B 305 Xanthine dehydrogenase/oxidase; hydroxylase, homod 95.96
2w3s_A 462 Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2 95.79
3hrd_C 296 Nicotinate dehydrogenase FAD-subunit; selenium lig 95.3
1t3q_C 288 Quinoline 2-oxidoreductase medium subunit; QOR, mo 95.22
1rm6_B 324 4-hydroxybenzoyl-COA reductase beta subunit; xanth 92.32
1ffv_C 287 CUTM, flavoprotein of carbon monoxide dehydrogenas 87.8
3unc_A 1332 Xanthine dehydrogenase/oxidase; oxidoreductase; HE 85.77
>3pm9_A Putative oxidoreductase; putative D-2-hydroxyglutarate dehydrogenase, putative D-LACT dehydrogenase; HET: FAD; 2.57A {Rhodopseudomonas palustris} Back     alignment and structure
Probab=99.92  E-value=3e-25  Score=204.15  Aligned_cols=146  Identities=30%  Similarity=0.425  Sum_probs=133.9

Q ss_pred             cCCCHHHHHHHHHhhCCCCCCeecCccccccccccccccCCCCccEEEeCCCHHHHHHHHHHHHhCCCcEEEecCCCCCC
Q psy6765          23 SILNDTHIQKFKQILSNDDNRVLTDEDSVKPYNVDWLKTQEGKSKLVLKPKTTEEVSAILRYCNEQKIAVCPQGGNTGVV  102 (246)
Q Consensus        23 ~~~~~~~~~~L~~~l~~~~~~v~~~~~~~~~~~~~~~~~~~~~p~~vv~P~s~~ev~~~v~~a~~~~i~v~~~GgG~~~~  102 (246)
                      +.++.+++++|+++++  ++.+.++++.+..|++||+..+.+.|.+|++|+|++||+++|++|+++++|++++|||||+.
T Consensus        11 ~~~~~~~~~~L~~~lg--~~~v~~~~~~~~~~~~d~~~~~~~~p~~vv~P~s~eeV~~~v~~a~~~~~pv~~~GgGt~~~   88 (476)
T 3pm9_A           11 VTLSPELIARFTAIVG--DKHALTDPLELEAYITEERNLYRGHSPLVLRPGSTEEVVAICKLANEARVALVPQGGNTGLV   88 (476)
T ss_dssp             -CCCHHHHHHHHHHHC--GGGEECSHHHHHHHHBCTTCCCBCCCSCEECCCSHHHHHHHHHHHHHHTCCEEEESSSCCSS
T ss_pred             ccCCHHHHHHHHHhcC--CCcEecCHHHHHHHhcccccccCCCCCEEEecCCHHHHHHHHHHHHHcCCeEEEEeCCCCCC
Confidence            4578899999999999  78899998889999999988888999999999999999999999999999999999999999


Q ss_pred             CCcccCCCeEEEecCCCCCceeeeCCCCeEEEcCCccHHHHHHHHhhcCceeecCCCch-hHHhhHHhh
Q psy6765         103 AGGVPLYDEVIVSASLMNKILNFDELSGNVNSMSNALVTNRSLELSNTGVVVLGVPLYD-EVIVSASLM  170 (246)
Q Consensus       103 g~~~~~~~gvvidl~~m~~i~~id~~~~~v~v~aG~~~~~l~~~L~~~gl~~~~~p~s~-~~~~~~~~~  170 (246)
                      |+++++.+||+|||++||+|+++|+++.+++|+||+++.+|.+++.++|+.||.+|++. ..+.++...
T Consensus        89 g~~~~~~ggvvIdl~~m~~i~~id~~~~~v~V~aGv~~~~l~~~l~~~Gl~~~~~~~s~~~~tvGG~ia  157 (476)
T 3pm9_A           89 GGQTPHNGEVVISLKRMDKIREIDTSSNTITVEAGAILQRVQEKAAEVDRLFPLSLGAQGSCTIGGNLS  157 (476)
T ss_dssp             STTCCCSSCEEEECTTCCCEEEEETTTTEEEEETTCBHHHHHHHHHHTTEECCCCCTTTTTCBHHHHHH
T ss_pred             CCccCCCCcEEEEeeCCCceEEEcCCCCeEEECCCcCHHHHHHHHHHhCCccCCCCCCCCcEEEccccC
Confidence            99998778999999999999999999999999999999999999999999999998873 455666543
>4bby_A Alkyldihydroxyacetonephosphate synthase, peroxiso; transferase, plasmalogen, flavin, peroxisome; HET: FAD; 1.90A {Cavia porcellus} PDB: 4bc9_A* 4bca_A* 4bc7_A* Back     alignment and structure
>1wvf_A 4-cresol dehydrogenase [hydroxylating] flavoprote subunit; flavoprotein, electron-transfer, FAD, oxidoreductase; HET: FAD; 1.30A {Pseudomonas putida} SCOP: d.58.32.1 d.145.1.1 PDB: 1wve_A* 1dii_A* 1diq_A* Back     alignment and structure
>1e8g_A Vanillyl-alcohol oxidase; oxidoreductase, flavoenzyme, specificity; HET: FAD FCR; 2.1A {Penicillium simplicissimum} SCOP: d.58.32.1 d.145.1.1 PDB: 1e8f_A* 1e8h_A* 1qlt_A* 1qlu_A* 1vao_A* 1ahv_A* 1ahz_A* 1ahu_A* 2vao_A* 1w1j_A* 1dzn_A* 1w1l_A* 1e0y_A* 1w1k_A* 1w1m_A* Back     alignment and structure
>1f0x_A DLDH, D-lactate dehydrogenase; oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: d.58.32.2 d.145.1.1 Back     alignment and structure
>2uuu_A Alkyldihydroxyacetonephosphate synthase; transferase, lavoprotein, lipid synthesis, peroxisomal disor; HET: FAD PL3; 1.95A {Dictyostelium discoideum} PDB: 2uuv_A* Back     alignment and structure
>1w1o_A Cytokinin dehydrogenase 1; flavin, oxidoreductase, flavoprotein, FAD; HET: NAG FAD; 1.7A {Zea mays} SCOP: d.58.32.4 d.145.1.1 PDB: 1w1q_A* 1w1r_A* 1w1s_A* 3dq0_A* 2qkn_A* 3c0p_A* 3bw7_A* 2qpm_A* 3kjm_A* Back     alignment and structure
>3tsh_A Pollen allergen PHL P 4; flavoprotein, BI-covalent flavinylation, oxidoreductase, Glu dehydrogenase, N-glycosylation, allergy, dehydrogenase; HET: FDA; 1.90A {Phleum pratense} PDB: 3tsj_A* Back     alignment and structure
>1hsk_A UDP-N-acetylenolpyruvoylglucosamine reductase; peptidoglycan synthesis, cell WALL, cell division, oxidoreductase, NADP, flavoprotein, FAD; HET: FAD; 2.30A {Staphylococcus aureus} SCOP: d.145.1.2 d.146.1.1 Back     alignment and structure
>2exr_A Cytokinin dehydrogenase 7; AT5G21482.1, cytokinin oxidase/dehydrogenase, CKX, structura genomics, protein structure initiative; HET: MSE FAD; 1.70A {Arabidopsis thaliana} PDB: 2q4w_A* Back     alignment and structure
>3pop_A GILR oxidase; FAD binding protein, gilvocarcin, gilvocarcin biosynthesis, covalently bound FAD, oxidoreductase; HET: FAD; 1.65A {Streptomyces griseoflavus} PDB: 3pqb_A* Back     alignment and structure
>3rja_A Carbohydrate oxidase; protein-substrate analogue complex, FAD binding domain, BERB berberine-like domain, glucooligosaccharide oxidase; HET: FAD NAG ABL TRS; 2.10A {Microdochium nivale} PDB: 3rj8_A* Back     alignment and structure
>2ipi_A Aclacinomycin oxidoreductase (aknox); anthracycline, flavoenzyme, twinning, MAD; HET: AKY FAD; 1.65A {Streptomyces galilaeus} Back     alignment and structure
>3tx1_A UDP-N-acetylenolpyruvoylglucosamine reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: FAD; 2.69A {Listeria monocytogenes} Back     alignment and structure
>2wdx_A Putative hexose oxidase; oxidoreductase-antibiotic complex, glycopeptide; HET: FAD GHP 3MY 3FG OMY BMA NAG N1L T55; 2.30A {Nonomuraea SP} PDB: 2wdw_A* Back     alignment and structure
>2y3s_A TAML; oxidoreductase; HET: FAD TIR; 1.67A {Streptomyces SP} PDB: 2y3r_A* 2y08_A* 2y4g_A* Back     alignment and structure
>2bvf_A 6-hydroxy-D-nicotine oxidase; autoflavinylation, enantiomeric substrates, flavoenzymes, NI degradation; HET: FAD; 1.92A {Arthrobacter nicotinovorans} PDB: 2bvg_A* 2bvh_A* Back     alignment and structure
>4feh_A Oxidoreductase DPRE1; alpha+beta, decaprenylphosphoryl-beta-D-RIBO; HET: FAD; 2.04A {Mycobacterium tuberculosis} PDB: 4fdo_A* 4fdn_A* 4fdp_A* 4ff6_A* 4aut_A* 4f4q_A* 4g3t_A 4g3u_A Back     alignment and structure
>3js8_A Cholesterol oxidase; cholsterol, organic solvent stability, oxygen channel, FAD, flavoprotein, oxidoreductase; HET: FAD SUC; 1.54A {Chromobacterium SP} Back     alignment and structure
>3fw9_A Reticuline oxidase; BI-covalent flavinylation, N-glycosylation, alakloid biosynt oxidoreductase, alkaloid metabolism; HET: FAD SLX NAG MAN; 1.49A {Eschscholzia californica} PDB: 3d2h_A* 3d2d_A* 3d2j_A* 3gsy_A* 4ec3_A* 3fw8_A* 3fw7_A* 3fwa_A* Back     alignment and structure
>1zr6_A Glucooligosaccharide oxidase; alpha + beta, flavoenzyme, oxidoreductase; HET: NAG FAD; 1.55A {Acremonium strictum} PDB: 2axr_A* 3e0t_A* 3hsu_A* Back     alignment and structure
>2i0k_A Oxidoreductase; MIX alpha beta, covalent FAD, flavoenzyme; HET: FAD; 1.60A {Brevibacterium sterolicum} SCOP: d.58.32.3 d.145.1.1 PDB: 1i19_A* Back     alignment and structure
>3vte_A Tetrahydrocannabinolic acid synthase; BI-covalent flavinylation, oxidoreductase; HET: NAG FAD; 2.75A {Cannabis sativa} Back     alignment and structure
>2vfr_A Xylitol oxidase, alditol oxidase; FAD, sugar, polyol, flavin, flavoprotein, oxidoreductase; HET: FAD; 1.1A {Streptomyces coelicolor} PDB: 2vfs_A* 2vft_A* 2vfu_A* 2vfv_A* Back     alignment and structure
>4bby_A Alkyldihydroxyacetonephosphate synthase, peroxiso; transferase, plasmalogen, flavin, peroxisome; HET: FAD; 1.90A {Cavia porcellus} PDB: 4bc9_A* 4bca_A* 4bc7_A* Back     alignment and structure
>1uxy_A MURB, uridine diphospho-N-acetylenolpyruvylglucosamine reductase; peptidoglycan synthesis, cell WALL, cell division, oxidoreductase, NADP; HET: FAD EPU; 1.80A {Escherichia coli} SCOP: d.145.1.2 d.146.1.1 PDB: 1mbb_A* 1mbt_A* 2q85_A* 2mbr_A* Back     alignment and structure
>3i99_A UDP-N-acetylenolpyruvoylglucosamine reductase; structural genomics, center for structural of infectious diseases, csgid; HET: FAD; 2.20A {Vibrio cholerae} Back     alignment and structure
>3tsh_A Pollen allergen PHL P 4; flavoprotein, BI-covalent flavinylation, oxidoreductase, Glu dehydrogenase, N-glycosylation, allergy, dehydrogenase; HET: FDA; 1.90A {Phleum pratense} PDB: 3tsj_A* Back     alignment and structure
>3pm9_A Putative oxidoreductase; putative D-2-hydroxyglutarate dehydrogenase, putative D-LACT dehydrogenase; HET: FAD; 2.57A {Rhodopseudomonas palustris} Back     alignment and structure
>3pop_A GILR oxidase; FAD binding protein, gilvocarcin, gilvocarcin biosynthesis, covalently bound FAD, oxidoreductase; HET: FAD; 1.65A {Streptomyces griseoflavus} PDB: 3pqb_A* Back     alignment and structure
>3fw9_A Reticuline oxidase; BI-covalent flavinylation, N-glycosylation, alakloid biosynt oxidoreductase, alkaloid metabolism; HET: FAD SLX NAG MAN; 1.49A {Eschscholzia californica} PDB: 3d2h_A* 3d2d_A* 3d2j_A* 3gsy_A* 4ec3_A* 3fw8_A* 3fw7_A* 3fwa_A* Back     alignment and structure
>2gqt_A UDP-N-acetylenolpyruvylglucosamine reductase; peptidoglycan biosynthesis, enolpyruvyl-UDP-N- acetylglucosamine, flavin adenine dinucleotide; HET: FAD; 1.30A {Thermus caldophilus} PDB: 2gqu_A* Back     alignment and structure
>3rja_A Carbohydrate oxidase; protein-substrate analogue complex, FAD binding domain, BERB berberine-like domain, glucooligosaccharide oxidase; HET: FAD NAG ABL TRS; 2.10A {Microdochium nivale} PDB: 3rj8_A* Back     alignment and structure
>3vte_A Tetrahydrocannabinolic acid synthase; BI-covalent flavinylation, oxidoreductase; HET: NAG FAD; 2.75A {Cannabis sativa} Back     alignment and structure
>2wdx_A Putative hexose oxidase; oxidoreductase-antibiotic complex, glycopeptide; HET: FAD GHP 3MY 3FG OMY BMA NAG N1L T55; 2.30A {Nonomuraea SP} PDB: 2wdw_A* Back     alignment and structure
>2y3s_A TAML; oxidoreductase; HET: FAD TIR; 1.67A {Streptomyces SP} PDB: 2y3r_A* 2y08_A* 2y4g_A* Back     alignment and structure
>2ipi_A Aclacinomycin oxidoreductase (aknox); anthracycline, flavoenzyme, twinning, MAD; HET: AKY FAD; 1.65A {Streptomyces galilaeus} Back     alignment and structure
>1wvf_A 4-cresol dehydrogenase [hydroxylating] flavoprote subunit; flavoprotein, electron-transfer, FAD, oxidoreductase; HET: FAD; 1.30A {Pseudomonas putida} SCOP: d.58.32.1 d.145.1.1 PDB: 1wve_A* 1dii_A* 1diq_A* Back     alignment and structure
>1f0x_A DLDH, D-lactate dehydrogenase; oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: d.58.32.2 d.145.1.1 Back     alignment and structure
>1zr6_A Glucooligosaccharide oxidase; alpha + beta, flavoenzyme, oxidoreductase; HET: NAG FAD; 1.55A {Acremonium strictum} PDB: 2axr_A* 3e0t_A* 3hsu_A* Back     alignment and structure
>1e8g_A Vanillyl-alcohol oxidase; oxidoreductase, flavoenzyme, specificity; HET: FAD FCR; 2.1A {Penicillium simplicissimum} SCOP: d.58.32.1 d.145.1.1 PDB: 1e8f_A* 1e8h_A* 1qlt_A* 1qlu_A* 1vao_A* 1ahv_A* 1ahz_A* 1ahu_A* 2vao_A* 1w1j_A* 1dzn_A* 1w1l_A* 1e0y_A* 1w1k_A* 1w1m_A* Back     alignment and structure
>2uuu_A Alkyldihydroxyacetonephosphate synthase; transferase, lavoprotein, lipid synthesis, peroxisomal disor; HET: FAD PL3; 1.95A {Dictyostelium discoideum} PDB: 2uuv_A* Back     alignment and structure
>2bvf_A 6-hydroxy-D-nicotine oxidase; autoflavinylation, enantiomeric substrates, flavoenzymes, NI degradation; HET: FAD; 1.92A {Arthrobacter nicotinovorans} PDB: 2bvg_A* 2bvh_A* Back     alignment and structure
>2exr_A Cytokinin dehydrogenase 7; AT5G21482.1, cytokinin oxidase/dehydrogenase, CKX, structura genomics, protein structure initiative; HET: MSE FAD; 1.70A {Arabidopsis thaliana} PDB: 2q4w_A* Back     alignment and structure
>1hsk_A UDP-N-acetylenolpyruvoylglucosamine reductase; peptidoglycan synthesis, cell WALL, cell division, oxidoreductase, NADP, flavoprotein, FAD; HET: FAD; 2.30A {Staphylococcus aureus} SCOP: d.145.1.2 d.146.1.1 Back     alignment and structure
>1w1o_A Cytokinin dehydrogenase 1; flavin, oxidoreductase, flavoprotein, FAD; HET: NAG FAD; 1.7A {Zea mays} SCOP: d.58.32.4 d.145.1.1 PDB: 1w1q_A* 1w1r_A* 1w1s_A* 3dq0_A* 2qkn_A* 3c0p_A* 3bw7_A* 2qpm_A* 3kjm_A* Back     alignment and structure
>4feh_A Oxidoreductase DPRE1; alpha+beta, decaprenylphosphoryl-beta-D-RIBO; HET: FAD; 2.04A {Mycobacterium tuberculosis} PDB: 4fdo_A* 4fdn_A* 4fdp_A* 4ff6_A* 4aut_A* 4f4q_A* 4g3t_A 4g3u_A Back     alignment and structure
>3tx1_A UDP-N-acetylenolpyruvoylglucosamine reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: FAD; 2.69A {Listeria monocytogenes} Back     alignment and structure
>3js8_A Cholesterol oxidase; cholsterol, organic solvent stability, oxygen channel, FAD, flavoprotein, oxidoreductase; HET: FAD SUC; 1.54A {Chromobacterium SP} Back     alignment and structure
>2i0k_A Oxidoreductase; MIX alpha beta, covalent FAD, flavoenzyme; HET: FAD; 1.60A {Brevibacterium sterolicum} SCOP: d.58.32.3 d.145.1.1 PDB: 1i19_A* Back     alignment and structure
>2vfr_A Xylitol oxidase, alditol oxidase; FAD, sugar, polyol, flavin, flavoprotein, oxidoreductase; HET: FAD; 1.1A {Streptomyces coelicolor} PDB: 2vfs_A* 2vft_A* 2vfu_A* 2vfv_A* Back     alignment and structure
>1uxy_A MURB, uridine diphospho-N-acetylenolpyruvylglucosamine reductase; peptidoglycan synthesis, cell WALL, cell division, oxidoreductase, NADP; HET: FAD EPU; 1.80A {Escherichia coli} SCOP: d.145.1.2 d.146.1.1 PDB: 1mbb_A* 1mbt_A* 2q85_A* 2mbr_A* Back     alignment and structure
>3i99_A UDP-N-acetylenolpyruvoylglucosamine reductase; structural genomics, center for structural of infectious diseases, csgid; HET: FAD; 2.20A {Vibrio cholerae} Back     alignment and structure
>2gqt_A UDP-N-acetylenolpyruvylglucosamine reductase; peptidoglycan biosynthesis, enolpyruvyl-UDP-N- acetylglucosamine, flavin adenine dinucleotide; HET: FAD; 1.30A {Thermus caldophilus} PDB: 2gqu_A* Back     alignment and structure
>1ffv_C CUTM, flavoprotein of carbon monoxide dehydrogenase; hydrolase; HET: ARO PCD FAD; 2.25A {Hydrogenophaga pseudoflava} SCOP: d.87.2.1 d.145.1.3 PDB: 1ffu_C* Back     alignment and structure
>2yvs_A Glycolate oxidase subunit GLCE; oxidoreductase; 2.00A {Thermus thermophilus} Back     alignment and structure
>1n62_C Carbon monoxide dehydrogenase medium chain; CODH, molybdenum, molybdopterin, oxidoreductase; HET: CUB MCN FAD; 1.09A {Oligotropha carboxidovorans} SCOP: d.87.2.1 d.145.1.3 PDB: 1n5w_C* 1n61_C* 1n60_C* 1n63_C* 1zxi_C* Back     alignment and structure
>3nvz_B Xanthine dehydrogenase/oxidase; hydroxylase, homodimer, xanthine oxidase, indole-3-aldehyde, oxidoreductase; HET: FAD MTE I3A; 1.60A {Bos taurus} PDB: 3eub_B* 3etr_B* 3ns1_B* 3nrz_B* 3rca_B* 3sr6_B* 3nvw_B* 3nvv_B* 3nvy_B* Back     alignment and structure
>2w3s_A Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2S, iron-sulfur, oxidoreductase, purine metabolism, molybdenum cofactor, hypoxanthine; HET: MPN FAD XAN; 2.60A {Rhodobacter capsulatus} PDB: 2w3r_A* 2w54_A* 2w55_A* 1jro_A* 1jrp_A* Back     alignment and structure
>3hrd_C Nicotinate dehydrogenase FAD-subunit; selenium ligand, iron, iron-sulfur, metal-binding, oxidoreductase; HET: MCN FAD; 2.20A {Eubacterium barkeri} Back     alignment and structure
>1t3q_C Quinoline 2-oxidoreductase medium subunit; QOR, molybdenum, MCD; HET: FAD MCN; 1.80A {Pseudomonas putida} SCOP: d.87.2.1 d.145.1.3 Back     alignment and structure
>1rm6_B 4-hydroxybenzoyl-COA reductase beta subunit; xanthine oxidase family, dimer heterotrimers, oxidoreductase; HET: PCD FAD SF4 EPE; 1.60A {Thauera aromatica} SCOP: d.87.2.1 d.145.1.3 PDB: 1sb3_B* Back     alignment and structure
>1ffv_C CUTM, flavoprotein of carbon monoxide dehydrogenase; hydrolase; HET: ARO PCD FAD; 2.25A {Hydrogenophaga pseudoflava} SCOP: d.87.2.1 d.145.1.3 PDB: 1ffu_C* Back     alignment and structure
>3unc_A Xanthine dehydrogenase/oxidase; oxidoreductase; HET: MTE FAD SAL; 1.65A {Bos taurus} PDB: 3una_A* 3uni_A* 1v97_A* 1fo4_A* 1vdv_A* 3am9_A* 3amz_A* 3ax7_A* 3ax9_A* 3bdj_A* 1n5x_A* 2ckj_A* 2e1q_A* 3an1_A* 2e3t_A* 1wyg_A* 3b9j_B* 1fiq_B* 3b9j_A* 1fiq_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 246
d1f0xa2265 d.145.1.1 (A:9-273) D-lactate dehydrogenase {Esche 7e-15
d1f0xa2 265 d.145.1.1 (A:9-273) D-lactate dehydrogenase {Esche 3e-06
d1w1oa2206 d.145.1.1 (A:40-245) Cytokinin dehydrogenase 1 {Ma 2e-13
d1w1oa2 206 d.145.1.1 (A:40-245) Cytokinin dehydrogenase 1 {Ma 4e-06
d1wvfa2236 d.145.1.1 (A:7-242) Flavoprotein subunit of p-cres 2e-12
d1wvfa2 236 d.145.1.1 (A:7-242) Flavoprotein subunit of p-cres 0.004
d2i0ka2216 d.145.1.1 (A:58-273) Cholesterol oxidase {Brevibac 4e-10
d2i0ka2 216 d.145.1.1 (A:58-273) Cholesterol oxidase {Brevibac 8e-08
d1e8ga2268 d.145.1.1 (A:6-273) Vanillyl-alcohol oxidase {Fung 4e-08
d1e8ga2 268 d.145.1.1 (A:6-273) Vanillyl-alcohol oxidase {Fung 0.004
>d1f0xa2 d.145.1.1 (A:9-273) D-lactate dehydrogenase {Escherichia coli [TaxId: 562]} Length = 265 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FAD-binding/transporter-associated domain-like
superfamily: FAD-binding/transporter-associated domain-like
family: FAD-linked oxidases, N-terminal domain
domain: D-lactate dehydrogenase
species: Escherichia coli [TaxId: 562]

 Score = 69.8 bits (170), Expect = 7e-15
 Identities = 17/95 (17%), Positives = 41/95 (43%), Gaps = 3/95 (3%)

Query: 26  NDTHIQKFKQILSNDDNRVLTDEDSVKPYNVDWLKTQEGKSKLVLKPKTTEEVSAILRYC 85
           N   + +  +++    + +LTD      Y   + ++ +G +  V+ P +  E+  +L+ C
Sbjct: 1   NKAFLNELARLV--GSSHLLTDPAKTARYRKGF-RSGQGDALAVVFPGSLLELWRVLKAC 57

Query: 86  NEQKIAVCPQGGNTGVVAGGVPLYDEVIVSASLMN 120
                 +  Q  NTG+  G  P  ++      +++
Sbjct: 58  VTADKIILMQAANTGLTEGSTPNGNDYDRDVVIIS 92
>d1f0xa2 d.145.1.1 (A:9-273) D-lactate dehydrogenase {Escherichia coli [TaxId: 562]} Length = 265 Back     information, alignment and structure
>d1w1oa2 d.145.1.1 (A:40-245) Cytokinin dehydrogenase 1 {Maize (Zea mays) [TaxId: 4577]} Length = 206 Back     information, alignment and structure
>d1w1oa2 d.145.1.1 (A:40-245) Cytokinin dehydrogenase 1 {Maize (Zea mays) [TaxId: 4577]} Length = 206 Back     information, alignment and structure
>d1wvfa2 d.145.1.1 (A:7-242) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida [TaxId: 303]} Length = 236 Back     information, alignment and structure
>d1wvfa2 d.145.1.1 (A:7-242) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida [TaxId: 303]} Length = 236 Back     information, alignment and structure
>d2i0ka2 d.145.1.1 (A:58-273) Cholesterol oxidase {Brevibacterium sterolicum [TaxId: 1702]} Length = 216 Back     information, alignment and structure
>d2i0ka2 d.145.1.1 (A:58-273) Cholesterol oxidase {Brevibacterium sterolicum [TaxId: 1702]} Length = 216 Back     information, alignment and structure
>d1e8ga2 d.145.1.1 (A:6-273) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum) [TaxId: 69488]} Length = 268 Back     information, alignment and structure
>d1e8ga2 d.145.1.1 (A:6-273) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum) [TaxId: 69488]} Length = 268 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query246
d1wvfa2236 Flavoprotein subunit of p-cresol methylhydroxylase 99.93
d1f0xa2265 D-lactate dehydrogenase {Escherichia coli [TaxId: 99.92
d1w1oa2206 Cytokinin dehydrogenase 1 {Maize (Zea mays) [TaxId 99.89
d1e8ga2268 Vanillyl-alcohol oxidase {Fungus (Penicillium simp 99.88
d2i0ka2216 Cholesterol oxidase {Brevibacterium sterolicum [Ta 99.76
d1hska1194 Uridine diphospho-N-Acetylenolpyruvylglucosamine r 99.74
d1wvfa2 236 Flavoprotein subunit of p-cresol methylhydroxylase 99.58
d1f0xa2 265 D-lactate dehydrogenase {Escherichia coli [TaxId: 99.54
d1w1oa2 206 Cytokinin dehydrogenase 1 {Maize (Zea mays) [TaxId 99.46
d1uxya1198 Uridine diphospho-N-Acetylenolpyruvylglucosamine r 99.45
d1e8ga2 268 Vanillyl-alcohol oxidase {Fungus (Penicillium simp 99.44
d2i0ka2 216 Cholesterol oxidase {Brevibacterium sterolicum [Ta 99.16
d1hska1194 Uridine diphospho-N-Acetylenolpyruvylglucosamine r 98.93
d1uxya1 198 Uridine diphospho-N-Acetylenolpyruvylglucosamine r 98.39
d1ffvc2177 Carbon monoxide (CO) dehydrogenase flavoprotein, N 95.79
d1v97a6223 Xanthine oxidase, domain 3 (?) {Cow (Bos taurus) [ 95.4
d1t3qc2176 Quinoline 2-oxidoreductase medium subunit QorM {Ps 95.23
d1rm6b2216 4-hydroxybenzoyl-CoA reductase beta subunit HrcB, 95.11
d1jroa4167 Xanthine dehydrogenase chain A, domain 3 {Rhodobac 95.07
d1n62c2177 Carbon monoxide (CO) dehydrogenase flavoprotein, N 94.42
d1l0ba297 Breast cancer associated protein, BRCA1 {Rat (Ratt 89.85
>d1wvfa2 d.145.1.1 (A:7-242) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FAD-binding/transporter-associated domain-like
superfamily: FAD-binding/transporter-associated domain-like
family: FAD-linked oxidases, N-terminal domain
domain: Flavoprotein subunit of p-cresol methylhydroxylase
species: Pseudomonas putida [TaxId: 303]

Probab=99.93  E-value=1.2e-25  Score=187.15  Aligned_cols=135  Identities=21%  Similarity=0.304  Sum_probs=119.5

Q ss_pred             HHHHHHHHHhhCCCCCCeecCccccccccccccc--cCCCCccEEEeCCCHHHHHHHHHHHHhCCCcEEEecCCCCCCCC
Q psy6765          27 DTHIQKFKQILSNDDNRVLTDEDSVKPYNVDWLK--TQEGKSKLVLKPKTTEEVSAILRYCNEQKIAVCPQGGNTGVVAG  104 (246)
Q Consensus        27 ~~~~~~L~~~l~~~~~~v~~~~~~~~~~~~~~~~--~~~~~p~~vv~P~s~~ev~~~v~~a~~~~i~v~~~GgG~~~~g~  104 (246)
                      ++++++|++++|  +++|+++++++..|++||+.  .....|.+||+|+|++||+++|++|+++++|+.++|+||++.++
T Consensus        13 ~~~v~~l~~ivG--~~~V~~~~~~~~~y~~d~~~~~~~~~~P~~Vv~P~s~eeV~~iv~~a~~~~~~i~~~g~G~s~~~g   90 (236)
T d1wvfa2          13 NKAVQKFRALLG--DDNVLVESDQLVPYNKIMMPVENAAHAPSAAVTATTVEQVQGVVKICNEHKIPIWTISTGRNFGYG   90 (236)
T ss_dssp             HHHHHHHHHHHC--GGGEECSHHHHHHHHCCCSSSCGGGGCCSEEEECCSHHHHHHHHHHHHHHTCCEEEESSCCCTTTT
T ss_pred             HHHHHHHHHHcC--CccEEECHHHHHHHhCccccccccCcCCCEEEecCCHHHHHHHHHHHHcCCcceeccccccccccc
Confidence            346789999999  78999999999999998753  35678999999999999999999999999999999999998654


Q ss_pred             cc-c-CCCeEEEecCCCCCceeeeCCCCeEEEcCCccHHHHHHHHhhcCceeecCCCchhH
Q psy6765         105 GV-P-LYDEVIVSASLMNKILNFDELSGNVNSMSNALVTNRSLELSNTGVVVLGVPLYDEV  163 (246)
Q Consensus       105 ~~-~-~~~gvvidl~~m~~i~~id~~~~~v~v~aG~~~~~l~~~L~~~gl~~~~~p~s~~~  163 (246)
                      .. + .+++|+|||++||+|+++|+++++++|++|++|.++.++|.++|+.++++|+....
T Consensus        91 ~~~~~~~~~ividl~~mn~i~~id~~~~~v~v~aG~~~~~l~~~l~~~g~~~~~~~~~~~~  151 (236)
T d1wvfa2          91 SAAPVQRGQVILDLKKMNKIIKIDPEMCYALVEPGVTFGQMYDYIQENNLPVMLSFSAPSA  151 (236)
T ss_dssp             TTSCSSTTCEEEECTTCCCEEEEETTTTEEEECTTCCHHHHHHHHHHTTCSEECCCCSSCT
T ss_pred             ccccccceEEEeecccccchhhhcccccceehhhhhhhhhhHHHHhhhccccccccccccc
Confidence            43 2 35689999999999999999999999999999999999999999999988876443
>d1f0xa2 d.145.1.1 (A:9-273) D-lactate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w1oa2 d.145.1.1 (A:40-245) Cytokinin dehydrogenase 1 {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1e8ga2 d.145.1.1 (A:6-273) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum) [TaxId: 69488]} Back     information, alignment and structure
>d2i0ka2 d.145.1.1 (A:58-273) Cholesterol oxidase {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1hska1 d.145.1.2 (A:15-208) Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1wvfa2 d.145.1.1 (A:7-242) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1f0xa2 d.145.1.1 (A:9-273) D-lactate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w1oa2 d.145.1.1 (A:40-245) Cytokinin dehydrogenase 1 {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1uxya1 d.145.1.2 (A:3-200) Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e8ga2 d.145.1.1 (A:6-273) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum) [TaxId: 69488]} Back     information, alignment and structure
>d2i0ka2 d.145.1.1 (A:58-273) Cholesterol oxidase {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1hska1 d.145.1.2 (A:15-208) Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1uxya1 d.145.1.2 (A:3-200) Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ffvc2 d.145.1.3 (C:1-177) Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain {Hydrogenophaga pseudoflava [TaxId: 47421]} Back     information, alignment and structure
>d1v97a6 d.145.1.3 (A:192-414) Xanthine oxidase, domain 3 (?) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1t3qc2 d.145.1.3 (C:1-176) Quinoline 2-oxidoreductase medium subunit QorM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1rm6b2 d.145.1.3 (B:1-216) 4-hydroxybenzoyl-CoA reductase beta subunit HrcB, N-terminal domain {Thauera aromatica [TaxId: 59405]} Back     information, alignment and structure
>d1jroa4 d.145.1.3 (A:179-345) Xanthine dehydrogenase chain A, domain 3 {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1n62c2 d.145.1.3 (C:1-177) Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]} Back     information, alignment and structure
>d1l0ba2 c.15.1.3 (A:1705-1801) Breast cancer associated protein, BRCA1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure