Psyllid ID: psy7177


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60------
MCVRPSKGVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYKKRDEDSDVEVSGP
cccccccccccccEEEEEEccccccEEEEcccccEEEccccccccccEEEEEEEEccccccccccc
cEEEcccccccccEEEEEEccccccEEEEcccccccccccccccccEEEEEEEEcccccccccccc
mcvrpskgvsaghytaytlhpntkewhyfndetvleqrpqdedfnNAYILFYkkrdedsdvevsgp
mcvrpskgvsaghytaytlhpntkEWHYFNDETVLEQRPQDEDFNNAYILFykkrdedsdvevsgp
MCVRPSKGVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYKKRDEDSDVEVSGP
**********AGHYTAYTLHPNTKEWHYFNDETVLEQR**DEDFNNAYILFY**************
MCVRPSKGVSAGHYTAYTLHPNTKEWHYFNDETVLEQR***EDFNNAYILFY**************
*********SAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYKKRD**********
MCVRPSKGVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYKKRD**********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiii
iiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCVRPSKGVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYKKRDEDSDVEVSGP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query66 2.2.26 [Sep-21-2011]
O75604605 Ubiquitin carboxyl-termin yes N/A 0.651 0.071 0.465 4e-05
Q5U349618 Ubiquitin carboxyl-termin yes N/A 0.651 0.069 0.465 7e-05
O88623613 Ubiquitin carboxyl-termin yes N/A 0.651 0.070 0.465 7e-05
P351251406 Ubiquitin carboxyl-termin no N/A 0.742 0.034 0.42 0.0001
Q91W36520 Ubiquitin carboxyl-termin no N/A 0.878 0.111 0.4 0.0001
Q8NFA01604 Ubiquitin carboxyl-termin no N/A 0.742 0.030 0.4 0.0002
Q8BUM9 1132 Ubiquitin carboxyl-termin no N/A 0.727 0.042 0.395 0.0004
Q99K46921 Ubiquitin carboxyl-termin no N/A 0.742 0.053 0.346 0.0004
Q70EL4 1123 Ubiquitin carboxyl-termin no N/A 0.727 0.042 0.395 0.0004
P51784963 Ubiquitin carboxyl-termin no N/A 0.742 0.050 0.346 0.0004
>sp|O75604|UBP2_HUMAN Ubiquitin carboxyl-terminal hydrolase 2 OS=Homo sapiens GN=USP2 PE=1 SV=2 Back     alignment and function desciption
 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 25/43 (58%)

Query: 11  AGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYK 53
            GHYTAY   P T EWH FND +V          ++AY+LFY+
Sbjct: 555 GGHYTAYCRSPGTGEWHTFNDSSVTPMSSSQVRTSDAYLLFYE 597




Hydrolase that deubiquitinates polyubiquitinated target proteins such as MDM2, MDM4 and CCND1. Isoform 1 and isoform 4 possess both ubiquitin-specific peptidase and isopeptidase activities. Deubiquitinates MDM2 without reversing MDM2-mediated p53/TP53 ubiquitination and thus indirectly promotes p53/TP53 degradation and limits p53 activity. Has no deubiquitinase activity against p53/TP53. Prevents MDM2-mediated degradation of MDM4. Plays a role in the G1/S cell-cycle progression in normal and cancer cells. Plays a role in the regulation of myogenic differentiation of embryonic muscle cells.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 4EC: .EC: 1EC: 9EC: .EC: 1EC: 2
>sp|Q5U349|UBP2_RAT Ubiquitin carboxyl-terminal hydrolase 2 OS=Rattus norvegicus GN=Usp2 PE=1 SV=1 Back     alignment and function description
>sp|O88623|UBP2_MOUSE Ubiquitin carboxyl-terminal hydrolase 2 OS=Mus musculus GN=Usp2 PE=1 SV=2 Back     alignment and function description
>sp|P35125|UBP6_HUMAN Ubiquitin carboxyl-terminal hydrolase 6 OS=Homo sapiens GN=USP6 PE=1 SV=2 Back     alignment and function description
>sp|Q91W36|UBP3_MOUSE Ubiquitin carboxyl-terminal hydrolase 3 OS=Mus musculus GN=Usp3 PE=2 SV=1 Back     alignment and function description
>sp|Q8NFA0|UBP32_HUMAN Ubiquitin carboxyl-terminal hydrolase 32 OS=Homo sapiens GN=USP32 PE=1 SV=1 Back     alignment and function description
>sp|Q8BUM9|UBP43_MOUSE Ubiquitin carboxyl-terminal hydrolase 43 OS=Mus musculus GN=Usp43 PE=2 SV=2 Back     alignment and function description
>sp|Q99K46|UBP11_MOUSE Ubiquitin carboxyl-terminal hydrolase 11 OS=Mus musculus GN=Usp11 PE=2 SV=4 Back     alignment and function description
>sp|Q70EL4|UBP43_HUMAN Ubiquitin carboxyl-terminal hydrolase 43 OS=Homo sapiens GN=USP43 PE=1 SV=2 Back     alignment and function description
>sp|P51784|UBP11_HUMAN Ubiquitin carboxyl-terminal hydrolase 11 OS=Homo sapiens GN=USP11 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query66
321475567 1180 hypothetical protein DAPPUDRAFT_307840 [ 0.712 0.039 0.659 7e-13
242007158 845 predicted protein [Pediculus humanus cor 0.818 0.063 0.592 2e-12
307183092 1048 Ubiquitin carboxyl-terminal hydrolase 32 0.818 0.051 0.611 5e-12
332024377 1053 Ubiquitin carboxyl-terminal hydrolase 32 0.818 0.051 0.611 6e-12
307213501 1054 Ubiquitin carboxyl-terminal hydrolase 32 0.818 0.051 0.611 6e-12
383858846 1050 PREDICTED: uncharacterized protein LOC10 0.818 0.051 0.611 7e-12
345487479 1022 PREDICTED: LOW QUALITY PROTEIN: ubiquiti 0.818 0.052 0.592 1e-11
350396230 1052 PREDICTED: ubiquitin carboxyl-terminal h 0.818 0.051 0.592 2e-11
328715747 898 PREDICTED: ubiquitin carboxyl-terminal h 0.893 0.065 0.516 1e-10
260807898 1291 hypothetical protein BRAFLDRAFT_95861 [B 0.818 0.041 0.481 2e-09
>gi|321475567|gb|EFX86529.1| hypothetical protein DAPPUDRAFT_307840 [Daphnia pulex] Back     alignment and taxonomy information
 Score = 77.8 bits (190), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 31/47 (65%), Positives = 41/47 (87%)

Query: 9    VSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYKKR 55
             S+GHYTAYT H N+K+WHY+NDETVL + PQDEDF++ Y+LFY++R
Sbjct: 1117 ASSGHYTAYTRHVNSKDWHYYNDETVLSRAPQDEDFSHGYVLFYQRR 1163




Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242007158|ref|XP_002424409.1| predicted protein [Pediculus humanus corporis] gi|212507809|gb|EEB11671.1| predicted protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307183092|gb|EFN70009.1| Ubiquitin carboxyl-terminal hydrolase 32 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332024377|gb|EGI64575.1| Ubiquitin carboxyl-terminal hydrolase 32 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307213501|gb|EFN88910.1| Ubiquitin carboxyl-terminal hydrolase 32 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383858846|ref|XP_003704910.1| PREDICTED: uncharacterized protein LOC100877443 [Megachile rotundata] Back     alignment and taxonomy information
>gi|345487479|ref|XP_001600155.2| PREDICTED: LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 43-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|350396230|ref|XP_003484486.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 43-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|328715747|ref|XP_001949023.2| PREDICTED: ubiquitin carboxyl-terminal hydrolase 4-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|260807898|ref|XP_002598745.1| hypothetical protein BRAFLDRAFT_95861 [Branchiostoma floridae] gi|229284019|gb|EEN54757.1| hypothetical protein BRAFLDRAFT_95861 [Branchiostoma floridae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query66
UNIPROTKB|F1NUS3447 F1NUS3 "Uncharacterized protei 0.636 0.093 0.452 4.3e-07
SGD|S000003733 1254 UBP12 "Ubiquitin-specific prot 0.803 0.042 0.396 2.8e-06
UNIPROTKB|F1S200389 LOC100737416 "Uncharacterized 0.742 0.125 0.4 4.3e-06
UNIPROTKB|E9PPM2362 USP2 "Ubiquitin carboxyl-termi 0.636 0.116 0.476 8.1e-06
CGD|CAL0000531 1372 orf19.6260 [Candida albicans ( 0.727 0.034 0.448 8.4e-06
UNIPROTKB|F1NUS4161 F1NUS4 "Uncharacterized protei 0.636 0.260 0.452 9e-06
UNIPROTKB|I3LJX6137 LOC100624494 "Uncharacterized 0.727 0.350 0.464 1.1e-05
UNIPROTKB|O75604605 USP2 "Ubiquitin carboxyl-termi 0.636 0.069 0.476 1.7e-05
MGI|MGI:2152450520 Usp3 "ubiquitin specific pepti 0.878 0.111 0.4 1.8e-05
UNIPROTKB|P351251406 USP6 "Ubiquitin carboxyl-termi 0.742 0.034 0.42 2.3e-05
UNIPROTKB|F1NUS3 F1NUS3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 103 (41.3 bits), Expect = 4.3e-07, Sum P(2) = 4.3e-07
 Identities = 19/42 (45%), Positives = 24/42 (57%)

Query:    12 GHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYK 53
             GHYTAY   P + EWH FND  V          ++AY+LFY+
Sbjct:   398 GHYTAYCKSPISSEWHSFNDSRVTPMSSSHVRSSDAYLLFYE 439


GO:0004221 "ubiquitin thiolesterase activity" evidence=IEA
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=IEA
SGD|S000003733 UBP12 "Ubiquitin-specific protease" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|F1S200 LOC100737416 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E9PPM2 USP2 "Ubiquitin carboxyl-terminal hydrolase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
CGD|CAL0000531 orf19.6260 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|F1NUS4 F1NUS4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|I3LJX6 LOC100624494 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|O75604 USP2 "Ubiquitin carboxyl-terminal hydrolase 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2152450 Usp3 "ubiquitin specific peptidase 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P35125 USP6 "Ubiquitin carboxyl-terminal hydrolase 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query66
cd02674230 cd02674, Peptidase_C19R, A subfamily of peptidase 2e-15
cd02257255 cd02257, Peptidase_C19, Peptidase C19 contains ubi 8e-11
pfam00443313 pfam00443, UCH, Ubiquitin carboxyl-terminal hydrol 2e-09
COG5560823 COG5560, UBP12, Ubiquitin C-terminal hydrolase [Po 9e-09
cd02668324 cd02668, Peptidase_C19L, A subfamily of Peptidase 1e-05
cd02657305 cd02657, Peptidase_C19A, A subfamily of Peptidase 2e-05
cd02661304 cd02661, Peptidase_C19E, A subfamily of Peptidase 2e-04
cd02658311 cd02658, Peptidase_C19B, A subfamily of Peptidase 2e-04
cd02659334 cd02659, peptidase_C19C, A subfamily of Peptidase 4e-04
COG5207749 COG5207, UBP14, Isopeptidase T [Posttranslational 0.003
>gnl|CDD|239139 cd02674, Peptidase_C19R, A subfamily of peptidase C19 Back     alignment and domain information
 Score = 66.9 bits (164), Expect = 2e-15
 Identities = 17/46 (36%), Positives = 27/46 (58%)

Query: 8   GVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYK 53
            ++ GHYTAY  +  T +W+ F+D  V +        ++AYILFY+
Sbjct: 185 SLNGGHYTAYCKNNETNDWYKFDDSRVTKVSESSVVSSSAYILFYE 230


Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome. Length = 230

>gnl|CDD|239072 cd02257, Peptidase_C19, Peptidase C19 contains ubiquitinyl hydrolases Back     alignment and domain information
>gnl|CDD|215922 pfam00443, UCH, Ubiquitin carboxyl-terminal hydrolase Back     alignment and domain information
>gnl|CDD|227847 COG5560, UBP12, Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|239133 cd02668, Peptidase_C19L, A subfamily of Peptidase C19 Back     alignment and domain information
>gnl|CDD|239122 cd02657, Peptidase_C19A, A subfamily of Peptidase C19 Back     alignment and domain information
>gnl|CDD|239126 cd02661, Peptidase_C19E, A subfamily of Peptidase C19 Back     alignment and domain information
>gnl|CDD|239123 cd02658, Peptidase_C19B, A subfamily of Peptidase C19 Back     alignment and domain information
>gnl|CDD|239124 cd02659, peptidase_C19C, A subfamily of Peptidase C19 Back     alignment and domain information
>gnl|CDD|227532 COG5207, UBP14, Isopeptidase T [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 66
cd02667279 Peptidase_C19K A subfamily of Peptidase C19. Pepti 99.82
cd02673245 Peptidase_C19Q A subfamily of Peptidase C19. Pepti 99.82
cd02664327 Peptidase_C19H A subfamily of Peptidase C19. Pepti 99.82
cd02662240 Peptidase_C19F A subfamily of Peptidase C19. Pepti 99.82
cd02659334 peptidase_C19C A subfamily of Peptidase C19. Pepti 99.81
cd02658311 Peptidase_C19B A subfamily of Peptidase C19. Pepti 99.81
cd02663300 Peptidase_C19G A subfamily of Peptidase C19. Pepti 99.81
cd02657305 Peptidase_C19A A subfamily of Peptidase C19. Pepti 99.81
KOG1865|consensus 545 99.8
cd02665228 Peptidase_C19I A subfamily of Peptidase C19. Pepti 99.79
PF00443269 UCH: Ubiquitin carboxyl-terminal hydrolase; InterP 99.79
cd02668324 Peptidase_C19L A subfamily of Peptidase C19. Pepti 99.78
cd02670241 Peptidase_C19N A subfamily of Peptidase C19. Pepti 99.78
COG5560823 UBP12 Ubiquitin C-terminal hydrolase [Posttranslat 99.78
cd02669440 Peptidase_C19M A subfamily of Peptidase C19. Pepti 99.78
cd02674230 Peptidase_C19R A subfamily of peptidase C19. Pepti 99.77
cd02660328 Peptidase_C19D A subfamily of Peptidase C19. Pepti 99.77
cd02661304 Peptidase_C19E A subfamily of Peptidase C19. Pepti 99.76
KOG1868|consensus653 99.74
cd02257255 Peptidase_C19 Peptidase C19 contains ubiquitinyl h 99.74
cd02671332 Peptidase_C19O A subfamily of Peptidase C19. Pepti 99.7
KOG1870|consensus842 99.7
cd02672268 Peptidase_C19P A subfamily of Peptidase C19. Pepti 99.68
KOG1867|consensus492 99.68
cd02666343 Peptidase_C19J A subfamily of Peptidase C19. Pepti 99.62
COG5533415 UBP5 Ubiquitin C-terminal hydrolase [Posttranslati 99.6
KOG4598|consensus 1203 99.53
KOG1866|consensus 944 99.52
COG5077 1089 Ubiquitin carboxyl-terminal hydrolase [Posttransla 99.45
KOG1873|consensus877 99.44
KOG0944|consensus763 99.38
KOG1864|consensus587 99.29
COG5207749 UBP14 Isopeptidase T [Posttranslational modificati 99.27
KOG1872|consensus473 99.27
KOG1871|consensus420 98.76
KOG1863|consensus 1093 98.74
PF13423295 UCH_1: Ubiquitin carboxyl-terminal hydrolase 98.59
KOG1275|consensus 1118 97.63
KOG2026|consensus442 96.92
PF05408193 Peptidase_C28: Foot-and-mouth virus L-proteinase; 93.69
PF15499275 Peptidase_C98: Ubiquitin-specific peptidase-like, 93.59
PF0147319 CW_binding_1: Putative cell wall binding repeat; I 89.57
>cd02667 Peptidase_C19K A subfamily of Peptidase C19 Back     alignment and domain information
Probab=99.82  E-value=9.5e-21  Score=122.70  Aligned_cols=53  Identities=32%  Similarity=0.541  Sum_probs=49.3

Q ss_pred             CEEEeeecCCCCeEEEEEECCC---------------------CCcEEEEcCceEEEcCCCcCCCCCeEEEEEE
Q psy7177           1 MCVRPSKGVSAGHYTAYTLHPN---------------------TKEWHYFNDETVLEQRPQDEDFNNAYILFYK   53 (66)
Q Consensus         1 avv~H~G~~~~GHY~a~~~~~~---------------------~~~W~~fdD~~V~~~~~~~~~~~~aYiLfY~   53 (66)
                      |||+|.|+.++|||+||+|...                     +++|++|||+.|++++.+++.+.+||||||+
T Consensus       206 ~vi~H~G~~~~GHY~a~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~W~~~dD~~V~~v~~~~v~~~~aYiLfYe  279 (279)
T cd02667         206 GVVEHSGTMRSGHYVAYVKVRPPQQRLSDLTKSKPAADEAGPGSGQWYYISDSDVREVSLEEVLKSEAYLLFYE  279 (279)
T ss_pred             EEEEEeCCCCCCEeEEEEEcCccccccccccccccccccCCCCCCcEEEEECCccEECCHHHhccCCcEEEEeC
Confidence            7999999779999999999854                     6899999999999999999999999999995



Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.

>cd02673 Peptidase_C19Q A subfamily of Peptidase C19 Back     alignment and domain information
>cd02664 Peptidase_C19H A subfamily of Peptidase C19 Back     alignment and domain information
>cd02662 Peptidase_C19F A subfamily of Peptidase C19 Back     alignment and domain information
>cd02659 peptidase_C19C A subfamily of Peptidase C19 Back     alignment and domain information
>cd02658 Peptidase_C19B A subfamily of Peptidase C19 Back     alignment and domain information
>cd02663 Peptidase_C19G A subfamily of Peptidase C19 Back     alignment and domain information
>cd02657 Peptidase_C19A A subfamily of Peptidase C19 Back     alignment and domain information
>KOG1865|consensus Back     alignment and domain information
>cd02665 Peptidase_C19I A subfamily of Peptidase C19 Back     alignment and domain information
>PF00443 UCH: Ubiquitin carboxyl-terminal hydrolase; InterPro: IPR001394 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd02668 Peptidase_C19L A subfamily of Peptidase C19 Back     alignment and domain information
>cd02670 Peptidase_C19N A subfamily of Peptidase C19 Back     alignment and domain information
>COG5560 UBP12 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02669 Peptidase_C19M A subfamily of Peptidase C19 Back     alignment and domain information
>cd02674 Peptidase_C19R A subfamily of peptidase C19 Back     alignment and domain information
>cd02660 Peptidase_C19D A subfamily of Peptidase C19 Back     alignment and domain information
>cd02661 Peptidase_C19E A subfamily of Peptidase C19 Back     alignment and domain information
>KOG1868|consensus Back     alignment and domain information
>cd02257 Peptidase_C19 Peptidase C19 contains ubiquitinyl hydrolases Back     alignment and domain information
>cd02671 Peptidase_C19O A subfamily of Peptidase C19 Back     alignment and domain information
>KOG1870|consensus Back     alignment and domain information
>cd02672 Peptidase_C19P A subfamily of Peptidase C19 Back     alignment and domain information
>KOG1867|consensus Back     alignment and domain information
>cd02666 Peptidase_C19J A subfamily of Peptidase C19 Back     alignment and domain information
>COG5533 UBP5 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4598|consensus Back     alignment and domain information
>KOG1866|consensus Back     alignment and domain information
>COG5077 Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1873|consensus Back     alignment and domain information
>KOG0944|consensus Back     alignment and domain information
>KOG1864|consensus Back     alignment and domain information
>COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1872|consensus Back     alignment and domain information
>KOG1871|consensus Back     alignment and domain information
>KOG1863|consensus Back     alignment and domain information
>PF13423 UCH_1: Ubiquitin carboxyl-terminal hydrolase Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>KOG2026|consensus Back     alignment and domain information
>PF05408 Peptidase_C28: Foot-and-mouth virus L-proteinase; InterPro: IPR008739 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF15499 Peptidase_C98: Ubiquitin-specific peptidase-like, SUMO isopeptidase Back     alignment and domain information
>PF01473 CW_binding_1: Putative cell wall binding repeat; InterPro: IPR018337 The cell wall-binding repeat (CW) is an about 20 amino acid residue module, essentially found in two bacterial Gram-positive protein families; the choline binding proteins and glucosyltransferases (2 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query66
2ibi_A374 Covalent Ubiquitin-Usp2 Complex Length = 374 4e-06
3v6c_A367 Crystal Structure Of Usp2 In Complex With Mutated U 4e-06
2hd5_A359 Usp2 In Complex With Ubiquitin Length = 359 5e-06
3nhe_A348 High Resolution Structure (1.26a) Of Usp2a In Compl 5e-06
2y6e_A367 Ubiquitin Specific Protease 4 Is Inhibited By Its U 2e-04
>pdb|2IBI|A Chain A, Covalent Ubiquitin-Usp2 Complex Length = 374 Back     alignment and structure

Iteration: 1

Score = 46.6 bits (109), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 20/43 (46%), Positives = 25/43 (58%) Query: 11 AGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYK 53 GHYTAY P T EWH FND +V ++AY+LFY+ Sbjct: 324 GGHYTAYCRSPGTGEWHTFNDSSVTPMSSSQVRTSDAYLLFYE 366
>pdb|3V6C|A Chain A, Crystal Structure Of Usp2 In Complex With Mutated Ubiquitin Length = 367 Back     alignment and structure
>pdb|2HD5|A Chain A, Usp2 In Complex With Ubiquitin Length = 359 Back     alignment and structure
>pdb|3NHE|A Chain A, High Resolution Structure (1.26a) Of Usp2a In Complex With Ubiquitin Length = 348 Back     alignment and structure
>pdb|2Y6E|A Chain A, Ubiquitin Specific Protease 4 Is Inhibited By Its Ubiquitin- Like Domain Length = 367 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query66
3nhe_A348 Ubiquitin carboxyl-terminal hydrolase 2; cysteine 8e-13
2y6e_A367 Ubiquitin carboxyl-terminal hydrolase 4; HET: CME; 1e-12
2gfo_A396 Ubiquitin carboxyl-terminal hydrolase 8; protease, 2e-11
3i3t_A355 Ubiquitin carboxyl-terminal hydrolase 21; hydrolas 5e-11
2ayn_A404 Ubiquitin carboxyl-terminal hydrolase 14; deubiqui 2e-10
3mhs_A476 Ubiquitin carboxyl-terminal hydrolase 8; multi-pro 5e-10
3ihp_A854 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 2e-09
1nb8_A353 Ubiquitin carboxyl-terminal hydrolase 7; UBP, deub 6e-08
2f1z_A522 Ubiquitin carboxyl-terminal hydrolase 7; hausp, US 1e-07
1vjv_A415 Ubiquitin carboxyl-terminal hydrolase 6; YFR010W, 9e-07
>3nhe_A Ubiquitin carboxyl-terminal hydrolase 2; cysteine protease, substrate ENZY complex, hydrolase-protein binding complex; HET: CME; 1.26A {Homo sapiens} PDB: 2hd5_A 2ibi_A Length = 348 Back     alignment and structure
 Score = 59.8 bits (145), Expect = 8e-13
 Identities = 21/52 (40%), Positives = 26/52 (50%)

Query: 8   GVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYKKRDEDS 59
               GHYTAY   P T EWH FND +V          ++AY+LFY+     S
Sbjct: 295 TTMGGHYTAYCRSPGTGEWHTFNDSSVTPMSSSQVRTSDAYLLFYELASPPS 346


>2y6e_A Ubiquitin carboxyl-terminal hydrolase 4; HET: CME; 2.40A {Homo sapiens} Length = 367 Back     alignment and structure
>2gfo_A Ubiquitin carboxyl-terminal hydrolase 8; protease, thiol protease, UBL conjugation pathway deubiquitinating enzyme, DUB, zinc ribbon; 2.00A {Homo sapiens} SCOP: d.3.1.9 PDB: 3n3k_A Length = 396 Back     alignment and structure
>3i3t_A Ubiquitin carboxyl-terminal hydrolase 21; hydrolase, structural genomics consortium, SGC, activator, alternative splicing, chromatin regulator, nucleus, polymorphism, protease; 2.59A {Homo sapiens} PDB: 2y5b_A 3mtn_A Length = 355 Back     alignment and structure
>2ayn_A Ubiquitin carboxyl-terminal hydrolase 14; deubiquitinating enzymes, DUB, USP14, proteasome, enzyme mechanism; 3.20A {Homo sapiens} SCOP: d.3.1.9 PDB: 2ayo_A Length = 404 Back     alignment and structure
>3mhs_A Ubiquitin carboxyl-terminal hydrolase 8; multi-protein complex, hydrolase-transcription regulator-Pro binding complex, acetylation, cytoplasm; 1.89A {Saccharomyces cerevisiae} PDB: 3mhh_A 3m99_A Length = 476 Back     alignment and structure
>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Length = 854 Back     alignment and structure
>1nb8_A Ubiquitin carboxyl-terminal hydrolase 7; UBP, deubiquitination, hausp, P53 binding; 2.30A {Homo sapiens} SCOP: d.3.1.9 PDB: 1nbf_A Length = 353 Back     alignment and structure
>2f1z_A Ubiquitin carboxyl-terminal hydrolase 7; hausp, USP7, UBP, deubiquitinating enzyme, substrate recognition; 3.20A {Homo sapiens} Length = 522 Back     alignment and structure
>1vjv_A Ubiquitin carboxyl-terminal hydrolase 6; YFR010W, structural genomics, JCSG, PSI, protein structure initiative; HET: MSE; 1.74A {Saccharomyces cerevisiae} SCOP: d.3.1.9 Length = 415 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query66
3nhe_A348 Ubiquitin carboxyl-terminal hydrolase 2; cysteine 99.89
2y6e_A367 Ubiquitin carboxyl-terminal hydrolase 4; HET: CME; 99.89
2gfo_A396 Ubiquitin carboxyl-terminal hydrolase 8; protease, 99.85
3i3t_A355 Ubiquitin carboxyl-terminal hydrolase 21; hydrolas 99.85
1vjv_A415 Ubiquitin carboxyl-terminal hydrolase 6; YFR010W, 99.84
1nb8_A353 Ubiquitin carboxyl-terminal hydrolase 7; UBP, deub 99.83
3mhs_A476 Ubiquitin carboxyl-terminal hydrolase 8; multi-pro 99.83
2ayn_A404 Ubiquitin carboxyl-terminal hydrolase 14; deubiqui 99.83
2f1z_A522 Ubiquitin carboxyl-terminal hydrolase 7; hausp, US 99.81
3ihp_A854 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 99.73
2vhf_A374 Ubiquitin carboxyl-terminal hydrolase CYLD; cytoki 98.14
3mp2_A211 Non-structural protein 3; papain-like protease, TG 85.95
1qmy_A167 Protease, leader protease; hydrolase, sulfhydryl p 82.65
>3nhe_A Ubiquitin carboxyl-terminal hydrolase 2; cysteine protease, substrate ENZY complex, hydrolase-protein binding complex; HET: CME; 1.26A {Homo sapiens} SCOP: d.3.1.9 PDB: 2hd5_A 3v6c_A 3v6e_A 2ibi_A Back     alignment and structure
Probab=99.89  E-value=2.3e-23  Score=134.55  Aligned_cols=60  Identities=37%  Similarity=0.597  Sum_probs=53.8

Q ss_pred             CEEEeeecCCCCeEEEEEECCCCCcEEEEcCceEEEcCCCcCCCCCeEEEEEEEcCCCCC
Q psy7177           1 MCVRPSKGVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYKKRDEDSD   60 (66)
Q Consensus         1 avv~H~G~~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~~~~~~aYiLfY~r~~~~~~   60 (66)
                      |||+|.|++.+|||+||+|...+++|++|||+.|++++.+++.+.+||||||+|++..++
T Consensus       288 avv~H~G~~~~GHY~~~~~~~~~~~W~~~nD~~V~~v~~~~v~~~~aY~LfY~r~~~~~~  347 (348)
T 3nhe_A          288 AVSNHSGTTMGGHYTAYCRSPGTGEWHTFNDSSVTPMSSSQVRTSDAYLLFYELASPPSR  347 (348)
T ss_dssp             EEEEEEECSSCEEEEEEEECTTTCCEEEEETTEEEEECGGGTCCTTEEEEEEEECC----
T ss_pred             EEEEccCCCCCcccEEEEccCCCCcEEEEeCCCceECCHHHcCCCCceEEEEEecCCCCC
Confidence            699999999999999999997788999999999999999999999999999999986553



>2y6e_A Ubiquitin carboxyl-terminal hydrolase 4; HET: CME; 2.40A {Homo sapiens} Back     alignment and structure
>2gfo_A Ubiquitin carboxyl-terminal hydrolase 8; protease, thiol protease, UBL conjugation pathway deubiquitinating enzyme, DUB, zinc ribbon; 2.00A {Homo sapiens} SCOP: d.3.1.9 PDB: 3n3k_A Back     alignment and structure
>3i3t_A Ubiquitin carboxyl-terminal hydrolase 21; hydrolase, structural genomics consortium, SGC, activator, alternative splicing, chromatin regulator, nucleus, polymorphism, protease; 2.59A {Homo sapiens} SCOP: d.3.1.0 PDB: 2y5b_A 3mtn_A Back     alignment and structure
>1vjv_A Ubiquitin carboxyl-terminal hydrolase 6; YFR010W, structural genomics, JCSG, PSI, protein structure initiative; HET: MSE; 1.74A {Saccharomyces cerevisiae} SCOP: d.3.1.9 Back     alignment and structure
>1nb8_A Ubiquitin carboxyl-terminal hydrolase 7; UBP, deubiquitination, hausp, P53 binding; 2.30A {Homo sapiens} SCOP: d.3.1.9 PDB: 1nbf_A Back     alignment and structure
>3mhs_A Ubiquitin carboxyl-terminal hydrolase 8; multi-protein complex, hydrolase-transcription regulator-Pro binding complex, acetylation, cytoplasm; 1.89A {Saccharomyces cerevisiae} PDB: 3mhh_A 4fjc_A 4fk5_A 4fip_A 3m99_A Back     alignment and structure
>2ayn_A Ubiquitin carboxyl-terminal hydrolase 14; deubiquitinating enzymes, DUB, USP14, proteasome, enzyme mechanism; 3.20A {Homo sapiens} SCOP: d.3.1.9 PDB: 2ayo_A Back     alignment and structure
>2f1z_A Ubiquitin carboxyl-terminal hydrolase 7; hausp, USP7, UBP, deubiquitinating enzyme, substrate recognition; 3.20A {Homo sapiens} Back     alignment and structure
>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Back     alignment and structure
>2vhf_A Ubiquitin carboxyl-terminal hydrolase CYLD; cytokine signalling, linkage specificity, deubiquitinating enzyme, Lys63- linked, anti-oncogene; 2.8A {Homo sapiens} Back     alignment and structure
>3mp2_A Non-structural protein 3; papain-like protease, TGEV, hydrolase; 2.50A {Porcine transmissible gastroenteritiscoronavirus} Back     alignment and structure
>1qmy_A Protease, leader protease; hydrolase, sulfhydryl proteinase, picornaviral proteinase; 1.9A {Aphthovirus O} SCOP: d.3.1.2 PDB: 1qol_A 2jqf_R 2jqg_R Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 66
d2gfoa1348 d.3.1.9 (A:762-1109) Ubiquitin carboxyl-terminal h 2e-11
d2hd5a1336 d.3.1.9 (A:211-521) Ubiquitin carboxyl-terminal hy 3e-11
d2ayna1383 d.3.1.9 (A:100-482) Ubiquitin carboxyl-terminal hy 9e-10
d1vjva_397 d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 2e-09
d1nbfa_347 d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 3e-08
>d2gfoa1 d.3.1.9 (A:762-1109) Ubiquitin carboxyl-terminal hydrolase 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Cysteine proteinases
superfamily: Cysteine proteinases
family: Ubiquitin carboxyl-terminal hydrolase, UCH
domain: Ubiquitin carboxyl-terminal hydrolase 8
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 55.1 bits (131), Expect = 2e-11
 Identities = 17/47 (36%), Positives = 23/47 (48%)

Query: 8   GVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYKK 54
           G+  GHYTAY  +   + W  F+D  V +        + AYILFY  
Sbjct: 301 GLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFYTS 347


>d2hd5a1 d.3.1.9 (A:211-521) Ubiquitin carboxyl-terminal hydrolase 2, USP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 336 Back     information, alignment and structure
>d2ayna1 d.3.1.9 (A:100-482) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d1vjva_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 397 Back     information, alignment and structure
>d1nbfa_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) {Human (Homo sapiens) [TaxId: 9606]} Length = 347 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query66
d2hd5a1336 Ubiquitin carboxyl-terminal hydrolase 2, USP2 {Hum 99.89
d2gfoa1348 Ubiquitin carboxyl-terminal hydrolase 8 {Human (Ho 99.88
d1vjva_397 Ubiquitin carboxyl-terminal hydrolase 6 {Baker's y 99.88
d1nbfa_347 Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAU 99.85
d2ayna1383 Ubiquitin carboxyl-terminal hydrolase 14 {Human (H 99.84
d1v8ha1106 Sulfur oxidation protein SoxZ {Thermus thermophilu 83.87
d1qmya_156 FMDV leader protease {Foot-and-mouth disease virus 82.32
>d2hd5a1 d.3.1.9 (A:211-521) Ubiquitin carboxyl-terminal hydrolase 2, USP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Cysteine proteinases
superfamily: Cysteine proteinases
family: Ubiquitin carboxyl-terminal hydrolase, UCH
domain: Ubiquitin carboxyl-terminal hydrolase 2, USP2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.89  E-value=1.6e-23  Score=131.08  Aligned_cols=54  Identities=39%  Similarity=0.660  Sum_probs=52.0

Q ss_pred             CEEEeeecCCCCeEEEEEECCCCCcEEEEcCceEEEcCCCcCCCCCeEEEEEEE
Q psy7177           1 MCVRPSKGVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYKK   54 (66)
Q Consensus         1 avv~H~G~~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~~~~~~aYiLfY~r   54 (66)
                      |||+|.|++++|||++|+|+..+++|++|||++|++++.+++.+++||||||+|
T Consensus       282 ~vi~H~G~~~~GHY~~~ik~~~~~~W~~~nD~~V~~v~~~~v~~~~aYiL~Y~r  335 (336)
T d2hd5a1         282 AVSNHSGTTMGGHYTAYCRSPGTGEWHTFNDSSVTPMSSSQVRTSDAYLLFYEL  335 (336)
T ss_dssp             EEEEEEECSSCEEEEEEEECTTTCCEEEEETTEEEEECGGGSCCTTEEEEEEEE
T ss_pred             EEEEEeCCCCCceEEEEEEcCCCCeEEEEECCceeECCHHHhccCCCEEEEEEc
Confidence            699999999999999999998788999999999999999999999999999998



>d2gfoa1 d.3.1.9 (A:762-1109) Ubiquitin carboxyl-terminal hydrolase 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjva_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nbfa_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ayna1 d.3.1.9 (A:100-482) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v8ha1 b.1.18.19 (A:2-107) Sulfur oxidation protein SoxZ {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qmya_ d.3.1.2 (A:) FMDV leader protease {Foot-and-mouth disease virus [TaxId: 12110]} Back     information, alignment and structure