Psyllid ID: psy7177
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 66 | ||||||
| 321475567 | 1180 | hypothetical protein DAPPUDRAFT_307840 [ | 0.712 | 0.039 | 0.659 | 7e-13 | |
| 242007158 | 845 | predicted protein [Pediculus humanus cor | 0.818 | 0.063 | 0.592 | 2e-12 | |
| 307183092 | 1048 | Ubiquitin carboxyl-terminal hydrolase 32 | 0.818 | 0.051 | 0.611 | 5e-12 | |
| 332024377 | 1053 | Ubiquitin carboxyl-terminal hydrolase 32 | 0.818 | 0.051 | 0.611 | 6e-12 | |
| 307213501 | 1054 | Ubiquitin carboxyl-terminal hydrolase 32 | 0.818 | 0.051 | 0.611 | 6e-12 | |
| 383858846 | 1050 | PREDICTED: uncharacterized protein LOC10 | 0.818 | 0.051 | 0.611 | 7e-12 | |
| 345487479 | 1022 | PREDICTED: LOW QUALITY PROTEIN: ubiquiti | 0.818 | 0.052 | 0.592 | 1e-11 | |
| 350396230 | 1052 | PREDICTED: ubiquitin carboxyl-terminal h | 0.818 | 0.051 | 0.592 | 2e-11 | |
| 328715747 | 898 | PREDICTED: ubiquitin carboxyl-terminal h | 0.893 | 0.065 | 0.516 | 1e-10 | |
| 260807898 | 1291 | hypothetical protein BRAFLDRAFT_95861 [B | 0.818 | 0.041 | 0.481 | 2e-09 |
| >gi|321475567|gb|EFX86529.1| hypothetical protein DAPPUDRAFT_307840 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
Score = 77.8 bits (190), Expect = 7e-13, Method: Compositional matrix adjust.
Identities = 31/47 (65%), Positives = 41/47 (87%)
Query: 9 VSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYKKR 55
S+GHYTAYT H N+K+WHY+NDETVL + PQDEDF++ Y+LFY++R
Sbjct: 1117 ASSGHYTAYTRHVNSKDWHYYNDETVLSRAPQDEDFSHGYVLFYQRR 1163
|
Source: Daphnia pulex Species: Daphnia pulex Genus: Daphnia Family: Daphniidae Order: Diplostraca Class: Branchiopoda Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|242007158|ref|XP_002424409.1| predicted protein [Pediculus humanus corporis] gi|212507809|gb|EEB11671.1| predicted protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|307183092|gb|EFN70009.1| Ubiquitin carboxyl-terminal hydrolase 32 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|332024377|gb|EGI64575.1| Ubiquitin carboxyl-terminal hydrolase 32 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307213501|gb|EFN88910.1| Ubiquitin carboxyl-terminal hydrolase 32 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|383858846|ref|XP_003704910.1| PREDICTED: uncharacterized protein LOC100877443 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|345487479|ref|XP_001600155.2| PREDICTED: LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 43-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|350396230|ref|XP_003484486.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 43-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|328715747|ref|XP_001949023.2| PREDICTED: ubiquitin carboxyl-terminal hydrolase 4-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|260807898|ref|XP_002598745.1| hypothetical protein BRAFLDRAFT_95861 [Branchiostoma floridae] gi|229284019|gb|EEN54757.1| hypothetical protein BRAFLDRAFT_95861 [Branchiostoma floridae] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 66 | ||||||
| UNIPROTKB|F1NUS3 | 447 | F1NUS3 "Uncharacterized protei | 0.636 | 0.093 | 0.452 | 4.3e-07 | |
| SGD|S000003733 | 1254 | UBP12 "Ubiquitin-specific prot | 0.803 | 0.042 | 0.396 | 2.8e-06 | |
| UNIPROTKB|F1S200 | 389 | LOC100737416 "Uncharacterized | 0.742 | 0.125 | 0.4 | 4.3e-06 | |
| UNIPROTKB|E9PPM2 | 362 | USP2 "Ubiquitin carboxyl-termi | 0.636 | 0.116 | 0.476 | 8.1e-06 | |
| CGD|CAL0000531 | 1372 | orf19.6260 [Candida albicans ( | 0.727 | 0.034 | 0.448 | 8.4e-06 | |
| UNIPROTKB|F1NUS4 | 161 | F1NUS4 "Uncharacterized protei | 0.636 | 0.260 | 0.452 | 9e-06 | |
| UNIPROTKB|I3LJX6 | 137 | LOC100624494 "Uncharacterized | 0.727 | 0.350 | 0.464 | 1.1e-05 | |
| UNIPROTKB|O75604 | 605 | USP2 "Ubiquitin carboxyl-termi | 0.636 | 0.069 | 0.476 | 1.7e-05 | |
| MGI|MGI:2152450 | 520 | Usp3 "ubiquitin specific pepti | 0.878 | 0.111 | 0.4 | 1.8e-05 | |
| UNIPROTKB|P35125 | 1406 | USP6 "Ubiquitin carboxyl-termi | 0.742 | 0.034 | 0.42 | 2.3e-05 |
| UNIPROTKB|F1NUS3 F1NUS3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 103 (41.3 bits), Expect = 4.3e-07, Sum P(2) = 4.3e-07
Identities = 19/42 (45%), Positives = 24/42 (57%)
Query: 12 GHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYK 53
GHYTAY P + EWH FND V ++AY+LFY+
Sbjct: 398 GHYTAYCKSPISSEWHSFNDSRVTPMSSSHVRSSDAYLLFYE 439
|
|
| SGD|S000003733 UBP12 "Ubiquitin-specific protease" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S200 LOC100737416 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PPM2 USP2 "Ubiquitin carboxyl-terminal hydrolase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0000531 orf19.6260 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NUS4 F1NUS4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LJX6 LOC100624494 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O75604 USP2 "Ubiquitin carboxyl-terminal hydrolase 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2152450 Usp3 "ubiquitin specific peptidase 3" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P35125 USP6 "Ubiquitin carboxyl-terminal hydrolase 6" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 66 | |||
| cd02674 | 230 | cd02674, Peptidase_C19R, A subfamily of peptidase | 2e-15 | |
| cd02257 | 255 | cd02257, Peptidase_C19, Peptidase C19 contains ubi | 8e-11 | |
| pfam00443 | 313 | pfam00443, UCH, Ubiquitin carboxyl-terminal hydrol | 2e-09 | |
| COG5560 | 823 | COG5560, UBP12, Ubiquitin C-terminal hydrolase [Po | 9e-09 | |
| cd02668 | 324 | cd02668, Peptidase_C19L, A subfamily of Peptidase | 1e-05 | |
| cd02657 | 305 | cd02657, Peptidase_C19A, A subfamily of Peptidase | 2e-05 | |
| cd02661 | 304 | cd02661, Peptidase_C19E, A subfamily of Peptidase | 2e-04 | |
| cd02658 | 311 | cd02658, Peptidase_C19B, A subfamily of Peptidase | 2e-04 | |
| cd02659 | 334 | cd02659, peptidase_C19C, A subfamily of Peptidase | 4e-04 | |
| COG5207 | 749 | COG5207, UBP14, Isopeptidase T [Posttranslational | 0.003 |
| >gnl|CDD|239139 cd02674, Peptidase_C19R, A subfamily of peptidase C19 | Back alignment and domain information |
|---|
Score = 66.9 bits (164), Expect = 2e-15
Identities = 17/46 (36%), Positives = 27/46 (58%)
Query: 8 GVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYK 53
++ GHYTAY + T +W+ F+D V + ++AYILFY+
Sbjct: 185 SLNGGHYTAYCKNNETNDWYKFDDSRVTKVSESSVVSSSAYILFYE 230
|
Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome. Length = 230 |
| >gnl|CDD|239072 cd02257, Peptidase_C19, Peptidase C19 contains ubiquitinyl hydrolases | Back alignment and domain information |
|---|
| >gnl|CDD|215922 pfam00443, UCH, Ubiquitin carboxyl-terminal hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|227847 COG5560, UBP12, Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|239133 cd02668, Peptidase_C19L, A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >gnl|CDD|239122 cd02657, Peptidase_C19A, A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >gnl|CDD|239126 cd02661, Peptidase_C19E, A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >gnl|CDD|239123 cd02658, Peptidase_C19B, A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >gnl|CDD|239124 cd02659, peptidase_C19C, A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >gnl|CDD|227532 COG5207, UBP14, Isopeptidase T [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 66 | |||
| cd02667 | 279 | Peptidase_C19K A subfamily of Peptidase C19. Pepti | 99.82 | |
| cd02673 | 245 | Peptidase_C19Q A subfamily of Peptidase C19. Pepti | 99.82 | |
| cd02664 | 327 | Peptidase_C19H A subfamily of Peptidase C19. Pepti | 99.82 | |
| cd02662 | 240 | Peptidase_C19F A subfamily of Peptidase C19. Pepti | 99.82 | |
| cd02659 | 334 | peptidase_C19C A subfamily of Peptidase C19. Pepti | 99.81 | |
| cd02658 | 311 | Peptidase_C19B A subfamily of Peptidase C19. Pepti | 99.81 | |
| cd02663 | 300 | Peptidase_C19G A subfamily of Peptidase C19. Pepti | 99.81 | |
| cd02657 | 305 | Peptidase_C19A A subfamily of Peptidase C19. Pepti | 99.81 | |
| KOG1865|consensus | 545 | 99.8 | ||
| cd02665 | 228 | Peptidase_C19I A subfamily of Peptidase C19. Pepti | 99.79 | |
| PF00443 | 269 | UCH: Ubiquitin carboxyl-terminal hydrolase; InterP | 99.79 | |
| cd02668 | 324 | Peptidase_C19L A subfamily of Peptidase C19. Pepti | 99.78 | |
| cd02670 | 241 | Peptidase_C19N A subfamily of Peptidase C19. Pepti | 99.78 | |
| COG5560 | 823 | UBP12 Ubiquitin C-terminal hydrolase [Posttranslat | 99.78 | |
| cd02669 | 440 | Peptidase_C19M A subfamily of Peptidase C19. Pepti | 99.78 | |
| cd02674 | 230 | Peptidase_C19R A subfamily of peptidase C19. Pepti | 99.77 | |
| cd02660 | 328 | Peptidase_C19D A subfamily of Peptidase C19. Pepti | 99.77 | |
| cd02661 | 304 | Peptidase_C19E A subfamily of Peptidase C19. Pepti | 99.76 | |
| KOG1868|consensus | 653 | 99.74 | ||
| cd02257 | 255 | Peptidase_C19 Peptidase C19 contains ubiquitinyl h | 99.74 | |
| cd02671 | 332 | Peptidase_C19O A subfamily of Peptidase C19. Pepti | 99.7 | |
| KOG1870|consensus | 842 | 99.7 | ||
| cd02672 | 268 | Peptidase_C19P A subfamily of Peptidase C19. Pepti | 99.68 | |
| KOG1867|consensus | 492 | 99.68 | ||
| cd02666 | 343 | Peptidase_C19J A subfamily of Peptidase C19. Pepti | 99.62 | |
| COG5533 | 415 | UBP5 Ubiquitin C-terminal hydrolase [Posttranslati | 99.6 | |
| KOG4598|consensus | 1203 | 99.53 | ||
| KOG1866|consensus | 944 | 99.52 | ||
| COG5077 | 1089 | Ubiquitin carboxyl-terminal hydrolase [Posttransla | 99.45 | |
| KOG1873|consensus | 877 | 99.44 | ||
| KOG0944|consensus | 763 | 99.38 | ||
| KOG1864|consensus | 587 | 99.29 | ||
| COG5207 | 749 | UBP14 Isopeptidase T [Posttranslational modificati | 99.27 | |
| KOG1872|consensus | 473 | 99.27 | ||
| KOG1871|consensus | 420 | 98.76 | ||
| KOG1863|consensus | 1093 | 98.74 | ||
| PF13423 | 295 | UCH_1: Ubiquitin carboxyl-terminal hydrolase | 98.59 | |
| KOG1275|consensus | 1118 | 97.63 | ||
| KOG2026|consensus | 442 | 96.92 | ||
| PF05408 | 193 | Peptidase_C28: Foot-and-mouth virus L-proteinase; | 93.69 | |
| PF15499 | 275 | Peptidase_C98: Ubiquitin-specific peptidase-like, | 93.59 | |
| PF01473 | 19 | CW_binding_1: Putative cell wall binding repeat; I | 89.57 |
| >cd02667 Peptidase_C19K A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
Probab=99.82 E-value=9.5e-21 Score=122.70 Aligned_cols=53 Identities=32% Similarity=0.541 Sum_probs=49.3
Q ss_pred CEEEeeecCCCCeEEEEEECCC---------------------CCcEEEEcCceEEEcCCCcCCCCCeEEEEEE
Q psy7177 1 MCVRPSKGVSAGHYTAYTLHPN---------------------TKEWHYFNDETVLEQRPQDEDFNNAYILFYK 53 (66)
Q Consensus 1 avv~H~G~~~~GHY~a~~~~~~---------------------~~~W~~fdD~~V~~~~~~~~~~~~aYiLfY~ 53 (66)
|||+|.|+.++|||+||+|... +++|++|||+.|++++.+++.+.+||||||+
T Consensus 206 ~vi~H~G~~~~GHY~a~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~W~~~dD~~V~~v~~~~v~~~~aYiLfYe 279 (279)
T cd02667 206 GVVEHSGTMRSGHYVAYVKVRPPQQRLSDLTKSKPAADEAGPGSGQWYYISDSDVREVSLEEVLKSEAYLLFYE 279 (279)
T ss_pred EEEEEeCCCCCCEeEEEEEcCccccccccccccccccccCCCCCCcEEEEECCccEECCHHHhccCCcEEEEeC
Confidence 7999999779999999999854 6899999999999999999999999999995
|
Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome. |
| >cd02673 Peptidase_C19Q A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02664 Peptidase_C19H A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02662 Peptidase_C19F A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02659 peptidase_C19C A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02658 Peptidase_C19B A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02663 Peptidase_C19G A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02657 Peptidase_C19A A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >KOG1865|consensus | Back alignment and domain information |
|---|
| >cd02665 Peptidase_C19I A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >PF00443 UCH: Ubiquitin carboxyl-terminal hydrolase; InterPro: IPR001394 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >cd02668 Peptidase_C19L A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02670 Peptidase_C19N A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >COG5560 UBP12 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02669 Peptidase_C19M A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02674 Peptidase_C19R A subfamily of peptidase C19 | Back alignment and domain information |
|---|
| >cd02660 Peptidase_C19D A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02661 Peptidase_C19E A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >KOG1868|consensus | Back alignment and domain information |
|---|
| >cd02257 Peptidase_C19 Peptidase C19 contains ubiquitinyl hydrolases | Back alignment and domain information |
|---|
| >cd02671 Peptidase_C19O A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >KOG1870|consensus | Back alignment and domain information |
|---|
| >cd02672 Peptidase_C19P A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >KOG1867|consensus | Back alignment and domain information |
|---|
| >cd02666 Peptidase_C19J A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >COG5533 UBP5 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4598|consensus | Back alignment and domain information |
|---|
| >KOG1866|consensus | Back alignment and domain information |
|---|
| >COG5077 Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1873|consensus | Back alignment and domain information |
|---|
| >KOG0944|consensus | Back alignment and domain information |
|---|
| >KOG1864|consensus | Back alignment and domain information |
|---|
| >COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1872|consensus | Back alignment and domain information |
|---|
| >KOG1871|consensus | Back alignment and domain information |
|---|
| >KOG1863|consensus | Back alignment and domain information |
|---|
| >PF13423 UCH_1: Ubiquitin carboxyl-terminal hydrolase | Back alignment and domain information |
|---|
| >KOG1275|consensus | Back alignment and domain information |
|---|
| >KOG2026|consensus | Back alignment and domain information |
|---|
| >PF05408 Peptidase_C28: Foot-and-mouth virus L-proteinase; InterPro: IPR008739 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF15499 Peptidase_C98: Ubiquitin-specific peptidase-like, SUMO isopeptidase | Back alignment and domain information |
|---|
| >PF01473 CW_binding_1: Putative cell wall binding repeat; InterPro: IPR018337 The cell wall-binding repeat (CW) is an about 20 amino acid residue module, essentially found in two bacterial Gram-positive protein families; the choline binding proteins and glucosyltransferases (2 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 66 | ||||
| 2ibi_A | 374 | Covalent Ubiquitin-Usp2 Complex Length = 374 | 4e-06 | ||
| 3v6c_A | 367 | Crystal Structure Of Usp2 In Complex With Mutated U | 4e-06 | ||
| 2hd5_A | 359 | Usp2 In Complex With Ubiquitin Length = 359 | 5e-06 | ||
| 3nhe_A | 348 | High Resolution Structure (1.26a) Of Usp2a In Compl | 5e-06 | ||
| 2y6e_A | 367 | Ubiquitin Specific Protease 4 Is Inhibited By Its U | 2e-04 |
| >pdb|2IBI|A Chain A, Covalent Ubiquitin-Usp2 Complex Length = 374 | Back alignment and structure |
|
| >pdb|3V6C|A Chain A, Crystal Structure Of Usp2 In Complex With Mutated Ubiquitin Length = 367 | Back alignment and structure |
| >pdb|2HD5|A Chain A, Usp2 In Complex With Ubiquitin Length = 359 | Back alignment and structure |
| >pdb|3NHE|A Chain A, High Resolution Structure (1.26a) Of Usp2a In Complex With Ubiquitin Length = 348 | Back alignment and structure |
| >pdb|2Y6E|A Chain A, Ubiquitin Specific Protease 4 Is Inhibited By Its Ubiquitin- Like Domain Length = 367 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 66 | |||
| 3nhe_A | 348 | Ubiquitin carboxyl-terminal hydrolase 2; cysteine | 8e-13 | |
| 2y6e_A | 367 | Ubiquitin carboxyl-terminal hydrolase 4; HET: CME; | 1e-12 | |
| 2gfo_A | 396 | Ubiquitin carboxyl-terminal hydrolase 8; protease, | 2e-11 | |
| 3i3t_A | 355 | Ubiquitin carboxyl-terminal hydrolase 21; hydrolas | 5e-11 | |
| 2ayn_A | 404 | Ubiquitin carboxyl-terminal hydrolase 14; deubiqui | 2e-10 | |
| 3mhs_A | 476 | Ubiquitin carboxyl-terminal hydrolase 8; multi-pro | 5e-10 | |
| 3ihp_A | 854 | Ubiquitin carboxyl-terminal hydrolase 5; hydrolase | 2e-09 | |
| 1nb8_A | 353 | Ubiquitin carboxyl-terminal hydrolase 7; UBP, deub | 6e-08 | |
| 2f1z_A | 522 | Ubiquitin carboxyl-terminal hydrolase 7; hausp, US | 1e-07 | |
| 1vjv_A | 415 | Ubiquitin carboxyl-terminal hydrolase 6; YFR010W, | 9e-07 |
| >3nhe_A Ubiquitin carboxyl-terminal hydrolase 2; cysteine protease, substrate ENZY complex, hydrolase-protein binding complex; HET: CME; 1.26A {Homo sapiens} PDB: 2hd5_A 2ibi_A Length = 348 | Back alignment and structure |
|---|
Score = 59.8 bits (145), Expect = 8e-13
Identities = 21/52 (40%), Positives = 26/52 (50%)
Query: 8 GVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYKKRDEDS 59
GHYTAY P T EWH FND +V ++AY+LFY+ S
Sbjct: 295 TTMGGHYTAYCRSPGTGEWHTFNDSSVTPMSSSQVRTSDAYLLFYELASPPS 346
|
| >2y6e_A Ubiquitin carboxyl-terminal hydrolase 4; HET: CME; 2.40A {Homo sapiens} Length = 367 | Back alignment and structure |
|---|
| >2gfo_A Ubiquitin carboxyl-terminal hydrolase 8; protease, thiol protease, UBL conjugation pathway deubiquitinating enzyme, DUB, zinc ribbon; 2.00A {Homo sapiens} SCOP: d.3.1.9 PDB: 3n3k_A Length = 396 | Back alignment and structure |
|---|
| >3i3t_A Ubiquitin carboxyl-terminal hydrolase 21; hydrolase, structural genomics consortium, SGC, activator, alternative splicing, chromatin regulator, nucleus, polymorphism, protease; 2.59A {Homo sapiens} PDB: 2y5b_A 3mtn_A Length = 355 | Back alignment and structure |
|---|
| >2ayn_A Ubiquitin carboxyl-terminal hydrolase 14; deubiquitinating enzymes, DUB, USP14, proteasome, enzyme mechanism; 3.20A {Homo sapiens} SCOP: d.3.1.9 PDB: 2ayo_A Length = 404 | Back alignment and structure |
|---|
| >3mhs_A Ubiquitin carboxyl-terminal hydrolase 8; multi-protein complex, hydrolase-transcription regulator-Pro binding complex, acetylation, cytoplasm; 1.89A {Saccharomyces cerevisiae} PDB: 3mhh_A 3m99_A Length = 476 | Back alignment and structure |
|---|
| >3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Length = 854 | Back alignment and structure |
|---|
| >1nb8_A Ubiquitin carboxyl-terminal hydrolase 7; UBP, deubiquitination, hausp, P53 binding; 2.30A {Homo sapiens} SCOP: d.3.1.9 PDB: 1nbf_A Length = 353 | Back alignment and structure |
|---|
| >2f1z_A Ubiquitin carboxyl-terminal hydrolase 7; hausp, USP7, UBP, deubiquitinating enzyme, substrate recognition; 3.20A {Homo sapiens} Length = 522 | Back alignment and structure |
|---|
| >1vjv_A Ubiquitin carboxyl-terminal hydrolase 6; YFR010W, structural genomics, JCSG, PSI, protein structure initiative; HET: MSE; 1.74A {Saccharomyces cerevisiae} SCOP: d.3.1.9 Length = 415 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 66 | |||
| 3nhe_A | 348 | Ubiquitin carboxyl-terminal hydrolase 2; cysteine | 99.89 | |
| 2y6e_A | 367 | Ubiquitin carboxyl-terminal hydrolase 4; HET: CME; | 99.89 | |
| 2gfo_A | 396 | Ubiquitin carboxyl-terminal hydrolase 8; protease, | 99.85 | |
| 3i3t_A | 355 | Ubiquitin carboxyl-terminal hydrolase 21; hydrolas | 99.85 | |
| 1vjv_A | 415 | Ubiquitin carboxyl-terminal hydrolase 6; YFR010W, | 99.84 | |
| 1nb8_A | 353 | Ubiquitin carboxyl-terminal hydrolase 7; UBP, deub | 99.83 | |
| 3mhs_A | 476 | Ubiquitin carboxyl-terminal hydrolase 8; multi-pro | 99.83 | |
| 2ayn_A | 404 | Ubiquitin carboxyl-terminal hydrolase 14; deubiqui | 99.83 | |
| 2f1z_A | 522 | Ubiquitin carboxyl-terminal hydrolase 7; hausp, US | 99.81 | |
| 3ihp_A | 854 | Ubiquitin carboxyl-terminal hydrolase 5; hydrolase | 99.73 | |
| 2vhf_A | 374 | Ubiquitin carboxyl-terminal hydrolase CYLD; cytoki | 98.14 | |
| 3mp2_A | 211 | Non-structural protein 3; papain-like protease, TG | 85.95 | |
| 1qmy_A | 167 | Protease, leader protease; hydrolase, sulfhydryl p | 82.65 |
| >3nhe_A Ubiquitin carboxyl-terminal hydrolase 2; cysteine protease, substrate ENZY complex, hydrolase-protein binding complex; HET: CME; 1.26A {Homo sapiens} SCOP: d.3.1.9 PDB: 2hd5_A 3v6c_A 3v6e_A 2ibi_A | Back alignment and structure |
|---|
Probab=99.89 E-value=2.3e-23 Score=134.55 Aligned_cols=60 Identities=37% Similarity=0.597 Sum_probs=53.8
Q ss_pred CEEEeeecCCCCeEEEEEECCCCCcEEEEcCceEEEcCCCcCCCCCeEEEEEEEcCCCCC
Q psy7177 1 MCVRPSKGVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYKKRDEDSD 60 (66)
Q Consensus 1 avv~H~G~~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~~~~~~aYiLfY~r~~~~~~ 60 (66)
|||+|.|++.+|||+||+|...+++|++|||+.|++++.+++.+.+||||||+|++..++
T Consensus 288 avv~H~G~~~~GHY~~~~~~~~~~~W~~~nD~~V~~v~~~~v~~~~aY~LfY~r~~~~~~ 347 (348)
T 3nhe_A 288 AVSNHSGTTMGGHYTAYCRSPGTGEWHTFNDSSVTPMSSSQVRTSDAYLLFYELASPPSR 347 (348)
T ss_dssp EEEEEEECSSCEEEEEEEECTTTCCEEEEETTEEEEECGGGTCCTTEEEEEEEECC----
T ss_pred EEEEccCCCCCcccEEEEccCCCCcEEEEeCCCceECCHHHcCCCCceEEEEEecCCCCC
Confidence 699999999999999999997788999999999999999999999999999999986553
|
| >2y6e_A Ubiquitin carboxyl-terminal hydrolase 4; HET: CME; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2gfo_A Ubiquitin carboxyl-terminal hydrolase 8; protease, thiol protease, UBL conjugation pathway deubiquitinating enzyme, DUB, zinc ribbon; 2.00A {Homo sapiens} SCOP: d.3.1.9 PDB: 3n3k_A | Back alignment and structure |
|---|
| >3i3t_A Ubiquitin carboxyl-terminal hydrolase 21; hydrolase, structural genomics consortium, SGC, activator, alternative splicing, chromatin regulator, nucleus, polymorphism, protease; 2.59A {Homo sapiens} SCOP: d.3.1.0 PDB: 2y5b_A 3mtn_A | Back alignment and structure |
|---|
| >1vjv_A Ubiquitin carboxyl-terminal hydrolase 6; YFR010W, structural genomics, JCSG, PSI, protein structure initiative; HET: MSE; 1.74A {Saccharomyces cerevisiae} SCOP: d.3.1.9 | Back alignment and structure |
|---|
| >1nb8_A Ubiquitin carboxyl-terminal hydrolase 7; UBP, deubiquitination, hausp, P53 binding; 2.30A {Homo sapiens} SCOP: d.3.1.9 PDB: 1nbf_A | Back alignment and structure |
|---|
| >3mhs_A Ubiquitin carboxyl-terminal hydrolase 8; multi-protein complex, hydrolase-transcription regulator-Pro binding complex, acetylation, cytoplasm; 1.89A {Saccharomyces cerevisiae} PDB: 3mhh_A 4fjc_A 4fk5_A 4fip_A 3m99_A | Back alignment and structure |
|---|
| >2ayn_A Ubiquitin carboxyl-terminal hydrolase 14; deubiquitinating enzymes, DUB, USP14, proteasome, enzyme mechanism; 3.20A {Homo sapiens} SCOP: d.3.1.9 PDB: 2ayo_A | Back alignment and structure |
|---|
| >2f1z_A Ubiquitin carboxyl-terminal hydrolase 7; hausp, USP7, UBP, deubiquitinating enzyme, substrate recognition; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2vhf_A Ubiquitin carboxyl-terminal hydrolase CYLD; cytokine signalling, linkage specificity, deubiquitinating enzyme, Lys63- linked, anti-oncogene; 2.8A {Homo sapiens} | Back alignment and structure |
|---|
| >3mp2_A Non-structural protein 3; papain-like protease, TGEV, hydrolase; 2.50A {Porcine transmissible gastroenteritiscoronavirus} | Back alignment and structure |
|---|
| >1qmy_A Protease, leader protease; hydrolase, sulfhydryl proteinase, picornaviral proteinase; 1.9A {Aphthovirus O} SCOP: d.3.1.2 PDB: 1qol_A 2jqf_R 2jqg_R | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 66 | ||||
| d2gfoa1 | 348 | d.3.1.9 (A:762-1109) Ubiquitin carboxyl-terminal h | 2e-11 | |
| d2hd5a1 | 336 | d.3.1.9 (A:211-521) Ubiquitin carboxyl-terminal hy | 3e-11 | |
| d2ayna1 | 383 | d.3.1.9 (A:100-482) Ubiquitin carboxyl-terminal hy | 9e-10 | |
| d1vjva_ | 397 | d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase | 2e-09 | |
| d1nbfa_ | 347 | d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase | 3e-08 |
| >d2gfoa1 d.3.1.9 (A:762-1109) Ubiquitin carboxyl-terminal hydrolase 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Ubiquitin carboxyl-terminal hydrolase, UCH domain: Ubiquitin carboxyl-terminal hydrolase 8 species: Human (Homo sapiens) [TaxId: 9606]
Score = 55.1 bits (131), Expect = 2e-11
Identities = 17/47 (36%), Positives = 23/47 (48%)
Query: 8 GVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYKK 54
G+ GHYTAY + + W F+D V + + AYILFY
Sbjct: 301 GLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFYTS 347
|
| >d2hd5a1 d.3.1.9 (A:211-521) Ubiquitin carboxyl-terminal hydrolase 2, USP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 336 | Back information, alignment and structure |
|---|
| >d2ayna1 d.3.1.9 (A:100-482) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]} Length = 383 | Back information, alignment and structure |
|---|
| >d1vjva_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 397 | Back information, alignment and structure |
|---|
| >d1nbfa_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) {Human (Homo sapiens) [TaxId: 9606]} Length = 347 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 66 | |||
| d2hd5a1 | 336 | Ubiquitin carboxyl-terminal hydrolase 2, USP2 {Hum | 99.89 | |
| d2gfoa1 | 348 | Ubiquitin carboxyl-terminal hydrolase 8 {Human (Ho | 99.88 | |
| d1vjva_ | 397 | Ubiquitin carboxyl-terminal hydrolase 6 {Baker's y | 99.88 | |
| d1nbfa_ | 347 | Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAU | 99.85 | |
| d2ayna1 | 383 | Ubiquitin carboxyl-terminal hydrolase 14 {Human (H | 99.84 | |
| d1v8ha1 | 106 | Sulfur oxidation protein SoxZ {Thermus thermophilu | 83.87 | |
| d1qmya_ | 156 | FMDV leader protease {Foot-and-mouth disease virus | 82.32 |
| >d2hd5a1 d.3.1.9 (A:211-521) Ubiquitin carboxyl-terminal hydrolase 2, USP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Ubiquitin carboxyl-terminal hydrolase, UCH domain: Ubiquitin carboxyl-terminal hydrolase 2, USP2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.89 E-value=1.6e-23 Score=131.08 Aligned_cols=54 Identities=39% Similarity=0.660 Sum_probs=52.0
Q ss_pred CEEEeeecCCCCeEEEEEECCCCCcEEEEcCceEEEcCCCcCCCCCeEEEEEEE
Q psy7177 1 MCVRPSKGVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYKK 54 (66)
Q Consensus 1 avv~H~G~~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~~~~~~aYiLfY~r 54 (66)
|||+|.|++++|||++|+|+..+++|++|||++|++++.+++.+++||||||+|
T Consensus 282 ~vi~H~G~~~~GHY~~~ik~~~~~~W~~~nD~~V~~v~~~~v~~~~aYiL~Y~r 335 (336)
T d2hd5a1 282 AVSNHSGTTMGGHYTAYCRSPGTGEWHTFNDSSVTPMSSSQVRTSDAYLLFYEL 335 (336)
T ss_dssp EEEEEEECSSCEEEEEEEECTTTCCEEEEETTEEEEECGGGSCCTTEEEEEEEE
T ss_pred EEEEEeCCCCCceEEEEEEcCCCCeEEEEECCceeECCHHHhccCCCEEEEEEc
Confidence 699999999999999999998788999999999999999999999999999998
|
| >d2gfoa1 d.3.1.9 (A:762-1109) Ubiquitin carboxyl-terminal hydrolase 8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vjva_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nbfa_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ayna1 d.3.1.9 (A:100-482) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v8ha1 b.1.18.19 (A:2-107) Sulfur oxidation protein SoxZ {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1qmya_ d.3.1.2 (A:) FMDV leader protease {Foot-and-mouth disease virus [TaxId: 12110]} | Back information, alignment and structure |
|---|