Psyllid ID: psy7272
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 275 | 2.2.26 [Sep-21-2011] | |||||||
| Q17BU3 | 1644 | Kinesin-like protein unc- | N/A | N/A | 0.872 | 0.145 | 0.428 | 3e-44 | |
| Q7PHR1 | 1644 | Kinesin-like protein unc- | yes | N/A | 0.869 | 0.145 | 0.425 | 7e-44 | |
| Q28WQ1 | 1671 | Kinesin-like protein unc- | yes | N/A | 0.861 | 0.141 | 0.423 | 3e-43 | |
| A1ZAJ2 | 1670 | Kinesin-like protein unc- | yes | N/A | 0.912 | 0.150 | 0.397 | 8e-41 | |
| O60333 | 1816 | Kinesin-like protein KIF1 | no | N/A | 0.436 | 0.066 | 0.562 | 2e-36 | |
| O88658 | 1816 | Kinesin-like protein KIF1 | yes | N/A | 0.436 | 0.066 | 0.554 | 6e-36 | |
| Q60575 | 1816 | Kinesin-like protein KIF1 | no | N/A | 0.436 | 0.066 | 0.554 | 6e-36 | |
| P33173 | 1695 | Kinesin-like protein KIF1 | no | N/A | 0.436 | 0.070 | 0.546 | 2e-34 | |
| Q12756 | 1690 | Kinesin-like protein KIF1 | no | N/A | 0.436 | 0.071 | 0.546 | 2e-34 | |
| O43896 | 1103 | Kinesin-like protein KIF1 | no | N/A | 0.385 | 0.096 | 0.550 | 3e-33 |
| >sp|Q17BU3|KIF1A_AEDAE Kinesin-like protein unc-104 OS=Aedes aegypti GN=unc-104 PE=3 SV=1 | Back alignment and function desciption |
|---|
Score = 178 bits (452), Expect = 3e-44, Method: Compositional matrix adjust.
Identities = 116/271 (42%), Positives = 165/271 (60%), Gaps = 31/271 (11%)
Query: 9 IQTVAPASVIAEEAVDQLQASEK-----LIAELNETWEEKLKR--TEEIRIQREAVFAEM 61
I ++PA + +E + L+ +++ A +NE KL R EEI+ RE + AE
Sbjct: 325 IAAISPADINYDETLSTLRYADRAKQIVCKAVVNEDANAKLIRELKEEIQKLRELLKAE- 383
Query: 62 GVAVKEDGN----TVGVFSP---QKAVDDMTDLTTEKV--SKISLVDLAGSERADSTGAK 112
G+ V+E GN T + SP +K T++ +++ S+ + +L + +
Sbjct: 384 GIEVQE-GNRRTPTPMICSPNRLRKRTGSSTEMAVDQLQASEKLIAELNETWEEKLKRTE 442
Query: 113 GTRLKE-------GANINKSLTTLGKVISALAEITPHLVNLNEDPFMSECLIYYIKDGRT 165
RL+ G + + T+G V S + +PHLVNLNEDP +SECL+YYIKDG T
Sbjct: 443 QIRLQREAVFAEMGVAVKEDGITVG-VFSP--KKSPHLVNLNEDPTLSECLLYYIKDGLT 499
Query: 166 KVGSAESNLPQESQDIQLSGSHIKTEHCTFENVEGVVTLIPFQEALCYVNGRQISEPTVL 225
++G++E+N+PQ DIQLSGSHI EHC FEN +GVVTL+P ++AL Y+NGR++ EP VL
Sbjct: 500 RLGTSEANVPQ---DIQLSGSHILKEHCVFENKDGVVTLVPHKDALVYLNGRKLVEPEVL 556
Query: 226 NTGSRVILGKNHVFRFNHPDQVRVHRENKKN 256
TGSRVILGKNHVFRF HP+Q R RE K+
Sbjct: 557 QTGSRVILGKNHVFRFTHPEQAREKREKPKD 587
|
Required for presynaptic maturation, has a role in axonal transport of dense-core vesicles carrying synaptic vesicle precursors, components required for the morphological transformation of axonal growth cones to mature boutons. Aedes aegypti (taxid: 7159) |
| >sp|Q7PHR1|KIF1A_ANOGA Kinesin-like protein unc-104 OS=Anopheles gambiae GN=unc-104 PE=3 SV=3 | Back alignment and function description |
|---|
| >sp|Q28WQ1|KIF1A_DROPS Kinesin-like protein unc-104 OS=Drosophila pseudoobscura pseudoobscura GN=unc-104 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|A1ZAJ2|KIF1A_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster GN=unc-104 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|O60333|KIF1B_HUMAN Kinesin-like protein KIF1B OS=Homo sapiens GN=KIF1B PE=1 SV=5 | Back alignment and function description |
|---|
| >sp|O88658|KIF1B_RAT Kinesin-like protein KIF1B OS=Rattus norvegicus GN=Kif1b PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q60575|KIF1B_MOUSE Kinesin-like protein KIF1B OS=Mus musculus GN=Kif1b PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|P33173|KIF1A_MOUSE Kinesin-like protein KIF1A OS=Mus musculus GN=Kif1a PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q12756|KIF1A_HUMAN Kinesin-like protein KIF1A OS=Homo sapiens GN=KIF1A PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|O43896|KIF1C_HUMAN Kinesin-like protein KIF1C OS=Homo sapiens GN=KIF1C PE=1 SV=3 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 275 | ||||||
| 339252290 | 1771 | putative kinesin motor domain protein [T | 0.68 | 0.105 | 0.487 | 4e-54 | |
| 410979829 | 994 | PREDICTED: kinesin-like protein KIF1C [F | 0.618 | 0.171 | 0.453 | 1e-48 | |
| 386768134 | 1675 | unc-104, isoform F [Drosophila melanogas | 0.669 | 0.109 | 0.492 | 1e-48 | |
| 195584022 | 1753 | GD25516 [Drosophila simulans] gi|1941938 | 0.669 | 0.104 | 0.492 | 1e-48 | |
| 386768136 | 1681 | unc-104, isoform G [Drosophila melanogas | 0.669 | 0.109 | 0.492 | 2e-48 | |
| 194882429 | 1753 | GG22243 [Drosophila erecta] gi|190658500 | 0.669 | 0.104 | 0.492 | 2e-48 | |
| 161077170 | 1684 | unc-104, isoform E [Drosophila melanogas | 0.669 | 0.109 | 0.492 | 2e-48 | |
| 194756724 | 1750 | GF13447 [Drosophila ananassae] gi|190621 | 0.669 | 0.105 | 0.480 | 3e-47 | |
| 328715398 | 1716 | PREDICTED: kinesin-like protein unc-104- | 0.923 | 0.148 | 0.421 | 5e-47 | |
| 195380495 | 1767 | GJ21351 [Drosophila virilis] gi|19414380 | 0.618 | 0.096 | 0.497 | 5e-47 |
| >gi|339252290|ref|XP_003371368.1| putative kinesin motor domain protein [Trichinella spiralis] gi|316968407|gb|EFV52687.1| putative kinesin motor domain protein [Trichinella spiralis] | Back alignment and taxonomy information |
|---|
Score = 217 bits (553), Expect = 4e-54, Method: Compositional matrix adjust.
Identities = 115/236 (48%), Positives = 149/236 (63%), Gaps = 49/236 (20%)
Query: 16 SVIAEEAVDQLQASEKLIAELNETWEEKLKRTEEIRIQREAVFAEMGVAVKEDGNTVGVF 75
S + E+ +D+L+ASEKLIAELNETWEEKL+RTE IR REA EMG+A +EDG T+GVF
Sbjct: 408 SAMEEDTIDRLKASEKLIAELNETWEEKLRRTEAIRASREAELKEMGLATREDGQTLGVF 467
Query: 76 SPQKAVDDMTDLTTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISA 135
P+ V +IS+ KS+ +
Sbjct: 468 QPKT------------VPRISI--------------------------KSVHSFC----- 484
Query: 136 LAEITPHLVNLNEDPFMSECLIYYIKDGRTKVGSAESNLPQESQDIQLSGSHIKTEHCTF 195
I PHLVNLNEDP +SECL+YY+K+G TKVG A++ + QDIQLSG I+TEHC F
Sbjct: 485 ---IVPHLVNLNEDPLISECLLYYLKEGTTKVGRADAPV---RQDIQLSGQWIQTEHCEF 538
Query: 196 ENVEGVVTLIPFQEALCYVNGRQISEPTVLNTGSRVILGKNHVFRFNHPDQVRVHR 251
EN GVV L+P A+C+VNG+ ++EPTVL++G+RVILGK HVFRFN+P ++ R
Sbjct: 539 ENKCGVVALVPQDTAMCFVNGKTVNEPTVLHSGNRVILGKYHVFRFNNPQELMQSR 594
|
Source: Trichinella spiralis Species: Trichinella spiralis Genus: Trichinella Family: Trichinellidae Order: Trichocephalida Class: Enoplea Phylum: Nematoda Superkingdom: Eukaryota |
| >gi|410979829|ref|XP_003996283.1| PREDICTED: kinesin-like protein KIF1C [Felis catus] | Back alignment and taxonomy information |
|---|
| >gi|386768134|ref|NP_001246373.1| unc-104, isoform F [Drosophila melanogaster] gi|383302532|gb|AFH08126.1| unc-104, isoform F [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195584022|ref|XP_002081815.1| GD25516 [Drosophila simulans] gi|194193824|gb|EDX07400.1| GD25516 [Drosophila simulans] | Back alignment and taxonomy information |
|---|
| >gi|386768136|ref|NP_001246374.1| unc-104, isoform G [Drosophila melanogaster] gi|383302533|gb|AFH08127.1| unc-104, isoform G [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|194882429|ref|XP_001975313.1| GG22243 [Drosophila erecta] gi|190658500|gb|EDV55713.1| GG22243 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|161077170|ref|NP_001097346.1| unc-104, isoform E [Drosophila melanogaster] gi|157400372|gb|ABV53825.1| unc-104, isoform E [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|194756724|ref|XP_001960625.1| GF13447 [Drosophila ananassae] gi|190621923|gb|EDV37447.1| GF13447 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
| >gi|328715398|ref|XP_003245618.1| PREDICTED: kinesin-like protein unc-104-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|195380495|ref|XP_002049006.1| GJ21351 [Drosophila virilis] gi|194143803|gb|EDW60199.1| GJ21351 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 275 | ||||||
| UNIPROTKB|Q17BU3 | 1644 | unc-104 "Kinesin-like protein | 0.865 | 0.144 | 0.425 | 6e-41 | |
| UNIPROTKB|Q7PHR1 | 1644 | unc-104 "Kinesin-like protein | 0.865 | 0.144 | 0.421 | 6e-41 | |
| UNIPROTKB|Q28WQ1 | 1671 | unc-104 "Kinesin-like protein | 0.858 | 0.141 | 0.415 | 9.2e-40 | |
| FB|FBgn0034155 | 1670 | unc-104 "unc-104 ortholog" [Dr | 0.854 | 0.140 | 0.411 | 3.6e-38 | |
| UNIPROTKB|D4A984 | 688 | Kif1b "Kinesin-like protein KI | 0.578 | 0.231 | 0.446 | 3.1e-32 | |
| UNIPROTKB|O60333 | 1816 | KIF1B "Kinesin-like protein KI | 0.578 | 0.087 | 0.452 | 6.1e-32 | |
| UNIPROTKB|E1C889 | 1770 | KIF1B "Uncharacterized protein | 0.578 | 0.089 | 0.452 | 9.7e-32 | |
| UNIPROTKB|F1RIF9 | 1811 | KIF1B "Uncharacterized protein | 0.578 | 0.087 | 0.452 | 1e-31 | |
| UNIPROTKB|E1BBN7 | 1818 | Bt.102812 "Uncharacterized pro | 0.578 | 0.087 | 0.452 | 1e-31 | |
| UNIPROTKB|F1M7T7 | 1150 | Kif1b "Kinesin-like protein KI | 0.578 | 0.138 | 0.446 | 1e-31 |
| UNIPROTKB|Q17BU3 unc-104 "Kinesin-like protein unc-104" [Aedes aegypti (taxid:7159)] | Back alignment and assigned GO terms |
|---|
Score = 449 (163.1 bits), Expect = 6.0e-41, P = 6.0e-41
Identities = 112/263 (42%), Positives = 164/263 (62%)
Query: 9 IQTVAPASVIAEEAVDQLQASEK---LI--AELNETWEEKLKRT--EEIRIQREAVFAEM 61
I ++PA + +E + L+ +++ ++ A +NE KL R EEI+ RE + AE
Sbjct: 325 IAAISPADINYDETLSTLRYADRAKQIVCKAVVNEDANAKLIRELKEEIQKLRELLKAE- 383
Query: 62 GVAVKEDGN----TVGVFSP---QKAVDDMTDLTTEKV--SKISLVDLAGSERADSTGAK 112
G+ V+E GN T + SP +K T++ +++ S+ + +L + +
Sbjct: 384 GIEVQE-GNRRTPTPMICSPNRLRKRTGSSTEMAVDQLQASEKLIAELNETWEEKLKRTE 442
Query: 113 GTRL-KEG--ANINKSLTTLGKVISALA-EITPHLVNLNEDPFMSECLIYYIKDGRTKVG 168
RL +E A + ++ G + + + +PHLVNLNEDP +SECL+YYIKDG T++G
Sbjct: 443 QIRLQREAVFAEMGVAVKEDGITVGVFSPKKSPHLVNLNEDPTLSECLLYYIKDGLTRLG 502
Query: 169 SAESNLPQESQDIQLSGSHIKTEHCTFENVEGVVTLIPFQEALCYVNGRQISEPTVLNTG 228
++E+N+PQ DIQLSGSHI EHC FEN +GVVTL+P ++AL Y+NGR++ EP VL TG
Sbjct: 503 TSEANVPQ---DIQLSGSHILKEHCVFENKDGVVTLVPHKDALVYLNGRKLVEPEVLQTG 559
Query: 229 SRVILGKNHVFRFNHPDQVRVHR 251
SRVILGKNHVFRF HP+Q R R
Sbjct: 560 SRVILGKNHVFRFTHPEQAREKR 582
|
|
| UNIPROTKB|Q7PHR1 unc-104 "Kinesin-like protein unc-104" [Anopheles gambiae (taxid:7165)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q28WQ1 unc-104 "Kinesin-like protein unc-104" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0034155 unc-104 "unc-104 ortholog" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4A984 Kif1b "Kinesin-like protein KIF1B" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O60333 KIF1B "Kinesin-like protein KIF1B" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C889 KIF1B "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RIF9 KIF1B "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BBN7 Bt.102812 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1M7T7 Kif1b "Kinesin-like protein KIF1B" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| O88658 | KIF1B_RAT | No assigned EC number | 0.5546 | 0.4363 | 0.0660 | yes | N/A |
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 275 | |||
| cd01365 | 356 | cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K | 4e-30 | |
| smart00129 | 335 | smart00129, KISc, Kinesin motor, catalytic domain | 9e-22 | |
| cd00106 | 328 | cd00106, KISc, Kinesin motor domain | 2e-20 | |
| cd01363 | 186 | cd01363, Motor_domain, Myosin and Kinesin motor do | 3e-20 | |
| pfam00225 | 326 | pfam00225, Kinesin, Kinesin motor domain | 3e-20 | |
| cd01366 | 329 | cd01366, KISc_C_terminal, Kinesin motor domain, KI | 3e-19 | |
| cd01370 | 338 | cd01370, KISc_KIP3_like, Kinesin motor domain, KIP | 7e-17 | |
| cd01374 | 321 | cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E | 2e-16 | |
| cd01369 | 325 | cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine | 4e-16 | |
| cd01371 | 333 | cd01371, KISc_KIF3, Kinesin motor domain, kinesins | 5e-16 | |
| cd01373 | 337 | cd01373, KISc_KLP2_like, Kinesin motor domain, KLP | 3e-15 | |
| cd01372 | 341 | cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik | 4e-15 | |
| cd01364 | 352 | cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC | 7e-15 | |
| cd01368 | 345 | cd01368, KISc_KIF23_like, Kinesin motor domain, KI | 2e-14 | |
| PLN03188 | 1320 | PLN03188, PLN03188, kinesin-12 family protein; Pro | 2e-13 | |
| cd00060 | 102 | cd00060, FHA, Forkhead associated domain (FHA); fo | 4e-12 | |
| cd01367 | 322 | cd01367, KISc_KIF2_like, Kinesin motor domain, KIF | 5e-12 | |
| COG5059 | 568 | COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | 1e-11 | |
| cd01375 | 334 | cd01375, KISc_KIF9_like, Kinesin motor domain, KIF | 1e-10 | |
| cd01376 | 319 | cd01376, KISc_KID_like, Kinesin motor domain, KIF2 | 2e-09 | |
| pfam00498 | 67 | pfam00498, FHA, FHA domain | 5e-06 | |
| smart00240 | 52 | smart00240, FHA, Forkhead associated domain | 0.003 |
| >gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
Score = 115 bits (290), Expect = 4e-30
Identities = 52/61 (85%), Positives = 56/61 (91%)
Query: 78 QKAVDDMTDLTTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALA 137
QK +D TDLTTEKVSKISLVDLAGSERA STGA+G RLKEG+NINKSLTTLGKVISALA
Sbjct: 226 QKKLDKETDLTTEKVSKISLVDLAGSERASSTGAEGDRLKEGSNINKSLTTLGKVISALA 285
Query: 138 E 138
+
Sbjct: 286 D 286
|
KIF1A (Unc104) transports synaptic vesicles to the nerve terminal, KIF1B has been implicated in transport of mitochondria. Both proteins are expressed in neurons. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. In contrast to the majority of dimeric kinesins, most KIF1A/Unc104 kinesins are monomeric motors. A lysine-rich loop in KIF1A binds to the negatively charged C-terminus of tubulin and compensates for the lack of a second motor domain, allowing KIF1A to move processively. Length = 356 |
| >gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|238054 cd00106, KISc, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238017 cd00060, FHA, Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|215951 pfam00498, FHA, FHA domain | Back alignment and domain information |
|---|
| >gnl|CDD|214578 smart00240, FHA, Forkhead associated domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 275 | |||
| KOG0245|consensus | 1221 | 100.0 | ||
| KOG0241|consensus | 1714 | 100.0 | ||
| KOG4280|consensus | 574 | 99.97 | ||
| KOG0243|consensus | 1041 | 99.96 | ||
| KOG0240|consensus | 607 | 99.95 | ||
| PLN03188 | 1320 | kinesin-12 family protein; Provisional | 99.94 | |
| KOG0242|consensus | 675 | 99.94 | ||
| cd01373 | 337 | KISc_KLP2_like Kinesin motor domain, KLP2-like sub | 99.93 | |
| cd01368 | 345 | KISc_KIF23_like Kinesin motor domain, KIF23-like s | 99.93 | |
| cd01370 | 338 | KISc_KIP3_like Kinesin motor domain, KIP3-like sub | 99.93 | |
| KOG0247|consensus | 809 | 99.92 | ||
| KOG0239|consensus | 670 | 99.92 | ||
| cd01364 | 352 | KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind | 99.91 | |
| cd01376 | 319 | KISc_KID_like Kinesin motor domain, KIF22/Kid-like | 99.9 | |
| cd01365 | 356 | KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p | 99.9 | |
| cd01363 | 186 | Motor_domain Myosin and Kinesin motor domain. Thes | 99.9 | |
| cd01371 | 333 | KISc_KIF3 Kinesin motor domain, kinesins II or KIF | 99.89 | |
| cd01369 | 325 | KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy | 99.89 | |
| cd01367 | 322 | KISc_KIF2_like Kinesin motor domain, KIF2-like gro | 99.89 | |
| KOG0246|consensus | 676 | 99.89 | ||
| cd01375 | 334 | KISc_KIF9_like Kinesin motor domain, KIF9-like sub | 99.89 | |
| cd01372 | 341 | KISc_KIF4 Kinesin motor domain, KIF4-like subfamil | 99.89 | |
| cd01366 | 329 | KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ | 99.89 | |
| cd01374 | 321 | KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like | 99.88 | |
| KOG0244|consensus | 913 | 99.88 | ||
| smart00129 | 335 | KISc Kinesin motor, catalytic domain. ATPase. Micr | 99.84 | |
| cd00106 | 328 | KISc Kinesin motor domain. This catalytic (head) d | 99.84 | |
| PF00225 | 335 | Kinesin: Kinesin motor domain; InterPro: IPR001752 | 99.83 | |
| COG5059 | 568 | KIP1 Kinesin-like protein [Cytoskeleton] | 99.81 | |
| PF00498 | 68 | FHA: FHA domain; InterPro: IPR000253 The forkhead- | 99.34 | |
| KOG1892|consensus | 1629 | 99.26 | ||
| cd00060 | 102 | FHA Forkhead associated domain (FHA); found in euk | 99.09 | |
| TIGR03354 | 396 | VI_FHA type VI secretion system FHA domain protein | 98.99 | |
| COG1716 | 191 | FOG: FHA domain [Signal transduction mechanisms] | 98.75 | |
| COG3456 | 430 | Predicted component of the type VI protein secreti | 98.75 | |
| smart00240 | 52 | FHA Forkhead associated domain. Found in eukaryoti | 98.45 | |
| PLN02927 | 668 | antheraxanthin epoxidase/zeaxanthin epoxidase | 98.43 | |
| KOG0241|consensus | 1714 | 98.22 | ||
| KOG0245|consensus | 1221 | 97.92 | ||
| KOG1882|consensus | 293 | 96.73 | ||
| TIGR02500 | 410 | type_III_yscD type III secretion apparatus protein | 95.55 | |
| KOG0615|consensus | 475 | 95.06 | ||
| KOG1881|consensus | 793 | 95.04 | ||
| COG5059 | 568 | KIP1 Kinesin-like protein [Cytoskeleton] | 94.98 | |
| PRK01777 | 95 | hypothetical protein; Validated | 94.45 | |
| KOG2293|consensus | 547 | 91.46 | ||
| TIGR02988 | 59 | YaaA_near_RecF S4 domain protein YaaA. This small | 83.17 | |
| KOG1880|consensus | 337 | 80.3 | ||
| smart00363 | 60 | S4 S4 RNA-binding domain. | 80.07 |
| >KOG0245|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.6e-54 Score=425.66 Aligned_cols=251 Identities=51% Similarity=0.725 Sum_probs=232.1
Q ss_pred EEecCCcchHHHHHHHH------------------HHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHhhccccccCCcee
Q psy7272 11 TVAPASVIAEEAVDQLQ------------------ASEKLIAELNETWEEKLKRTEEIRIQREAVFAEMGVAVKEDGNTV 72 (275)
Q Consensus 11 ~~~~~~~~~~~~~~~L~------------------e~E~L~~el~~t~EE~L~~~e~~~~~r~~~~t~~~~~~~~ssrsh 72 (275)
.|..+|.|.|.+.|-|. .+|.|-+-...+|.+.-..++.+.++|.+|+|+||. .|||||
T Consensus 141 evSymEIYcErVrDLL~~p~~kg~LRVREHP~lGPYVedLS~~aV~Sy~dI~~~md~GNkqRTtAATnMNd---tSSRSH 217 (1221)
T KOG0245|consen 141 EVSYMEIYCERVRDLLNAPKSKGGLRVREHPILGPYVEDLSKLAVTSYADIQDLMDEGNKQRTTAATNMND---TSSRSH 217 (1221)
T ss_pred EEeehhHHHHHHHHHhhCCCCCCCceeeccCccChhHhHhhhcccccHHHHHHHHHhcchhhhhhhhcccc---ccccce
Confidence 56777888888888887 677888888888888888888888899999999994 499999
Q ss_pred eEEee---eeeeecCCCCcceeEeeeEEeeccCcccccccCccccccccccccccchhhHHHHHHHhhhccc--------
Q psy7272 73 GVFSP---QKAVDDMTDLTTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEITP-------- 141 (275)
Q Consensus 73 ~if~i---~~~~~~~~~~~~~~~s~l~lvDLAGSEr~~~~~~~~~~~~E~~~IN~SL~~Lg~vi~al~~~~~-------- 141 (275)
+|||| +..++...+...+++|||+|||||||||+..+|+.|+|++||++|||||.+||+||.|||+.+.
T Consensus 218 aVFtIvftQk~~~~~~~l~sek~SKIsLVDLAGSERasstGa~G~RLKEGa~INKSLtTLGkVISALAe~~~~k~~ks~f 297 (1221)
T KOG0245|consen 218 AVFTIVFTQKKHDQDTGLDSEKVSKISLVDLAGSERASSTGANGDRLKEGANINKSLTTLGKVISALAESQKGKKKKSDF 297 (1221)
T ss_pred eEEEEEEEeeeccccCCCcceeeeeeeEEeccCcccccccCCCccchhcccccchHHHHHHHHHHHHHHHhccCCCCCcc
Confidence 99998 5666777778899999999999999999999999999999999999999999999999997431
Q ss_pred --------------------------------------------------------------------------------
Q psy7272 142 -------------------------------------------------------------------------------- 141 (275)
Q Consensus 142 -------------------------------------------------------------------------------- 141 (275)
T Consensus 298 IPYRDSVLTWLLkEnLGGNSKTaMIAAlSPAdiNyeETLSTLRYAdRAK~Iv~~avVNEdpnaKLIRELreEv~rLksll 377 (1221)
T KOG0245|consen 298 IPYRDSVLTWLLKENLGGNSKTAMIAALSPADINYEETLSTLRYADRAKQIVNNAVVNEDPNAKLIRELREEVARLKSLL 377 (1221)
T ss_pred ccchHHHHHHHHHHhcCCcchhhhhhccChhhcChHHHHHHHHHhhHhhhhhccceeCCCccHHHHHHHHHHHHHHHHHH
Confidence
Q ss_pred ------------------------------------------------------------------------------CC
Q psy7272 142 ------------------------------------------------------------------------------HL 143 (275)
Q Consensus 142 ------------------------------------------------------------------------------~l 143 (275)
|+
T Consensus 378 ~~~~~~~~~~~~~p~~~~~~~~~e~~~~~L~E~Ek~mael~etW~EKl~~aEair~e~~~~L~emGva~~~D~~kk~phL 457 (1221)
T KOG0245|consen 378 RAQGLGDIAVEGSPSALLSQPEIEELRERLQETEKIMAELNETWEEKLREAEAIRMEREALLAEMGVAVREDGGKKTPHL 457 (1221)
T ss_pred hccccccccccCCcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHhcCceeeecCCccCcce
Confidence 99
Q ss_pred cCCCCCCCCcceeEEEeeccccccCCCCCCCCCCcceeeecCCcccccceEEEEeCCE--EEEEeCCCCceEECCeeecc
Q psy7272 144 VNLNEDPFMSECLIYYIKDGRTKVGSAESNLPQESQDIQLSGSHIKTEHCTFENVEGV--VTLIPFQEALCYVNGRQISE 221 (275)
Q Consensus 144 ~~l~~~P~r~s~Lt~~L~~~~t~IGr~~~~~~~~~~dI~L~~~~Is~~Hc~I~~~e~~--vtL~~~s~a~t~VNG~~I~~ 221 (275)
+|||+||..+.+|.|+|++|.+.||+.++... +||.|+|..|..+||.|.+.+|. |+|.|+.+|.|||||++|.+
T Consensus 458 VNLneDPllSe~LlY~ikeG~TrVG~~~a~~~---~DI~LsG~~I~~qHC~i~~~~g~~~vtl~p~e~aetyVNGk~v~e 534 (1221)
T KOG0245|consen 458 VNLNEDPLLSECLLYYIKEGETRVGREDASSR---QDIVLSGQLIREQHCSIRNEGGNDVVTLEPCEDAETYVNGKLVTE 534 (1221)
T ss_pred eccCCCchhhccEEEEeccCceecCCCCcccC---CceEecchhhhhhceEEEecCCCceEEeccCCccceeEccEEcCC
Confidence 99999999999999999999999999887666 99999999999999999999887 99999999999999999999
Q ss_pred ceecCCCCEEEeCCceEEEEeCCchhhhhhhccCCCCCCccCcccc
Q psy7272 222 PTVLNTGSRVILGKNHVFRFNHPDQVRVHRENKKNASDKSESKKDK 267 (275)
Q Consensus 222 ~~~L~~GDrI~lG~~~~f~f~~P~~a~~~r~~~~~~~~~~~~~~~~ 267 (275)
|++|++||||+||.+|+|||+||.++|..|++.+++++||||+.|.
T Consensus 535 p~qL~~GdRiilG~~H~frfn~P~~ar~~r~~~~~~~~~~~pvD~~ 580 (1221)
T KOG0245|consen 535 PTQLRSGDRIILGGNHVFRFNHPEQARQERERTPPAPTPPEPVDWK 580 (1221)
T ss_pred cceeccCCEEEEcCceeEEecCHHHHhhhcccCCCCCCCCCCccHH
Confidence 9999999999999999999999999999999999999999999885
|
|
| >KOG0241|consensus | Back alignment and domain information |
|---|
| >KOG4280|consensus | Back alignment and domain information |
|---|
| >KOG0243|consensus | Back alignment and domain information |
|---|
| >KOG0240|consensus | Back alignment and domain information |
|---|
| >PLN03188 kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >KOG0242|consensus | Back alignment and domain information |
|---|
| >cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >KOG0247|consensus | Back alignment and domain information |
|---|
| >KOG0239|consensus | Back alignment and domain information |
|---|
| >cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >cd01363 Motor_domain Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >KOG0246|consensus | Back alignment and domain information |
|---|
| >cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >KOG0244|consensus | Back alignment and domain information |
|---|
| >smart00129 KISc Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >cd00106 KISc Kinesin motor domain | Back alignment and domain information |
|---|
| >PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport | Back alignment and domain information |
|---|
| >COG5059 KIP1 Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF00498 FHA: FHA domain; InterPro: IPR000253 The forkhead-associated (FHA) domain [] is a phosphopeptide recognition domain found in many regulatory proteins | Back alignment and domain information |
|---|
| >KOG1892|consensus | Back alignment and domain information |
|---|
| >cd00060 FHA Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins | Back alignment and domain information |
|---|
| >TIGR03354 VI_FHA type VI secretion system FHA domain protein | Back alignment and domain information |
|---|
| >COG1716 FOG: FHA domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3456 Predicted component of the type VI protein secretion system, contains a FHA domain [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00240 FHA Forkhead associated domain | Back alignment and domain information |
|---|
| >PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase | Back alignment and domain information |
|---|
| >KOG0241|consensus | Back alignment and domain information |
|---|
| >KOG0245|consensus | Back alignment and domain information |
|---|
| >KOG1882|consensus | Back alignment and domain information |
|---|
| >TIGR02500 type_III_yscD type III secretion apparatus protein, YscD/HrpQ family | Back alignment and domain information |
|---|
| >KOG0615|consensus | Back alignment and domain information |
|---|
| >KOG1881|consensus | Back alignment and domain information |
|---|
| >COG5059 KIP1 Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK01777 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG2293|consensus | Back alignment and domain information |
|---|
| >TIGR02988 YaaA_near_RecF S4 domain protein YaaA | Back alignment and domain information |
|---|
| >KOG1880|consensus | Back alignment and domain information |
|---|
| >smart00363 S4 S4 RNA-binding domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 275 | ||||
| 2eh0_A | 130 | Solution Structure Of The Fha Domain From Human Kin | 1e-35 | ||
| 4egx_A | 184 | Crystal Structure Of Kif1a Cc1-Fha Tandem Length = | 8e-35 | ||
| 4ejq_A | 154 | Crystal Structure Of Kif1a C-Cc1-Fha Length = 154 | 2e-34 | ||
| 2g1l_A | 104 | Crystal Structure Of The Fha Domain Of Human Kinesi | 5e-29 | ||
| 1vfv_A | 366 | Crystal Structure Of The Kif1a Motor Domain Complex | 3e-23 | ||
| 1i6i_A | 366 | Crystal Structure Of The Kif1a Motor Domain Complex | 3e-23 | ||
| 1i5s_A | 367 | Crystal Structure Of The Kif1a Motor Domain Complex | 3e-23 | ||
| 1ia0_K | 394 | Kif1a Head-Microtubule Complex Structure In Atp-For | 3e-23 | ||
| 3fm8_A | 124 | Crystal Structure Of Full Length Centaurin Alpha-1 | 4e-17 | ||
| 3gbj_A | 354 | Crystal Structure Of The Motor Domain Of Kinesin Ki | 1e-15 | ||
| 2owm_A | 443 | Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3 | 2e-15 | ||
| 3lre_A | 355 | Crystal Structure Analysis Of Human Kinesin-8 Motor | 2e-12 | ||
| 1wln_A | 120 | Solution Structure Of The Fha Domain Of Mouse Afadi | 2e-11 | ||
| 2h58_A | 330 | Crystal Structure Of The Kifc3 Motor Domain In Comp | 2e-11 | ||
| 1t5c_A | 349 | Crystal Structure Of The Motor Domain Of Human Kine | 4e-11 | ||
| 4aqv_C | 373 | Model Of Human Kinesin-5 Motor Domain (3hqd) And Ma | 7e-11 | ||
| 1q0b_A | 367 | Crystal Structure Of The Motor Protein Ksp In Compl | 8e-11 | ||
| 4a28_A | 368 | Eg5-2 Length = 368 | 8e-11 | ||
| 1ii6_A | 368 | Crystal Structure Of The Mitotic Kinesin Eg5 In Com | 8e-11 | ||
| 4a1z_A | 368 | Eg5-1 Length = 368 | 8e-11 | ||
| 4ap0_A | 370 | The Mitotic Kinesin Eg5 In Complex With Mg-Adp And | 8e-11 | ||
| 3hqd_A | 369 | Human Kinesin Eg5 Motor Domain In Complex With Ampp | 8e-11 | ||
| 1x88_A | 359 | Human Eg5 Motor Domain Bound To Mg-Adp And Monastro | 9e-11 | ||
| 3zcw_A | 348 | Eg5 - New Allosteric Binding Site Length = 348 | 1e-10 | ||
| 1sdm_A | 369 | Crystal Structure Of Kinesin-Like Calmodulin Bindin | 5e-10 | ||
| 3h4s_A | 386 | Structure Of The Complex Of A Mitotic Kinesin With | 7e-10 | ||
| 4atx_C | 340 | Rigor Kinesin Motor Domain With An Ordered Neck-Lin | 1e-09 | ||
| 1mkj_A | 349 | Human Kinesin Motor Domain With Docked Neck Linker | 1e-09 | ||
| 1bg2_A | 325 | Human Ubiquitous Kinesin Motor Domain Length = 325 | 1e-09 | ||
| 2y5w_A | 365 | Crystal Structure Of Drosophila Melanogaster Kinesi | 2e-09 | ||
| 3b6u_A | 372 | Crystal Structure Of The Motor Domain Of Human Kine | 2e-09 | ||
| 2wbe_C | 373 | Kinesin-5-Tubulin Complex With Amppnp Length = 373 | 2e-09 | ||
| 2vvg_A | 350 | Crystal Structure Of The G.Intestinalis Kinesin 2 G | 6e-09 | ||
| 3t0q_A | 349 | Motor Domain Structure Of The Kar3-Like Kinesin Fro | 4e-08 | ||
| 4a14_A | 344 | Human Kif7, A Kinesin Involved In Hedgehog Signalli | 5e-08 | ||
| 3bfn_A | 388 | Crystal Structure Of The Motor Domain Of Human Kine | 2e-07 | ||
| 4etp_A | 403 | C-Terminal Motor And Motor Homology Domain Of Kar3v | 7e-07 | ||
| 1goj_A | 355 | Structure Of A Fast Kinesin: Implications For Atpas | 8e-07 | ||
| 2gry_A | 420 | Crystal Structure Of The Human Kif2 Motor Domain In | 9e-07 | ||
| 1f9t_A | 358 | Crystal Structures Of Kinesin Mutants Reveal A Sign | 9e-07 | ||
| 4h1g_A | 715 | Structure Of Candida Albicans Kar3 Motor Domain Fus | 1e-06 | ||
| 3kar_A | 346 | The Motor Domain Of Kinesin-Like Protein Kar3, A Sa | 1e-06 | ||
| 1f9v_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 1e-06 | ||
| 4gkr_A | 371 | Structure Of The C-Terminal Motor Domain Of Kar3 Fr | 2e-06 | ||
| 3nwn_A | 359 | Crystal Structure Of The Human Kif9 Motor Domain In | 3e-06 | ||
| 2xt3_A | 344 | Human Kif7, A Kinesin Involved In Hedgehog Signalli | 3e-06 | ||
| 1v8j_A | 410 | The Crystal Structure Of The Minimal Functional Dom | 5e-06 | ||
| 1f9w_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 5e-06 | ||
| 1f9u_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 6e-06 | ||
| 3edl_D | 331 | Kinesin13-Microtubule Ring Complex Length = 331 | 9e-06 | ||
| 2heh_A | 387 | Crystal Structure Of The Kif2c Motor Domain (Casp T | 2e-05 | ||
| 2rep_A | 376 | Crystal Structure Of The Motor Domain Of Human Kine | 2e-05 | ||
| 3pxn_A | 344 | Crystal Structure Of The Drosophila Kinesin Family | 3e-04 | ||
| 3dc4_A | 344 | Crystal Structure Of The Drosophila Kinesin Family | 3e-04 |
| >pdb|2EH0|A Chain A, Solution Structure Of The Fha Domain From Human Kinesin- Like Protein Kif1b Length = 130 | Back alignment and structure |
|
| >pdb|4EGX|A Chain A, Crystal Structure Of Kif1a Cc1-Fha Tandem Length = 184 | Back alignment and structure |
| >pdb|4EJQ|A Chain A, Crystal Structure Of Kif1a C-Cc1-Fha Length = 154 | Back alignment and structure |
| >pdb|2G1L|A Chain A, Crystal Structure Of The Fha Domain Of Human Kinesin Family Member C Length = 104 | Back alignment and structure |
| >pdb|1VFV|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppnp Length = 366 | Back alignment and structure |
| >pdb|1I6I|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppcp Length = 366 | Back alignment and structure |
| >pdb|1I5S|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Adp Length = 367 | Back alignment and structure |
| >pdb|1IA0|K Chain K, Kif1a Head-Microtubule Complex Structure In Atp-Form Length = 394 | Back alignment and structure |
| >pdb|3FM8|A Chain A, Crystal Structure Of Full Length Centaurin Alpha-1 Bound With The Fha Domain Of Kif13b (Capri Target) Length = 124 | Back alignment and structure |
| >pdb|3GBJ|A Chain A, Crystal Structure Of The Motor Domain Of Kinesin Kif13b Bound With Adp Length = 354 | Back alignment and structure |
| >pdb|2OWM|A Chain A, Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3) Length = 443 | Back alignment and structure |
| >pdb|3LRE|A Chain A, Crystal Structure Analysis Of Human Kinesin-8 Motor Domain Length = 355 | Back alignment and structure |
| >pdb|1WLN|A Chain A, Solution Structure Of The Fha Domain Of Mouse Afadin 6 Length = 120 | Back alignment and structure |
| >pdb|2H58|A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp Length = 330 | Back alignment and structure |
| >pdb|1T5C|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinetochore Protein Cenp-E Length = 349 | Back alignment and structure |
| >pdb|4AQV|C Chain C, Model Of Human Kinesin-5 Motor Domain (3hqd) And Mammalian Tubulin Heterodimer (1jff) Docked Into The 9.7-angstrom Cryo-em Map Of Microtubule-bound Kinesin-5 Motor Domain In The Ampppnp State. Length = 373 | Back alignment and structure |
| >pdb|1Q0B|A Chain A, Crystal Structure Of The Motor Protein Ksp In Complex With Adp And Monastrol Length = 367 | Back alignment and structure |
| >pdb|4A28|A Chain A, Eg5-2 Length = 368 | Back alignment and structure |
| >pdb|1II6|A Chain A, Crystal Structure Of The Mitotic Kinesin Eg5 In Complex With Mg-Adp. Length = 368 | Back alignment and structure |
| >pdb|4A1Z|A Chain A, Eg5-1 Length = 368 | Back alignment and structure |
| >pdb|4AP0|A Chain A, The Mitotic Kinesin Eg5 In Complex With Mg-Adp And Ispinesib Length = 370 | Back alignment and structure |
| >pdb|3HQD|A Chain A, Human Kinesin Eg5 Motor Domain In Complex With Amppnp And Mg2+ Length = 369 | Back alignment and structure |
| >pdb|1X88|A Chain A, Human Eg5 Motor Domain Bound To Mg-Adp And Monastrol Length = 359 | Back alignment and structure |
| >pdb|3ZCW|A Chain A, Eg5 - New Allosteric Binding Site Length = 348 | Back alignment and structure |
| >pdb|1SDM|A Chain A, Crystal Structure Of Kinesin-Like Calmodulin Binding Protein Length = 369 | Back alignment and structure |
| >pdb|3H4S|A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator Length = 386 | Back alignment and structure |
| >pdb|4ATX|C Chain C, Rigor Kinesin Motor Domain With An Ordered Neck-Linker, Docked On Tubulin Dimer, Modelled Into The 8a Cryo-Em Map Of Doublecortin-Microtubules Decorated With Kinesin Length = 340 | Back alignment and structure |
| >pdb|1MKJ|A Chain A, Human Kinesin Motor Domain With Docked Neck Linker Length = 349 | Back alignment and structure |
| >pdb|1BG2|A Chain A, Human Ubiquitous Kinesin Motor Domain Length = 325 | Back alignment and structure |
| >pdb|2Y5W|A Chain A, Crystal Structure Of Drosophila Melanogaster Kinesin-1 Motor Domain Dimer Length = 365 | Back alignment and structure |
| >pdb|3B6U|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3b In Complex With Adp Length = 372 | Back alignment and structure |
| >pdb|2WBE|C Chain C, Kinesin-5-Tubulin Complex With Amppnp Length = 373 | Back alignment and structure |
| >pdb|2VVG|A Chain A, Crystal Structure Of The G.Intestinalis Kinesin 2 Gikin2a Motor Domain Length = 350 | Back alignment and structure |
| >pdb|3T0Q|A Chain A, Motor Domain Structure Of The Kar3-Like Kinesin From Ashbya Gossypii Length = 349 | Back alignment and structure |
| >pdb|4A14|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 | Back alignment and structure |
| >pdb|3BFN|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 22 Length = 388 | Back alignment and structure |
| >pdb|4ETP|A Chain A, C-Terminal Motor And Motor Homology Domain Of Kar3vik1 Fused To A Synthetic Heterodimeric Coiled Coil Length = 403 | Back alignment and structure |
| >pdb|1GOJ|A Chain A, Structure Of A Fast Kinesin: Implications For Atpase Mechanism And Interactions With Microtubules Length = 355 | Back alignment and structure |
| >pdb|2GRY|A Chain A, Crystal Structure Of The Human Kif2 Motor Domain In Complex With Adp Length = 420 | Back alignment and structure |
| >pdb|1F9T|A Chain A, Crystal Structures Of Kinesin Mutants Reveal A Signalling Pathway For Activation Of The Motor Atpase Length = 358 | Back alignment and structure |
| >pdb|4H1G|A Chain A, Structure Of Candida Albicans Kar3 Motor Domain Fused To Maltose- Binding Protein Length = 715 | Back alignment and structure |
| >pdb|3KAR|A Chain A, The Motor Domain Of Kinesin-Like Protein Kar3, A Saccharomyces Cerevisiae Kinesin-Related Protein Length = 346 | Back alignment and structure |
| >pdb|1F9V|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|4GKR|A Chain A, Structure Of The C-Terminal Motor Domain Of Kar3 From Candida Glabrata Length = 371 | Back alignment and structure |
| >pdb|3NWN|A Chain A, Crystal Structure Of The Human Kif9 Motor Domain In Complex With Adp Length = 359 | Back alignment and structure |
| >pdb|2XT3|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 | Back alignment and structure |
| >pdb|1V8J|A Chain A, The Crystal Structure Of The Minimal Functional Domain Of The Microtubule Destabilizer Kif2c Complexed With Mg-adp Length = 410 | Back alignment and structure |
| >pdb|1F9W|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|1F9U|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|3EDL|D Chain D, Kinesin13-Microtubule Ring Complex Length = 331 | Back alignment and structure |
| >pdb|2HEH|A Chain A, Crystal Structure Of The Kif2c Motor Domain (Casp Target) Length = 387 | Back alignment and structure |
| >pdb|2REP|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member C1 Length = 376 | Back alignment and structure |
| >pdb|3PXN|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Kin10NOD IN Complex With Divalent Manganese And Adp Length = 344 | Back alignment and structure |
| >pdb|3DC4|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Nod In Complex With Adp Length = 344 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1wln_A Afadin; beta sandwich, FHA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.26.1.2 Length = 120 | Back alignment and structure |
|---|
Score = 142 bits (360), Expect = 2e-43
Identities = 40/112 (35%), Positives = 63/112 (56%), Gaps = 7/112 (6%)
Query: 140 TPHLVNLNEDPFMS--ECLIYYIKDGRTKVGSAESNLPQESQDIQLSGSHIKTEHCTFEN 197
P+LV L+ D S + +Y ++ T+VG+ + + IQL G I+ HC N
Sbjct: 11 LPYLVELSPDGSDSRDKPKLYRLQLSVTEVGTEKFD----DNSIQLFGPGIQPHHCDLTN 66
Query: 198 VEGVVTLIPF-QEALCYVNGRQISEPTVLNTGSRVILGKNHVFRFNHPDQVR 248
++GVVT+ P +A YV+G++ISE T+L +G R+ G +HVF+F P
Sbjct: 67 MDGVVTVTPRSMDAETYVDGQRISETTMLQSGMRLQFGTSHVFKFVDPSGPS 118
|
| >2g1l_A Kinesin-like protein KIF1C; transport, FHA domain, structural genomics consortium, kines transport protein; 2.60A {Homo sapiens} SCOP: b.26.1.2 Length = 104 | Back alignment and structure |
|---|
| >3fm8_A Kinesin-like protein KIF13B; kinesin, GAP, GTPase activation, structural genomics consort ATP-binding, cytoskeleton, microtubule, motor protein, NUCL binding; 2.30A {Homo sapiens} PDB: 3mdb_A* Length = 124 | Back alignment and structure |
|---|
| >2eh0_A KLP, kinesin-like protein KIF1B; FHA domain, KIAA0591, KIAA1448, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 130 | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 | Back alignment and structure |
|---|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 | Back alignment and structure |
|---|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 | Back alignment and structure |
|---|
| >1r21_A Antigen KI-67; beta sandwich, cell cycle; NMR {Homo sapiens} SCOP: b.26.1.2 PDB: 2aff_A* Length = 128 | Back alignment and structure |
|---|
| >2jqj_A DNA damage response protein kinase DUN1; protein/phosphopeptide, cell cycle; HET: DNA; NMR {Saccharomyces cerevisiae} PDB: 2jql_A* Length = 151 | Back alignment and structure |
|---|
| >2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 Length = 100 | Back alignment and structure |
|---|
| >3gqs_A Adenylate cyclase-like protein; FHA domain, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.20A {Chlamydia trachomatis} Length = 106 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 275 | |||
| 4egx_A | 184 | Kinesin-like protein KIF1A; FHA domain, transport | 100.0 | |
| 4ejq_A | 154 | Kinesin-like protein KIF1A; homodimer, FHA domain, | 99.97 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 99.97 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 99.96 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 99.96 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 99.96 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 99.96 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 99.96 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 99.96 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 99.96 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 99.96 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 99.96 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 99.96 | |
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 99.96 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 99.96 | |
| 3nwn_A | 359 | Kinesin-like protein KIF9; motor domain, ADP, stru | 99.96 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 99.96 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 99.96 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 99.95 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 99.95 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 99.95 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 99.95 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 99.95 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 99.95 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 99.95 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 99.95 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 99.94 | |
| 4h1g_A | 715 | Maltose binding protein-cakar3 motor domain fusio; | 99.94 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 99.94 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 99.93 | |
| 3fm8_A | 124 | Kinesin-like protein KIF13B; kinesin, GAP, GTPase | 99.92 | |
| 1wln_A | 120 | Afadin; beta sandwich, FHA domain, structural geno | 99.8 | |
| 3gqs_A | 106 | Adenylate cyclase-like protein; FHA domain, struct | 99.52 | |
| 1r21_A | 128 | Antigen KI-67; beta sandwich, cell cycle; NMR {Hom | 99.49 | |
| 2xt9_B | 115 | Putative signal transduction protein GARA; lyase-s | 99.47 | |
| 2jqj_A | 151 | DNA damage response protein kinase DUN1; protein/p | 99.46 | |
| 2kb3_A | 143 | Oxoglutarate dehydrogenase inhibitor; forkhead-ass | 99.45 | |
| 3po8_A | 100 | RV0020C protein, putative uncharacterized protein | 99.45 | |
| 2kfu_A | 162 | RV1827 PThr 22; FHA domain, phosphorylation, intra | 99.43 | |
| 1gxc_A | 149 | CHK2, CDS1, serine/threonine-protein kinase CHK2; | 99.4 | |
| 3hx1_A | 131 | SLR1951 protein; P74513_SYNY3, adenylate cyclase-l | 99.38 | |
| 1lgp_A | 116 | Cell cycle checkpoint protein CHFR; FHA, tungstate | 99.37 | |
| 1uht_A | 118 | Expressed protein; FHA domain, beta-sandwich, anti | 99.36 | |
| 3oun_A | 157 | Putative uncharacterized protein TB39.8; peptidogl | 99.36 | |
| 3va4_A | 132 | Mediator of DNA damage checkpoint protein 1; cell | 99.35 | |
| 1g6g_A | 127 | Protein kinase RAD53; beta-sandwich, phosphopeptid | 99.33 | |
| 4h87_A | 130 | Kanadaptin; FHA domain of PF00498, mRNA processing | 99.33 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 99.32 | |
| 1g3g_A | 164 | Protien kinase SPK1; FHA domain, RAD53, phosphopep | 99.32 | |
| 1mzk_A | 139 | Kinase associated protein phosphatase; beta sandwi | 99.3 | |
| 1dmz_A | 158 | Protein (protein kinase SPK1); beta-sandwich, anti | 99.3 | |
| 2jpe_A | 140 | Nuclear inhibitor of protein phosphatase 1; FHA do | 99.29 | |
| 2pie_A | 138 | E3 ubiquitin-protein ligase RNF8; FHA domain, comp | 99.27 | |
| 2kin_B | 100 | Kinesin; motor protein, cytoskeleton; HET: ADP; 2. | 99.25 | |
| 2csw_A | 145 | Ubiquitin ligase protein RNF8; 11-stranded beta sa | 99.24 | |
| 1qu5_A | 182 | Protein kinase SPK1; FHA, RAD53, transferase; NMR | 99.24 | |
| 3els_A | 158 | PRE-mRNA leakage protein 1; intrinsically unstruct | 99.11 | |
| 3elv_A | 205 | PRE-mRNA leakage protein 1; intrinsically unstruct | 99.07 | |
| 3kin_B | 117 | Kinesin heavy chain; motor protein, cytoskeleton; | 98.92 | |
| 3uv0_A | 102 | Mutator 2, isoform B; FHA, protein binding, dimeri | 98.82 | |
| 4a0e_A | 123 | YSCD, type III secretion protein; transport protei | 98.79 | |
| 3huf_A | 325 | DNA repair and telomere maintenance protein NBS1; | 98.62 | |
| 3kt9_A | 102 | Aprataxin; FHA domain, beta sandwich, beta sheet, | 98.29 | |
| 2brf_A | 110 | Bifunctional polynucleotide phosphatase/kinase; hy | 98.26 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 98.21 | |
| 1yj5_C | 143 | 5' polynucleotide kinase-3' phosphatase FHA domai; | 98.15 | |
| 1wv3_A | 238 | Similar to DNA segregation ATPase and related prot | 98.06 | |
| 1ujx_A | 119 | Polynucleotide kinase 3'-phosphatase; DNA repair, | 97.82 | |
| 2hj1_A | 97 | Hypothetical protein; structural genomics, PSI, pr | 89.34 |
| >4egx_A Kinesin-like protein KIF1A; FHA domain, transport protein; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.2e-41 Score=290.38 Aligned_cols=174 Identities=63% Similarity=1.073 Sum_probs=157.7
Q ss_pred chHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHhhccccccCCceeeEEeeeeeeecCCCCcceeEeeeEE
Q psy7272 18 IAEEAVDQLQASEKLIAELNETWEEKLKRTEEIRIQREAVFAEMGVAVKEDGNTVGVFSPQKAVDDMTDLTTEKVSKISL 97 (275)
Q Consensus 18 ~~~~~~~~L~e~E~L~~el~~t~EE~L~~~e~~~~~r~~~~t~~~~~~~~ssrsh~if~i~~~~~~~~~~~~~~~s~l~l 97 (275)
.+||+.++|+++|+||++|+++|||+|+.+++++++|..++.+||++...+.....|+..+.
T Consensus 6 ~~ee~~e~L~~~e~l~~el~~tWeeKl~~te~~~~e~~~~l~~~gi~~~~~~~~~gv~~~~~------------------ 67 (184)
T 4egx_A 6 FSEEAIERLKETEKIIAELNETWEEKLRRTEAIRMEREALLAEMGVAMREDGGTLGVFSPKK------------------ 67 (184)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTEEEETTTEEEEEECCSS------------------
T ss_pred cCHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHcCcchhhcccccceecCCC------------------
Confidence 47999999999999999999999999999999999999999999999887777777765222
Q ss_pred eeccCcccccccCccccccccccccccchhhHHHHHHHhhhcccCCcCCCCCCCCcceeEEEeeccccccCCCCCCCCCC
Q psy7272 98 VDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEITPHLVNLNEDPFMSECLIYYIKDGRTKVGSAESNLPQE 177 (275)
Q Consensus 98 vDLAGSEr~~~~~~~~~~~~E~~~IN~SL~~Lg~vi~al~~~~~~l~~l~~~P~r~s~Lt~~L~~~~t~IGr~~~~~~~~ 177 (275)
.||++||++||..+..++|+|+++.++||+.++...
T Consensus 68 ------------------------------------------~PhLvnLn~Dp~ls~~l~y~L~~g~t~VGr~~~~~~-- 103 (184)
T 4egx_A 68 ------------------------------------------TPHLVNLNEDPLMSECLLYYIKDGITRVGREDGERR-- 103 (184)
T ss_dssp ------------------------------------------SCEEEECCCCTTCSSCSEEECCSEEEEEECSSSSSC--
T ss_pred ------------------------------------------CceEEeccCCcccCceEEEEECCCcCcCCCCCcCCC--
Confidence 799999999999999999999999999999876555
Q ss_pred cceeeecCCcccccceEEEEe-----CCEEEEEeCCCCceEECCeeeccceecCCCCEEEeCCceEEEEeCCchhhhhhh
Q psy7272 178 SQDIQLSGSHIKTEHCTFENV-----EGVVTLIPFQEALCYVNGRQISEPTVLNTGSRVILGKNHVFRFNHPDQVRVHRE 252 (275)
Q Consensus 178 ~~dI~L~~~~Is~~Hc~I~~~-----e~~vtL~~~s~a~t~VNG~~I~~~~~L~~GDrI~lG~~~~f~f~~P~~a~~~r~ 252 (275)
+||.|.|++|++.||.|.+. ++.++|.|.++|.|||||.+|.+++.|+|||||.||++|+|||++|.+|+.+|+
T Consensus 104 -~dI~L~G~~I~~~Hc~i~~~~~~~~~~~vtl~p~~~a~t~VNG~~I~~~~~L~~GDrI~lG~~h~Frfn~P~ea~~~r~ 182 (184)
T 4egx_A 104 -QDIVLSGHFIKEEHCVFRSDSRGGSEAVVTLEPCEGADTYVNGKKVTEPSILRSGNRIIMGKSHVFRFNHPEQARQERE 182 (184)
T ss_dssp -CSEECCSTTCCSEEEEEEEECCSSCSCEEEEEECTTCCEEETTEECCSCEECCTTCEEEETTTEEEEEECHHHHHHC--
T ss_pred -CeEEECccccccccEEEEEcCCCCceEEEEEeeCCCCeEEEcCEEccccEEcCCCCEEEECCCCEEEECChHHHHHhhc
Confidence 89999999999999999985 467999999999999999999999999999999999999999999999999998
Q ss_pred cc
Q psy7272 253 NK 254 (275)
Q Consensus 253 ~~ 254 (275)
++
T Consensus 183 ~s 184 (184)
T 4egx_A 183 RT 184 (184)
T ss_dssp --
T ss_pred CC
Confidence 74
|
| >4ejq_A Kinesin-like protein KIF1A; homodimer, FHA domain, transport protein; 1.89A {Homo sapiens} PDB: 2eh0_A 2g1l_A | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* | Back alignment and structure |
|---|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* | Back alignment and structure |
|---|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* | Back alignment and structure |
|---|
| >3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* | Back alignment and structure |
|---|
| >4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* | Back alignment and structure |
|---|
| >3fm8_A Kinesin-like protein KIF13B; kinesin, GAP, GTPase activation, structural genomics consort ATP-binding, cytoskeleton, microtubule, motor protein, NUCL binding; 2.30A {Homo sapiens} PDB: 3mdb_A* | Back alignment and structure |
|---|
| >1wln_A Afadin; beta sandwich, FHA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >3gqs_A Adenylate cyclase-like protein; FHA domain, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.20A {Chlamydia trachomatis} | Back alignment and structure |
|---|
| >1r21_A Antigen KI-67; beta sandwich, cell cycle; NMR {Homo sapiens} SCOP: b.26.1.2 PDB: 2aff_A* | Back alignment and structure |
|---|
| >2xt9_B Putative signal transduction protein GARA; lyase-signaling protein complex, KDH, KGD; HET: TPP; 2.20A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2jqj_A DNA damage response protein kinase DUN1; protein/phosphopeptide, cell cycle; HET: DNA; NMR {Saccharomyces cerevisiae} PDB: 2jql_A* | Back alignment and structure |
|---|
| >2kb3_A Oxoglutarate dehydrogenase inhibitor; forkhead-associated domain, kinase substrate, GARA, FHA, cytoplasm, phosphoprotein; HET: TPO; NMR {Corynebacterium glutamicum} PDB: 2kb4_A | Back alignment and structure |
|---|
| >3po8_A RV0020C protein, putative uncharacterized protein TB39.8; FHA domain, synthetic peptide, peptide binding protein; 1.50A {Mycobacterium tuberculosis} SCOP: b.26.1.0 PDB: 3poa_A* 2lc1_A | Back alignment and structure |
|---|
| >2kfu_A RV1827 PThr 22; FHA domain, phosphorylation, intramolecular interaction, glutamate metabolism, phosphoprotein, protein binding; HET: TPO; NMR {Mycobacterium tuberculosis} PDB: 2kkl_A | Back alignment and structure |
|---|
| >1gxc_A CHK2, CDS1, serine/threonine-protein kinase CHK2; phosphoprotein-binding domain, checkpoint kinase, transferase; HET: TPO; 2.7A {Homo sapiens} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >3hx1_A SLR1951 protein; P74513_SYNY3, adenylate cyclase-like protein, NESG, structural genomics, PSI-2, protein structure initiative; 2.50A {Synechocystis SP} | Back alignment and structure |
|---|
| >1lgp_A Cell cycle checkpoint protein CHFR; FHA, tungstate, domain swapping; 2.00A {Homo sapiens} SCOP: b.26.1.2 PDB: 1lgq_A | Back alignment and structure |
|---|
| >1uht_A Expressed protein; FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3va4_A Mediator of DNA damage checkpoint protein 1; cell cycle, FHA domain, DNA-damage, CHK2 and MDC1 dimerizati; HET: TPO; 1.54A {Mus musculus} PDB: 3va1_A* 3umz_A 3unm_A 3unn_A* 3uot_A* 3un0_B | Back alignment and structure |
|---|
| >1g6g_A Protein kinase RAD53; beta-sandwich, phosphopeptide complex, cell cycle; HET: TPO; 1.60A {Saccharomyces cerevisiae} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >4h87_A Kanadaptin; FHA domain of PF00498, mRNA processing, nucleus, structural joint center for structural genomics, JCSG, protein structu initiative; HET: SO4; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >1g3g_A Protien kinase SPK1; FHA domain, RAD53, phosphopeptide, phosphoprotein, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1j4o_A 1j4p_A* 1j4q_A* 1k3j_A 1k3n_A* 1k3q_A* 2a0t_A* 2jqi_A* | Back alignment and structure |
|---|
| >1dmz_A Protein (protein kinase SPK1); beta-sandwich, antiparallel beta-sheets, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1fhq_A 1fhr_A* 1j4k_A* 1j4l_A* 1k2m_A* 1k2n_A* | Back alignment and structure |
|---|
| >2jpe_A Nuclear inhibitor of protein phosphatase 1; FHA domain, NIPP1, mRNA splicing, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2pie_A E3 ubiquitin-protein ligase RNF8; FHA domain, complex, ligase, signaling protein; HET: TPO; 1.35A {Homo sapiens} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >2csw_A Ubiquitin ligase protein RNF8; 11-stranded beta sandwich, ring finger protein 8, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >1qu5_A Protein kinase SPK1; FHA, RAD53, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >3els_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3elv_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 2.40A {Saccharomyces cerevisiae} PDB: 2jkd_A | Back alignment and structure |
|---|
| >3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3uv0_A Mutator 2, isoform B; FHA, protein binding, dimerization; 1.90A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4a0e_A YSCD, type III secretion protein; transport protein, SAD phasing, type III secretion system; 2.04A {Yersinia pestis} PDB: 4d9v_A | Back alignment and structure |
|---|
| >3huf_A DNA repair and telomere maintenance protein NBS1; NBS1, FHA domain, BRCT domain, phosphoprotein binding, phosp binding, DNA repair; HET: DNA TPO; 2.15A {Schizosaccharomyces pombe} PDB: 3hue_A* 3i0m_A* 3i0n_A* | Back alignment and structure |
|---|
| >3kt9_A Aprataxin; FHA domain, beta sandwich, beta sheet, AMP hydrolase, alternative splicing, disease mutation, DNA damage, DNA repair, DNA-binding; 1.65A {Homo sapiens} SCOP: b.26.1.0 | Back alignment and structure |
|---|
| >2brf_A Bifunctional polynucleotide phosphatase/kinase; hydrolase/transferase, FHA, forkhead-associated, PNKP, PNK, polynucleotide kinase 3' phosphatase; 1.40A {Homo sapiens} SCOP: b.26.1.2 PDB: 2w3o_A* 1yjm_A* | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A | Back alignment and structure |
|---|
| >1yj5_C 5' polynucleotide kinase-3' phosphatase FHA domai; beta sandwich, P-loop, transferase; 2.80A {Mus musculus} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >1wv3_A Similar to DNA segregation ATPase and related proteins; structural genomics, unknown function; 1.75A {Staphylococcus aureus subsp} SCOP: b.26.1.4 b.26.1.4 | Back alignment and structure |
|---|
| >1ujx_A Polynucleotide kinase 3'-phosphatase; DNA repair, FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif; NMR {Mus musculus} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >2hj1_A Hypothetical protein; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; 2.10A {Haemophilus influenzae} SCOP: d.15.3.4 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 275 | ||||
| d1wlna1 | 107 | b.26.1.2 (A:8-114) Afadin {Mouse (Mus musculus) [T | 5e-31 | |
| d2g1la1 | 102 | b.26.1.2 (A:498-599) Kinesin-like protein kif1c {H | 1e-28 | |
| d2zfia1 | 349 | c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), | 4e-11 | |
| d1bg2a_ | 323 | c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId | 2e-09 | |
| d2affa1 | 98 | b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapi | 2e-09 | |
| d1v8ka_ | 362 | c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c | 8e-09 | |
| d1ry6a_ | 330 | c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodiu | 3e-08 | |
| d2ff4a3 | 99 | b.26.1.2 (A:284-382) Probable regulatory protein E | 4e-08 | |
| d1f9va_ | 342 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 5e-07 | |
| d1goja_ | 354 | c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 | 6e-07 | |
| d2ncda_ | 368 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 8e-07 | |
| d1x88a1 | 345 | c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), | 1e-05 | |
| d1sdma_ | 364 | c.37.1.9 (A:) Kinesin heavy chain-like protein {Po | 1e-05 |
| >d1wlna1 b.26.1.2 (A:8-114) Afadin {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 | Back information, alignment and structure |
|---|
class: All beta proteins fold: SMAD/FHA domain superfamily: SMAD/FHA domain family: FHA domain domain: Afadin species: Mouse (Mus musculus) [TaxId: 10090]
Score = 109 bits (273), Expect = 5e-31
Identities = 40/108 (37%), Positives = 62/108 (57%), Gaps = 7/108 (6%)
Query: 140 TPHLVNLNEDPFMS--ECLIYYIKDGRTKVGSAESNLPQESQDIQLSGSHIKTEHCTFEN 197
P+LV L+ D S + +Y ++ T+VG+ + + IQL G I+ HC N
Sbjct: 4 LPYLVELSPDGSDSRDKPKLYRLQLSVTEVGTEKF----DDNSIQLFGPGIQPHHCDLTN 59
Query: 198 VEGVVTLIPFQE-ALCYVNGRQISEPTVLNTGSRVILGKNHVFRFNHP 244
++GVVT+ P A YV+G++ISE T+L +G R+ G +HVF+F P
Sbjct: 60 MDGVVTVTPRSMDAETYVDGQRISETTMLQSGMRLQFGTSHVFKFVDP 107
|
| >d2g1la1 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Length = 349 | Back information, alignment and structure |
|---|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
| >d2affa1 b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Length = 362 | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 330 | Back information, alignment and structure |
|---|
| >d2ff4a3 b.26.1.2 (A:284-382) Probable regulatory protein EmbR, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 99 | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 | Back information, alignment and structure |
|---|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 368 | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 364 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 275 | |||
| d1sdma_ | 364 | Kinesin heavy chain-like protein {Potato (Solanum | 99.92 | |
| d1x88a1 | 345 | Kinesin {Human (Homo sapiens), mitotic kinesin eg5 | 99.91 | |
| d1goja_ | 354 | Kinesin {Neurospora crassa [TaxId: 5141]} | 99.9 | |
| d2zfia1 | 349 | Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 | 99.89 | |
| d1bg2a_ | 323 | Kinesin {Human (Homo sapiens) [TaxId: 9606]} | 99.89 | |
| d1v8ka_ | 362 | Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 | 99.89 | |
| d1ry6a_ | 330 | Kinesin {Malaria parasite (Plasmodium falciparum) | 99.87 | |
| d1f9va_ | 342 | Kinesin motor Ncd (non-claret disjunctional) {Bake | 99.86 | |
| d2g1la1 | 102 | Kinesin-like protein kif1c {Human (Homo sapiens) [ | 99.86 | |
| d1wlna1 | 107 | Afadin {Mouse (Mus musculus) [TaxId: 10090]} | 99.86 | |
| d2ncda_ | 368 | Kinesin motor Ncd (non-claret disjunctional) {Frui | 99.85 | |
| d2ff4a3 | 99 | Probable regulatory protein EmbR, C-terminal domai | 99.6 | |
| d2affa1 | 98 | Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} | 99.58 | |
| d1uhta_ | 118 | FHA domain containing protein At4G14490 {Thale cre | 99.31 | |
| d1gxca_ | 116 | Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} | 99.23 | |
| d1mzka_ | 122 | Kinase associated protein phosphatase {Thale cress | 99.21 | |
| d1lgpa_ | 113 | Cell cycle checkpoint protein Chfr {Human (Homo sa | 99.2 | |
| d2piea1 | 127 | Ubiquitin ligase protein RNF8 {Human (Homo sapiens | 99.14 | |
| d2brfa1 | 101 | Polynucleotide kinase 3'-phosphatase {Human (Homo | 99.05 | |
| d1g6ga_ | 127 | Phosphotyrosine binding domain of Rad53 {Baker's y | 99.04 | |
| d1dmza_ | 158 | Phosphotyrosine binding domain of Rad53 {Baker's y | 98.96 | |
| d1c06a_ | 159 | Ribosomal protein S4 {Bacillus stearothermophilus | 85.03 |
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Kinesin heavy chain-like protein species: Potato (Solanum tuberosum) [TaxId: 4113]
Probab=99.92 E-value=1.1e-27 Score=221.74 Aligned_cols=160 Identities=29% Similarity=0.342 Sum_probs=125.1
Q ss_pred HHhHHHHHHHHHHHHHHHHHHHHhhccccccCCceeeEEeeeeeeecCCCCcceeEeeeEEeeccCcccccccCcccccc
Q psy7272 37 NETWEEKLKRTEEIRIQREAVFAEMGVAVKEDGNTVGVFSPQKAVDDMTDLTTEKVSKISLVDLAGSERADSTGAKGTRL 116 (275)
Q Consensus 37 ~~t~EE~L~~~e~~~~~r~~~~t~~~~~~~~ssrsh~if~i~~~~~~~~~~~~~~~s~l~lvDLAGSEr~~~~~~~~~~~ 116 (275)
..+|+|.+.....+.++|.++.|.|| .+|||||+||++.+..... .......|+|+|||||||||..++++.|.++
T Consensus 170 v~s~~~~~~~l~~g~~~R~~~~t~~n---~~ssRsH~i~~i~v~~~~~-~~~~~~~~kl~~vDLAGsEr~~~~~~~g~~~ 245 (364)
T d1sdma_ 170 ISTYEELKTIIQRGSEQRHTTGTLMN---EQSSRSHLIVSVIIESTNL-QTQAIARGKLSFVDLAGSERVKKSGSAGNQL 245 (364)
T ss_dssp ECSHHHHHHHHHHHHHHHCCCSSCTT---CHHHHSEEEEEEEEEEEET-TTCCEEEEEEEEEECCCCSCCCC--------
T ss_pred eCCHHHHHHHhhccceeecccccccc---ccccccceEEEEEEEEecc-CcceeeeEEEEeechhhccccccccccCcee
Confidence 45788888889999999999888887 5699999999987655443 3445688999999999999999999999999
Q ss_pred ccccccccchhhHHHHHHHhhhcccCCcCCCCCCCCcceeEEEeeccccccCCCCCCCCCCcceeeecCCcccccceEEE
Q psy7272 117 KEGANINKSLTTLGKVISALAEITPHLVNLNEDPFMSECLIYYIKDGRTKVGSAESNLPQESQDIQLSGSHIKTEHCTFE 196 (275)
Q Consensus 117 ~E~~~IN~SL~~Lg~vi~al~~~~~~l~~l~~~P~r~s~Lt~~L~~~~t~IGr~~~~~~~~~~dI~L~~~~Is~~Hc~I~ 196 (275)
+|+.+||+||++||+||.||+++..|+ |||+|+||++|++.++ |++.+.++ ++|.+......
T Consensus 246 ~E~~~iN~SL~~L~~vi~aL~~~~~~i------pyR~SkLT~lL~d~Lg--gns~t~~I---~~isp~~~~~~------- 307 (364)
T d1sdma_ 246 KEAQSINKSLSALGDVISALSSGNQHI------PYRNHKLTMLMSDSLG--GNAKTLMF---VNISPAESNLD------- 307 (364)
T ss_dssp -CCCTTCHHHHHHHHHHHHHHHTCSCC------CGGGCHHHHHTTTTTT--SSSEEEEE---EEECCBGGGHH-------
T ss_pred eeccccccchhhHHHHHHHHHcCCCcC------CchhhhhhHHHHhhcC--CCceEEEE---EEeCCCcchHH-------
Confidence 999999999999999999999988887 9999999999999988 88877666 56655444433
Q ss_pred EeCCEEEEEeCCCCceEECCeeec
Q psy7272 197 NVEGVVTLIPFQEALCYVNGRQIS 220 (275)
Q Consensus 197 ~~e~~vtL~~~s~a~t~VNG~~I~ 220 (275)
++..||+++++++...|...++
T Consensus 308 --eTl~TL~fa~~ak~i~n~p~~n 329 (364)
T d1sdma_ 308 --ETHNSLTYASRVRSIVNDPSKN 329 (364)
T ss_dssp --HHHHHHHHHHHHTTCCCCCCCC
T ss_pred --HHHHHHHHHHHHhhcccCCccc
Confidence 6667888888888777765553
|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2g1la1 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wlna1 b.26.1.2 (A:8-114) Afadin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2ff4a3 b.26.1.2 (A:284-382) Probable regulatory protein EmbR, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2affa1 b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhta_ b.26.1.2 (A:) FHA domain containing protein At4G14490 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1gxca_ b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mzka_ b.26.1.2 (A:) Kinase associated protein phosphatase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1lgpa_ b.26.1.2 (A:) Cell cycle checkpoint protein Chfr {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2piea1 b.26.1.2 (A:13-139) Ubiquitin ligase protein RNF8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2brfa1 b.26.1.2 (A:8-108) Polynucleotide kinase 3'-phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g6ga_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dmza_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1c06a_ d.66.1.2 (A:) Ribosomal protein S4 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|