Psyllid ID: psy72
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 202 | ||||||
| 193683664 | 144 | PREDICTED: mitochondrial import receptor | 0.232 | 0.326 | 0.446 | 9e-05 | |
| 322792426 | 68 | hypothetical protein SINV_14090 [Solenop | 0.331 | 0.985 | 0.338 | 0.0001 | |
| 307204875 | 141 | Mitochondrial import receptor subunit TO | 0.331 | 0.475 | 0.323 | 0.0002 | |
| 307189819 | 141 | Mitochondrial import receptor subunit TO | 0.331 | 0.475 | 0.323 | 0.0002 | |
| 332025892 | 141 | Mitochondrial import receptor subunit TO | 0.331 | 0.475 | 0.323 | 0.0003 | |
| 357608075 | 163 | hypothetical protein KGM_13847 [Danaus p | 0.212 | 0.263 | 0.418 | 0.0005 | |
| 91090252 | 143 | PREDICTED: similar to maggie CG14981-PA | 0.212 | 0.300 | 0.395 | 0.0006 |
| >gi|193683664|ref|XP_001945135.1| PREDICTED: mitochondrial import receptor subunit TOM22 homolog [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 52.8 bits (125), Expect = 9e-05, Method: Compositional matrix adjust.
Identities = 21/47 (44%), Positives = 35/47 (74%)
Query: 55 KVPISFYSFARTSTWLIATSATVALLPIVFESQRFEVQEMQRNQQKQ 101
KV + Y FA TSTW ++T+A + L+P++FE++R +++E Q+N KQ
Sbjct: 78 KVILETYLFACTSTWYVSTTAALLLMPVLFETERIQMEEAQKNHSKQ 124
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|322792426|gb|EFZ16410.1| hypothetical protein SINV_14090 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|307204875|gb|EFN83430.1| Mitochondrial import receptor subunit TOM22-like protein [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|307189819|gb|EFN74091.1| Mitochondrial import receptor subunit TOM22-like protein [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|332025892|gb|EGI66048.1| Mitochondrial import receptor subunit TOM22-like protein [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|357608075|gb|EHJ65812.1| hypothetical protein KGM_13847 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|91090252|ref|XP_969934.1| PREDICTED: similar to maggie CG14981-PA [Tribolium castaneum] gi|270013781|gb|EFA10229.1| hypothetical protein TcasGA2_TC012425 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 202 | ||||||
| FB|FBgn0035473 | 148 | mge "maggie" [Drosophila melan | 0.301 | 0.412 | 0.333 | 1.1e-10 | |
| ZFIN|ZDB-GENE-030131-9810 | 134 | tomm22 "translocase of outer m | 0.202 | 0.305 | 0.414 | 4.9e-08 | |
| UNIPROTKB|F1NLW3 | 146 | TOMM22 "Uncharacterized protei | 0.301 | 0.417 | 0.349 | 6.6e-07 | |
| UNIPROTKB|A6QPI6 | 140 | TOMM22 "Mitochondrial import r | 0.301 | 0.435 | 0.333 | 1.9e-06 | |
| UNIPROTKB|E2RKA9 | 142 | TOMM22 "Uncharacterized protei | 0.301 | 0.429 | 0.333 | 1.9e-06 | |
| UNIPROTKB|Q9NS69 | 142 | TOMM22 "Mitochondrial import r | 0.301 | 0.429 | 0.333 | 1.9e-06 | |
| UNIPROTKB|F1SLC2 | 142 | TOMM22 "Uncharacterized protei | 0.301 | 0.429 | 0.333 | 1.9e-06 | |
| MGI|MGI:2450248 | 142 | Tomm22 "translocase of outer m | 0.301 | 0.429 | 0.333 | 1.9e-06 | |
| RGD|1303260 | 142 | Tomm22 "translocase of outer m | 0.301 | 0.429 | 0.333 | 1.9e-06 | |
| UNIPROTKB|J9NTE2 | 140 | LOC100855486 "Uncharacterized | 0.297 | 0.428 | 0.312 | 2.2e-05 |
| FB|FBgn0035473 mge "maggie" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 116 (45.9 bits), Expect = 1.1e-10, Sum P(2) = 1.1e-10
Identities = 21/63 (33%), Positives = 40/63 (63%)
Query: 41 PKESYSAAGEIF--LIKVPISFYSFARTSTWLIATSATVALLPIVFESQRFEVQEMQRNQ 98
P+ +A G + +K FYSF+ ++W+ TSA + P++FE++R +++E+ ++Q
Sbjct: 64 PEPVRNAVGAVSSATVKSVKGFYSFSCNASWIFFTSAVILFAPVIFETERAQMEELHKSQ 123
Query: 99 QKQ 101
QKQ
Sbjct: 124 QKQ 126
|
|
| ZFIN|ZDB-GENE-030131-9810 tomm22 "translocase of outer mitochondrial membrane 22 homolog (yeast)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NLW3 TOMM22 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6QPI6 TOMM22 "Mitochondrial import receptor subunit TOM22 homolog" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RKA9 TOMM22 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9NS69 TOMM22 "Mitochondrial import receptor subunit TOM22 homolog" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SLC2 TOMM22 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2450248 Tomm22 "translocase of outer mitochondrial membrane 22 homolog (yeast)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1303260 Tomm22 "translocase of outer mitochondrial membrane 22 homolog (yeast)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NTE2 LOC100855486 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
No hit with e-value below 0.005
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 202 | |||
| KOG4111|consensus | 136 | 99.97 | ||
| PF04281 | 137 | Tom22: Mitochondrial import receptor subunit Tom22 | 99.88 | |
| TIGR00986 | 145 | 3a0801s05tom22 mitochondrial import receptor subun | 99.82 | |
| PF04281 | 137 | Tom22: Mitochondrial import receptor subunit Tom22 | 91.37 |
| >KOG4111|consensus | Back alignment and domain information |
|---|
Probab=99.97 E-value=4.6e-33 Score=224.72 Aligned_cols=98 Identities=24% Similarity=0.332 Sum_probs=88.0
Q ss_pred ChhHHHHHhhhhhhcccccCCCcccccCchhhhccccceEE--eeeehhhhhcccceeehhhhhHHHhhhhhhhhhhhHh
Q psy72 13 STSSVMKNLKGSALWNGEQGRSSLDNSTPKESYSAAGEIFL--IKVPISFYSFARTSTWLIATSATVALLPIVFESQRFE 90 (202)
Q Consensus 13 ~~~~~~~~t~gERLWgLEMfPesLtEMFPe~VRSAAgatfs--v~vvKkLYsFSrsAlWI~~TSfmILvlPVIFEtER~Q 90 (202)
+.++--.||+-||+||| +||||+..|++++.+++ ++++||+|+|||+++||++|||||||+|||||+||+|
T Consensus 35 ~dd~e~dETi~eRi~gL-------kEivp~g~R~~i~~~~~~av~~~kk~~~fsg~a~Wi~tTt~lIL~vP~i~e~E~~q 107 (136)
T KOG4111|consen 35 GDDSEEDETILERIWGL-------KEIVPQGRRSAIGATAGDAVFVVKKLYSFSGKAAWIATTTFLILVVPLIFETEREQ 107 (136)
T ss_pred ccCCCcchhHHHHHHhh-------HhhcchhhhhhhhhcchhHHHHHHHHHHhccchhHHHHHHHHHHHHHHHHHHHHHH
Confidence 34455789999999999 78888888889887776 8999999999999999999999999999999999999
Q ss_pred HHHHHHhhhhhhhcCCCccchhhcccCCCCC
Q psy72 91 VQEMQRNQQKQWSTRPFSWLIFAFQGVNFEN 121 (202)
Q Consensus 91 MEE~Q~qQQRQiLLGP~aa~~~A~sG~~~~~ 121 (202)
|++.|.+||||+||||++ |++|+..+.
T Consensus 108 ~~~e~e~Qq~q~ll~p~~----~~q~~~~~a 134 (136)
T KOG4111|consen 108 QLQEQEKQQRQQLLAPNV----AAQGGKPGA 134 (136)
T ss_pred HHhHHHHHHHHHhCCCcc----cccCCCCCC
Confidence 999999999999999999 777765543
|
|
| >PF04281 Tom22: Mitochondrial import receptor subunit Tom22 ; InterPro: IPR005683 The mitochondrial protein translocase family, which is responsible for movement of nuclear encoded pre-proteins into mitochondria, is very complex with at least 19 components | Back alignment and domain information |
|---|
| >TIGR00986 3a0801s05tom22 mitochondrial import receptor subunit Tom22 | Back alignment and domain information |
|---|
| >PF04281 Tom22: Mitochondrial import receptor subunit Tom22 ; InterPro: IPR005683 The mitochondrial protein translocase family, which is responsible for movement of nuclear encoded pre-proteins into mitochondria, is very complex with at least 19 components | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00