Psyllid ID: psy72


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200--
MTCFLFIRNLKGSTSSVMKNLKGSALWNGEQGRSSLDNSTPKESYSAAGEIFLIKVPISFYSFARTSTWLIATSATVALLPIVFESQRFEVQEMQRNQQKQWSTRPFSWLIFAFQGVNFENVEHHHPLKKILDTGHYSPVYVAHKVPANVACGPHTHGSWKSLYLCLTFSWCRENGYGPLFPCILLGTGSSLGPGMAMMPSR
cEEEEEEEcccccHHHHHHHccccccccccccccccccccccccccccccEEEEEEHHHHHcccccEEEEEEHHHHHHHHHEEEEEcHHcHHHHHHHHHccEEEcccHHHHHHcccccccccccccccHHHccccccccEEEEEcccccccccccccccccEEEEEEEEHHHHcccccccccEEEEcccccccccccccccc
ccHEEEEEccccccHHHHHHcccHHHHcccccccccccccccEEEccccEEEEEEEHHHHHHHHcccEEEEEHHHHHHHcHHEEHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccccccccHHHHHcccccccEEEEEEccccccccccccccHHHEHHHHEHHHHHHccccccccEEEEcccccccccccccccc
MTCFLFIrnlkgstsSVMKNLkgsalwngeqgrssldnstpkesysaagEIFLIKVPISFYSFARTSTWLIATSATVALLPIVFESQRFEVQEMQRNQqkqwstrpfSWLIFAFqgvnfenvehhhplkkildtghyspvyvahkvpanvacgphthgswkSLYLCLTfswcrengygplfpcillgtgsslgpgmammpsr
MTCFLFIrnlkgstssvMKNLKGsalwngeqgrsSLDNSTPKESYSAAGEIFLIKVPISFYSFARTSTWLIATSATVALLPIVFESQRFEVQEMQRNQQKQWSTRPFSWLIFAFQGVNFENVEHHHPLKKILDTGHYSPVYVAHKVPANVACGPHTHGSWKSLYLCLTFSWCRENGYGPLFPCILLGtgsslgpgmammpsr
MTCFLFIRNLKGSTSSVMKNLKGSALWNGEQGRSSLDNSTPKESYSAAGEIFLIKVPISFYSFARTSTWLIATSATVALLPIVFESQRFEVQEMQRNQQKQWSTRPFSWLIFAFQGVNFENVEHHHPLKKILDTGHYSPVYVAHKVPANVACGPHTHGSWKSLYLCLTFSWCRENGYGPLFPCILLGTGSSLGPGMAMMPSR
**CFLFIRNLK***********************************AAGEIFLIKVPISFYSFARTSTWLIATSATVALLPIVFESQRFEVQ*******KQWSTRPFSWLIFAFQGVNFENVEHHHPLKKILDTGHYSPVYVAHKVPANVACGPHTHGSWKSLYLCLTFSWCRENGYGPLFPCILLGTG*************
*TCFLFIRNLKGSTS*****LKGSALWNGEQG************YSAAGEIFLIKVPISFYSFARTSTWLIATSATVALLPIVFES****************************************PLKKILDTGHYSPVYVAHKVPANVACGPHTHGSWKSLYLCLTFSWCRENGYGPLFPCILLGTGSSLGPGMAMM***
MTCFLFIRNLKGSTSSVMKNLKGSALWN****************YSAAGEIFLIKVPISFYSFARTSTWLIATSATVALLPIVFESQRFEV***********STRPFSWLIFAFQGVNFENVEHHHPLKKILDTGHYSPVYVAHKVPANVACGPHTHGSWKSLYLCLTFSWCRENGYGPLFPCILLGTGSSLGPGMAMMPSR
*TCFLFIRNLKGSTSSV*K******LWNGEQGRSSLDNSTPKESYSAAGEIFLIKVPISFYSFARTSTWLIATSATVALLPIVFESQRFEVQEMQRNQQKQWSTRPFSWLIFAFQGVNFENVEHHHPLKKILDTGHYSPVYVAHKVPANVACGPHTHGSWKSLYLCLTFSWCRENGYGPLFPCILLGT**************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHi
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTCFLFIRNLKGSTSSVMKNLKGSALWNGEQGRSSLDNSTPKESYSAAGEIFLIKVPISFYSFARTSTWLIATSATVALLPIVFESQRFEVQEMQRNQQKQWSTRPFSWLIFAFQGVNFENVEHHHPLKKILDTGHYSPVYVAHKVPANVACGPHTHGSWKSLYLCLTFSWCRENGYGPLFPCILLGTGSSLGPGMAMMPSR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query202
193683664144 PREDICTED: mitochondrial import receptor 0.232 0.326 0.446 9e-05
32279242668 hypothetical protein SINV_14090 [Solenop 0.331 0.985 0.338 0.0001
307204875141 Mitochondrial import receptor subunit TO 0.331 0.475 0.323 0.0002
307189819141 Mitochondrial import receptor subunit TO 0.331 0.475 0.323 0.0002
332025892141 Mitochondrial import receptor subunit TO 0.331 0.475 0.323 0.0003
357608075163 hypothetical protein KGM_13847 [Danaus p 0.212 0.263 0.418 0.0005
91090252143 PREDICTED: similar to maggie CG14981-PA 0.212 0.300 0.395 0.0006
>gi|193683664|ref|XP_001945135.1| PREDICTED: mitochondrial import receptor subunit TOM22 homolog [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score = 52.8 bits (125), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 35/47 (74%)

Query: 55  KVPISFYSFARTSTWLIATSATVALLPIVFESQRFEVQEMQRNQQKQ 101
           KV +  Y FA TSTW ++T+A + L+P++FE++R +++E Q+N  KQ
Sbjct: 78  KVILETYLFACTSTWYVSTTAALLLMPVLFETERIQMEEAQKNHSKQ 124




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|322792426|gb|EFZ16410.1| hypothetical protein SINV_14090 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307204875|gb|EFN83430.1| Mitochondrial import receptor subunit TOM22-like protein [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307189819|gb|EFN74091.1| Mitochondrial import receptor subunit TOM22-like protein [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332025892|gb|EGI66048.1| Mitochondrial import receptor subunit TOM22-like protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|357608075|gb|EHJ65812.1| hypothetical protein KGM_13847 [Danaus plexippus] Back     alignment and taxonomy information
>gi|91090252|ref|XP_969934.1| PREDICTED: similar to maggie CG14981-PA [Tribolium castaneum] gi|270013781|gb|EFA10229.1| hypothetical protein TcasGA2_TC012425 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query202
FB|FBgn0035473148 mge "maggie" [Drosophila melan 0.301 0.412 0.333 1.1e-10
ZFIN|ZDB-GENE-030131-9810134 tomm22 "translocase of outer m 0.202 0.305 0.414 4.9e-08
UNIPROTKB|F1NLW3146 TOMM22 "Uncharacterized protei 0.301 0.417 0.349 6.6e-07
UNIPROTKB|A6QPI6140 TOMM22 "Mitochondrial import r 0.301 0.435 0.333 1.9e-06
UNIPROTKB|E2RKA9142 TOMM22 "Uncharacterized protei 0.301 0.429 0.333 1.9e-06
UNIPROTKB|Q9NS69142 TOMM22 "Mitochondrial import r 0.301 0.429 0.333 1.9e-06
UNIPROTKB|F1SLC2142 TOMM22 "Uncharacterized protei 0.301 0.429 0.333 1.9e-06
MGI|MGI:2450248142 Tomm22 "translocase of outer m 0.301 0.429 0.333 1.9e-06
RGD|1303260142 Tomm22 "translocase of outer m 0.301 0.429 0.333 1.9e-06
UNIPROTKB|J9NTE2140 LOC100855486 "Uncharacterized 0.297 0.428 0.312 2.2e-05
FB|FBgn0035473 mge "maggie" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 116 (45.9 bits), Expect = 1.1e-10, Sum P(2) = 1.1e-10
 Identities = 21/63 (33%), Positives = 40/63 (63%)

Query:    41 PKESYSAAGEIF--LIKVPISFYSFARTSTWLIATSATVALLPIVFESQRFEVQEMQRNQ 98
             P+   +A G +    +K    FYSF+  ++W+  TSA +   P++FE++R +++E+ ++Q
Sbjct:    64 PEPVRNAVGAVSSATVKSVKGFYSFSCNASWIFFTSAVILFAPVIFETERAQMEELHKSQ 123

Query:    99 QKQ 101
             QKQ
Sbjct:   124 QKQ 126


GO:0005742 "mitochondrial outer membrane translocase complex" evidence=ISS;NAS
GO:0015450 "P-P-bond-hydrolysis-driven protein transmembrane transporter activity" evidence=ISS
GO:0005739 "mitochondrion" evidence=IDA
GO:0006886 "intracellular protein transport" evidence=IEA
ZFIN|ZDB-GENE-030131-9810 tomm22 "translocase of outer mitochondrial membrane 22 homolog (yeast)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NLW3 TOMM22 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A6QPI6 TOMM22 "Mitochondrial import receptor subunit TOM22 homolog" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RKA9 TOMM22 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NS69 TOMM22 "Mitochondrial import receptor subunit TOM22 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SLC2 TOMM22 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:2450248 Tomm22 "translocase of outer mitochondrial membrane 22 homolog (yeast)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1303260 Tomm22 "translocase of outer mitochondrial membrane 22 homolog (yeast)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9NTE2 LOC100855486 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 202
KOG4111|consensus136 99.97
PF04281137 Tom22: Mitochondrial import receptor subunit Tom22 99.88
TIGR00986145 3a0801s05tom22 mitochondrial import receptor subun 99.82
PF04281137 Tom22: Mitochondrial import receptor subunit Tom22 91.37
>KOG4111|consensus Back     alignment and domain information
Probab=99.97  E-value=4.6e-33  Score=224.72  Aligned_cols=98  Identities=24%  Similarity=0.332  Sum_probs=88.0

Q ss_pred             ChhHHHHHhhhhhhcccccCCCcccccCchhhhccccceEE--eeeehhhhhcccceeehhhhhHHHhhhhhhhhhhhHh
Q psy72            13 STSSVMKNLKGSALWNGEQGRSSLDNSTPKESYSAAGEIFL--IKVPISFYSFARTSTWLIATSATVALLPIVFESQRFE   90 (202)
Q Consensus        13 ~~~~~~~~t~gERLWgLEMfPesLtEMFPe~VRSAAgatfs--v~vvKkLYsFSrsAlWI~~TSfmILvlPVIFEtER~Q   90 (202)
                      +.++--.||+-||+|||       +||||+..|++++.+++  ++++||+|+|||+++||++|||||||+|||||+||+|
T Consensus        35 ~dd~e~dETi~eRi~gL-------kEivp~g~R~~i~~~~~~av~~~kk~~~fsg~a~Wi~tTt~lIL~vP~i~e~E~~q  107 (136)
T KOG4111|consen   35 GDDSEEDETILERIWGL-------KEIVPQGRRSAIGATAGDAVFVVKKLYSFSGKAAWIATTTFLILVVPLIFETEREQ  107 (136)
T ss_pred             ccCCCcchhHHHHHHhh-------HhhcchhhhhhhhhcchhHHHHHHHHHHhccchhHHHHHHHHHHHHHHHHHHHHHH
Confidence            34455789999999999       78888888889887776  8999999999999999999999999999999999999


Q ss_pred             HHHHHHhhhhhhhcCCCccchhhcccCCCCC
Q psy72            91 VQEMQRNQQKQWSTRPFSWLIFAFQGVNFEN  121 (202)
Q Consensus        91 MEE~Q~qQQRQiLLGP~aa~~~A~sG~~~~~  121 (202)
                      |++.|.+||||+||||++    |++|+..+.
T Consensus       108 ~~~e~e~Qq~q~ll~p~~----~~q~~~~~a  134 (136)
T KOG4111|consen  108 QLQEQEKQQRQQLLAPNV----AAQGGKPGA  134 (136)
T ss_pred             HHhHHHHHHHHHhCCCcc----cccCCCCCC
Confidence            999999999999999999    777765543



>PF04281 Tom22: Mitochondrial import receptor subunit Tom22 ; InterPro: IPR005683 The mitochondrial protein translocase family, which is responsible for movement of nuclear encoded pre-proteins into mitochondria, is very complex with at least 19 components Back     alignment and domain information
>TIGR00986 3a0801s05tom22 mitochondrial import receptor subunit Tom22 Back     alignment and domain information
>PF04281 Tom22: Mitochondrial import receptor subunit Tom22 ; InterPro: IPR005683 The mitochondrial protein translocase family, which is responsible for movement of nuclear encoded pre-proteins into mitochondria, is very complex with at least 19 components Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00