Psyllid ID: psy7710


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470---
MSSSQSPTLYDMVVVGGGIVGVATARELKLKYPKMKTCLVEKEKEFFSMSSSQSPALYDVVVVGGGIVGVATARELKLNYPKMKICLVEKEKELGMHQTGHNSGVVHAGIYYKPGTLKAKLCVEGMNLAYEYFDKRNIPYKKCGKLIVALNEQLEPLHDLYERSIQNNVKDVRLVSAEEIKTIEPYCKGVKAIHSPNTGIVDWGLVTRVMGEEFCELGGEIRLNQQVESFKENPESVTISTKQGDHLESSYALVCAGLQADEMALKSGCSLEPAIVPFRGEYLLLNPAKQHLVRGNIYPVPDPNFPFLGVHFTPRMDGSVWLGPNAVLAFKKEGYRWRDFSVRELFSTLRYPGFWRLGLKYTRYGSKEMIMSWFPSMRVNELKQYIEEIEAGDIQRGPSGVRAQALSSSGDLVDDFGVKAIHSPHTGIVDWGLVTRVMGEEFCELGGEIRLNQQVESFKENPEMVDSMNEYEF
ccccccccEEEEEEEcccEEEccHHHHHHHHcccccccHHHHcccccccccccccccccEEEEcccHHHHHHHHHHHHcccccEEEEEccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccEEEEEccccHHHHHHHHHHHHHcccccEEEccHHHHHHHcccccEEEEEEccccEEEcHHHHHHHHHHHHHHcccEEEcccEEEEEEEcccEEEEEEccccEEEEcEEEEcccccHHHHHHHccccccccEEcccEEEEEEcccccccccccEEccccccccccEEEEEcccccEEEEccccEEcccccccccccccHHHHHHHHccccHHHHccccccccHHHHHHHHcHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccHHHHHHcccccccccccccccc
cccccccccEcEEEEcccHHHHHHHHHHHccccccccccccccccccccccccccccEcEEEEccEHHHHHHHHHHHHHccccEEEEEEccccHHHHcccccccEEEEEEEEccccHHHHHHHHHHHHHHHHHHHccccccHccEEEEEccHHHHHHHHHHHHHHHcccccEEEccHHHHHHHccccEEEEEEEccccccccHHHHHHHHHHHHHHcccEEEEcEEEEEEEEccccEEEEEccccEEEEEEEEEcccHHHHHHHHHcccccccEEEEccccEEEccHHHccHEcccEcccccccccEEEEEEcccccccEEEcHHHHHHHHHcccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHcccccccEEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHHcccEEEEEEEEcccccccccccccccccc
msssqsptlyDMVVVGGGIVGVATARELklkypkmktCLVEKEKEffsmsssqspalyDVVVVGGGIVGVATARELKLNYPKMKICLVEKEkelgmhqtghnsgvvhagiyykpgtlkAKLCVEGMNLAYeyfdkrnipykkCGKLIVALNEQLEPLHDLYERSIQNNVKDVRLVSAEEIKtiepyckgvkaihspntgivdWGLVTRVMGEEFCELGGEIRLNQQVEsfkenpesvtistkqgdhlESSYALVCAGLQADEMALksgcslepaivpfrgeylllnpakqhlvrgniypvpdpnfpflgvhftprmdgsvwlgpnavlafkkegyrwrdfSVRELFStlrypgfwrlGLKYTRYGSKEMIMSWFPSMRVNELKQYIEEIeagdiqrgpsgvraqalsssgdlvddfgvkaihsphtgivdWGLVTRVMGEEFCELGGEIRLNQQvesfkenpemvdsmneyef
msssqsptlyDMVVVGGGIVGVATARELKLKYPKMKTCLVEKEKEFfsmsssqspALYDVVVVGGGIVGVATarelklnypKMKICLVEKEKELGMHQTGHNSGVVHAGIYYKPGTLKAKLCVEGMNLAYEYFDKRNIPYKKCGKLIVALNEQLEPLHDLYERSIQNNVKDVRLVSAEEIKTIepyckgvkaihspntgiVDWGLVTRVMGEEFCELGGEIRLNQQVESFKENPESVTISTKQGDHLESSYALVCAGLQADEMALKSGCSLEPAIVPFRGEYLLLNPAKQHLVRGNIYPVPDPNFPFLGVHFTPRMDGSVWLGPNAVLAFKKEGYRWRDFSVRELfstlrypgfwrlGLKYTRYGSKEMIMSWFPSMRVNELKQYIEEIEagdiqrgpsGVRAQALSSSGDLVDDFGVKAihsphtgivdwGLVTRVMGEEFCELGGEirlnqqvesfkenpemvdsmneyef
MSSSQSPTLYDMvvvgggivgvATARELKLKYPKMKTCLVEKEKEFFsmsssqsPALYDvvvvgggivgvATARELKLNYPKMKICLVEKEKELGMHQTGHNSGVVHAGIYYKPGTLKAKLCVEGMNLAYEYFDKRNIPYKKCGKLIVALNEQLEPLHDLYERSIQNNVKDVRLVSAEEIKTIEPYCKGVKAIHSPNTGIVDWGLVTRVMGEEFCELGGEIRLNQQVESFKENPESVTISTKQGDHLESSYALVCAGLQADEMALKSGCSLEPAIVPFRGEYLLLNPAKQHLVRGNIYPVPDPNFPFLGVHFTPRMDGSVWLGPNAVLAFKKEGYRWRDFSVRELFSTLRYPGFWRLGLKYTRYGSKEMIMSWFPSMRVNELKQYIEEIEAGDIQRGPSGVRAQALSSSGDLVDDFGVKAIHSPHTGIVDWGLVTRVMGEEFCELGGEIRLNQQVESFKENPEMVDSMNEYEF
********LYDMVVVGGGIVGVATARELKLKYPKMKTCLVEKEKEFF*******PALYDVVVVGGGIVGVATARELKLNYPKMKICLVEKEKELGMHQTGHNSGVVHAGIYYKPGTLKAKLCVEGMNLAYEYFDKRNIPYKKCGKLIVALNEQLEPLHDLYERSIQNNVKDVRLVSAEEIKTIEPYCKGVKAIHSPNTGIVDWGLVTRVMGEEFCELGGEIRLNQ*********************LESSYALVCAGLQADEMALKSGCSLEPAIVPFRGEYLLLNPAKQHLVRGNIYPVPDPNFPFLGVHFTPRMDGSVWLGPNAVLAFKKEGYRWRDFSVRELFSTLRYPGFWRLGLKYTRYGSKEMIMSWFPSMRVNELKQYIEEIEAGDI****************DLVDDFGVKAIHSPHTGIVDWGLVTRVMGEEFCELGGEIRLN*********************
*****SP*LYDMVVVGGGIVGVATARELK***************************LYDVVVVGGGIVGVATARELKLNYPKMKICLVEKEKELGMHQTGHNSGVVHAGIYYKPGTLKAKLCVEGMNLAYEYFDKRNIPYKKCGKLIVALNEQLEPLHDLYERSIQNNVKDVRLVSAEEIKTIEPYCKGVKAIHSPNTGIVDWGLVTRVMGEEFCELGGEIRLNQQVESFKENPESVTISTKQGDHLESSYALVCAGLQADEMALKSGCSLEPAIVPFRGEYLLLNPAKQHLVRGNIYPVPDPNFPFLGVHFTPRMDGSVWLGPNAVLAFKKEGYRWRDFSVRELFSTLRYPGFWRLGLKYTRYGSKEMIMSWFPSMRVNELKQYIEEIEAGDIQRGPSGVRAQALSSSGDLVDDFGVKAIHSPHTGIVDWGLVTRVMGEEFCELGGEIRLNQQVE*****************
MSSSQSPTLYDMVVVGGGIVGVATARELKLKYPKMKTCLVEKEKEFFSMSSSQSPALYDVVVVGGGIVGVATARELKLNYPKMKICLVEKEKELGMHQTGHNSGVVHAGIYYKPGTLKAKLCVEGMNLAYEYFDKRNIPYKKCGKLIVALNEQLEPLHDLYERSIQNNVKDVRLVSAEEIKTIEPYCKGVKAIHSPNTGIVDWGLVTRVMGEEFCELGGEIRLNQQVE**************QGDHLESSYALVCAGLQADEMALKSGCSLEPAIVPFRGEYLLLNPAKQHLVRGNIYPVPDPNFPFLGVHFTPRMDGSVWLGPNAVLAFKKEGYRWRDFSVRELFSTLRYPGFWRLGLKYTRYGSKEMIMSWFPSMRVNELKQYIEEIEAGDIQRGPSGVRAQALSSSGDLVDDFGVKAIHSPHTGIVDWGLVTRVMGEEFCELGGEIRLNQQVESFKENPEMVDSMNEYEF
*****SPTLYDMVVVGGGIVGVATARELKLKYPKMKTCLVEKEK*F**M**SQSPALYDVVVVGGGIVGVATARELKLNYPKMKICLVEKEKELGMHQTGHNSGVVHAGIYYKPGTLKAKLCVEGMNLAYEYFDKRNIPYKKCGKLIVALNEQLEPLHDLYERSIQNNVKDVRLVSAEEIKTIEPYCKGVKAIHSPNTGIVDWGLVTRVMGEEFCELGGEIRLNQQVESFKENPESVTISTKQGDHLESSYALVCAGLQADEMALKSGCSLEPAIVPFRGEYLLLNPAKQHLVRGNIYPVPDPNFPFLGVHFTPRMDGSVWLGPNAVLAFKKEGYRWRDFSVRELFSTLRYPGFWRLGLKYTRYGSKEMIMSWFPSMRVNELKQYIEEIEAGDIQRGPSGVRAQALSSSGDLVDDFGVKAIHSPHTGIVDWGLVTRVMGEEFCELGGEIRLNQQVESFK**************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSSQSPTLYDMVVVGGGIVGVATARELKLKYPKMKTCLVEKEKEFFSMSSSQSPALYDVVVVGGGIVGVATARELKLNYPKMKICLVEKEKELGMHQTGHNSGVVHAGIYYKPGTLKAKLCVEGMNLAYEYFDKRNIPYKKCGKLIVALNEQLEPLHDLYERSIQNNVKDVRLVSAEEIKTIEPYCKGVKAIHSPNTGIVDWGLVTRVMGEEFCELGGEIRLNQQVESFKENPESVTISTKQGDHLESSYALVCAGLQADEMALKSGCSLEPAIVPFRGEYLLLNPAKQHLVRGNIYPVPDPNFPFLGVHFTPRMDGSVWLGPNAVLAFKKEGYRWRDFSVRELFSTLRYPGFWRLGLKYTRYGSKEMIMSWFPSMRVNELKQYIEEIEAGDIQRGPSGVRAQALSSSGDLVDDFGVKAIHSPHTGIVDWGLVTRVMGEEFCELGGEIRLNQQVESFKENPEMVDSMNEYEF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query473 2.2.26 [Sep-21-2011]
A7SMW7456 L-2-hydroxyglutarate dehy N/A N/A 0.758 0.787 0.552 1e-117
A8X2R1434 L-2-hydroxyglutarate dehy N/A N/A 0.756 0.824 0.546 1e-116
Q9N4Z0433 L-2-hydroxyglutarate dehy yes N/A 0.758 0.829 0.532 1e-114
A7MBI3463 L-2-hydroxyglutarate dehy yes N/A 0.733 0.749 0.501 1e-101
Q9H9P8463 L-2-hydroxyglutarate dehy yes N/A 0.775 0.792 0.514 1e-101
Q91YP0464 L-2-hydroxyglutarate dehy yes N/A 0.733 0.747 0.504 1e-101
Q55GI5446 L-2-hydroxyglutarate dehy yes N/A 0.809 0.858 0.422 1e-92
Q5R9N7419 L-2-hydroxyglutarate dehy yes N/A 0.682 0.770 0.472 2e-88
P37339422 L-2-hydroxyglutarate oxid N/A N/A 0.754 0.845 0.435 4e-75
P75063384 Uncharacterized protein M yes N/A 0.577 0.710 0.297 7e-20
>sp|A7SMW7|L2HDH_NEMVE L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Nematostella vectensis GN=v1g172254 PE=3 SV=1 Back     alignment and function desciption
 Score =  422 bits (1085), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 206/373 (55%), Positives = 262/373 (70%), Gaps = 14/373 (3%)

Query: 58  YDVVVVGGGIVGVATARELKLNYPKMKICLVEKEKELGMHQTGHNSGVVHAGIYYKPGTL 117
           YDV +VGGGIVG+ATAREL L +PK+  C++EKEKEL MHQ+GHNSGV+H GIYY PG+L
Sbjct: 40  YDVAIVGGGIVGLATARELILRHPKLTFCVLEKEKELSMHQSGHNSGVIHCGIYYTPGSL 99

Query: 118 KAKLCVEGMNLAYEYFDKRNIPYKKCGKLIVALNEQLEPL-HDLYERSIQNNVKDVRLVS 176
           KAKLCV+G++L Y+Y D+ NIPYKKCGKLIVA+ ++  PL ++LYER  +N VKD+ +V 
Sbjct: 100 KAKLCVQGLDLTYQYCDEHNIPYKKCGKLIVAVEDKEIPLLNNLYERGKKNGVKDLTMVD 159

Query: 177 AEEIKTIEPYCKGVKAIHSPNTGIVDWGLVTRVMGEEFCELGGEIRLNQQVESFKENPES 236
              IK IEP+C+G+ AI SPNTGIVDW  V    G++F + GG+I    +V  FK   ES
Sbjct: 160 KRGIKEIEPHCEGMFAIVSPNTGIVDWAQVALAYGDDFRKGGGDIFTGYEVTDFKCASES 219

Query: 237 -------------VTISTKQGDHLESSYALVCAGLQADEMALKSGCSLEPAIVPFRGEYL 283
                        VT+ +     ++  Y + C GL +D +A KSGC+ EP IVPFRG+YL
Sbjct: 220 GKSQEKEAGLTHPVTVFSNNKQTIKCRYVITCGGLYSDRLAEKSGCNREPRIVPFRGDYL 279

Query: 284 LLNPAKQHLVRGNIYPVPDPNFPFLGVHFTPRMDGSVWLGPNAVLAFKKEGYRWRDFSVR 343
           +L P K HLV+GNIYPVPDPNFPFLGVHFTPRMDGSVWLGPNAVLAF +EGY   D ++R
Sbjct: 280 VLKPEKCHLVKGNIYPVPDPNFPFLGVHFTPRMDGSVWLGPNAVLAFAREGYNLLDINLR 339

Query: 344 ELFSTLRYPGFWRLGLKYTRYGSKEMIMSWFPSMRVNELKQYIEEIEAGDIQRGPSGVRA 403
           +L   L + G  +L  KY  +G  E       + +V +L++YI  + A D+  GPSGVRA
Sbjct: 340 DLADALAFRGLRQLMFKYFSFGVGEYYRGLNHAAQVKQLQKYIPSVTADDVVSGPSGVRA 399

Query: 404 QALSSSGDLVDDF 416
           QAL   G+LVDDF
Sbjct: 400 QALDRDGNLVDDF 412





Nematostella vectensis (taxid: 45351)
EC: 1EC: .EC: 1EC: .EC: 9EC: 9EC: .EC: 2
>sp|A8X2R1|L2HDH_CAEBR L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Caenorhabditis briggsae GN=CBG06643 PE=3 SV=2 Back     alignment and function description
>sp|Q9N4Z0|L2HDH_CAEEL L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Caenorhabditis elegans GN=Y45G12B.3 PE=3 SV=2 Back     alignment and function description
>sp|A7MBI3|L2HDH_BOVIN L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Bos taurus GN=L2HGDH PE=2 SV=1 Back     alignment and function description
>sp|Q9H9P8|L2HDH_HUMAN L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Homo sapiens GN=L2HGDH PE=1 SV=3 Back     alignment and function description
>sp|Q91YP0|L2HDH_MOUSE L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Mus musculus GN=L2hgdh PE=2 SV=1 Back     alignment and function description
>sp|Q55GI5|L2HDH_DICDI L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Dictyostelium discoideum GN=l2hgdh PE=3 SV=1 Back     alignment and function description
>sp|Q5R9N7|L2HDH_PONAB L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Pongo abelii GN=L2HGDH PE=2 SV=1 Back     alignment and function description
>sp|P37339|LHGO_ECOLI L-2-hydroxyglutarate oxidase LhgO OS=Escherichia coli (strain K12) GN=lhgO PE=1 SV=3 Back     alignment and function description
>sp|P75063|Y051_MYCPN Uncharacterized protein MG039 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_051 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query473
321466639462 hypothetical protein DAPPUDRAFT_305386 [ 0.758 0.777 0.601 1e-125
195114986455 GI17168 [Drosophila mojavensis] gi|19391 0.780 0.810 0.603 1e-123
195437853457 GK24330 [Drosophila willistoni] gi|19416 0.775 0.803 0.602 1e-123
195387960468 GJ17673 [Drosophila virilis] gi|19414911 0.758 0.767 0.605 1e-122
195035497452 GH11599 [Drosophila grimshawi] gi|193905 0.758 0.794 0.602 1e-122
24585081455 CG10639 [Drosophila melanogaster] gi|729 0.780 0.810 0.592 1e-121
195484296455 GE12689 [Drosophila yakuba] gi|194176735 0.758 0.789 0.597 1e-121
312381137 590 hypothetical protein AND_06627 [Anophele 0.758 0.608 0.590 1e-121
119112468439 AGAP007868-PA [Anopheles gambiae str. PE 0.758 0.817 0.587 1e-121
194759574453 GF14644 [Drosophila ananassae] gi|190615 0.758 0.792 0.602 1e-121
>gi|321466639|gb|EFX77633.1| hypothetical protein DAPPUDRAFT_305386 [Daphnia pulex] Back     alignment and taxonomy information
 Score =  456 bits (1173), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 223/371 (60%), Positives = 283/371 (76%), Gaps = 12/371 (3%)

Query: 58  YDVVVVGGGIVGVATARELKLNYPKMKICLVEKEKELGMHQTGHNSGVVHAGIYYKPGTL 117
           YD+V+VGGGIVG+ATARE+ + +P MK  +VEKE  L  HQ+GHNSGVVH GIYYKPG+L
Sbjct: 47  YDIVIVGGGIVGMATAREMIMRHPNMKFAVVEKENCLAAHQSGHNSGVVHGGIYYKPGSL 106

Query: 118 KAKLCVEGMNLAYEYFDKRNIPYKKCGKLIVALNEQLEP-LHDLYERSIQNNVKDVRLVS 176
           KAKLCVEG++L+Y+YFD++ IPYKKCGKLIVA+ +Q  P L DLY R IQN V D++++ 
Sbjct: 107 KAKLCVEGLHLSYKYFDEKGIPYKKCGKLIVAVEKQELPRLEDLYNRGIQNGVPDIQMID 166

Query: 177 AEEIKTIEPYCKGVKAIHSPNTGIVDWGLVTRVMGEEFCELGGEIRLNQQVESFK----- 231
             +IK IEPYC+G+KA+ SP+TGIVDWGLVT+  GE+F  LGG+I LN +V+ FK     
Sbjct: 167 GAKIKEIEPYCQGLKAVWSPHTGIVDWGLVTQYYGEDFKALGGDIHLNFEVKDFKVAEES 226

Query: 232 ------ENPESVTISTKQGDHLESSYALVCAGLQADEMALKSGCSLEPAIVPFRGEYLLL 285
                  N + V ++   G  +   Y L C GLQ+D +A  SGCS EP IVPFRGEYLLL
Sbjct: 227 KVKALASNKKGVQVTASNGQSVRCKYVLTCGGLQSDRLAELSGCSREPRIVPFRGEYLLL 286

Query: 286 NPAKQHLVRGNIYPVPDPNFPFLGVHFTPRMDGSVWLGPNAVLAFKKEGYRWRDFSVREL 345
           NP K HLV+GNIYPVPDP FPFLGVHFTPRMDGSVWLGPNAVLA K+EGY W D ++R+L
Sbjct: 287 NPKKTHLVKGNIYPVPDPRFPFLGVHFTPRMDGSVWLGPNAVLALKREGYSWGDINLRDL 346

Query: 346 FSTLRYPGFWRLGLKYTRYGSKEMIMSWFPSMRVNELKQYIEEIEAGDIQRGPSGVRAQA 405
           F +LRY GF +L +K+  +G +E++ S F S+ + EL++YI E+++ DI RGP+GVRAQA
Sbjct: 347 FDSLRYRGFQKLAVKHVAFGLQEIVRSAFISLSLKELQKYIPEVQSSDITRGPAGVRAQA 406

Query: 406 LSSSGDLVDDF 416
           L + G LV+DF
Sbjct: 407 LDADGSLVEDF 417




Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195114986|ref|XP_002002048.1| GI17168 [Drosophila mojavensis] gi|193912623|gb|EDW11490.1| GI17168 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195437853|ref|XP_002066854.1| GK24330 [Drosophila willistoni] gi|194162939|gb|EDW77840.1| GK24330 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195387960|ref|XP_002052660.1| GJ17673 [Drosophila virilis] gi|194149117|gb|EDW64815.1| GJ17673 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195035497|ref|XP_001989214.1| GH11599 [Drosophila grimshawi] gi|193905214|gb|EDW04081.1| GH11599 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|24585081|ref|NP_609923.2| CG10639 [Drosophila melanogaster] gi|7298510|gb|AAF53729.1| CG10639 [Drosophila melanogaster] gi|201065691|gb|ACH92255.1| FI05204p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195484296|ref|XP_002090634.1| GE12689 [Drosophila yakuba] gi|194176735|gb|EDW90346.1| GE12689 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|312381137|gb|EFR26953.1| hypothetical protein AND_06627 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|119112468|ref|XP_317624.2| AGAP007868-PA [Anopheles gambiae str. PEST] gi|116123367|gb|EAA12921.2| AGAP007868-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|194759574|ref|XP_001962022.1| GF14644 [Drosophila ananassae] gi|190615719|gb|EDV31243.1| GF14644 [Drosophila ananassae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query473
FB|FBgn0032729455 CG10639 [Drosophila melanogast 0.758 0.789 0.572 2.6e-117
WB|WBGene00021564433 Y45G12B.3 [Caenorhabditis eleg 0.758 0.829 0.510 2.4e-106
ZFIN|ZDB-GENE-090319-6452 l2hgdh "L-2-hydroxyglutarate d 0.731 0.765 0.525 4e-104
UNIPROTKB|F1NBV3452 L2HGDH "Uncharacterized protei 0.731 0.765 0.522 4.6e-101
UNIPROTKB|F1SHX9463 L2HGDH "Uncharacterized protei 0.731 0.747 0.513 1.8e-97
RGD|1306250463 L2hgdh "L-2-hydroxyglutarate d 0.731 0.747 0.502 3.7e-97
MGI|MGI:2384968464 L2hgdh "L-2-hydroxyglutarate d 0.731 0.745 0.505 7.7e-97
UNIPROTKB|Q9H9P8463 L2HGDH "L-2-hydroxyglutarate d 0.731 0.747 0.511 1.3e-96
UNIPROTKB|A7MBI3463 L2HGDH "L-2-hydroxyglutarate d 0.731 0.747 0.502 6.9e-96
UNIPROTKB|E2RRS4674 L2HGDH "Uncharacterized protei 0.731 0.513 0.511 3e-95
FB|FBgn0032729 CG10639 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1109 (395.4 bits), Expect = 2.6e-117, Sum P(2) = 2.6e-117
 Identities = 209/365 (57%), Positives = 265/365 (72%)

Query:    58 YDXXXXXXXXXXXATARELKLNYPKMKICLVEKEKELGMHQTGHNSGVVHAGIYYKPGTL 117
             YD           A+ARE+ L +P +K+ ++EKE +L  HQ+GHNSGV+HAGIYYKPGTL
Sbjct:    43 YDLVVVGGGIVGAASAREIVLRHPSLKVAVLEKECKLAKHQSGHNSGVIHAGIYYKPGTL 102

Query:   118 KAKLCVEGMNLAYEYFDKRNIPYKKCGKLIVALNE-QLEPLHDLYERSIQNNVKDVRLVS 176
             KA+LCVEGM+LAY Y D++ IPYKK GKLIVA +E +++ L DL +R I NNV D+R++ 
Sbjct:   103 KARLCVEGMHLAYAYLDEKKIPYKKTGKLIVATDEKEVKLLKDLEKRGIANNVPDLRMIE 162

Query:   177 AEEIKTIEPYCKGVKAIHSPNTGIVDWGLVTRVMGEEFCELGGEIRLNQQVESFKENPES 236
               EI+ IEPYC+GV A+HSP+TGIVDWGLVT   G++F + GG+I L+  V  F E  E 
Sbjct:   163 GSEIQEIEPYCQGVMALHSPHTGIVDWGLVTEHYGQDFKQCGGDIYLDFNVSKFTETKEG 222

Query:   237 ----VTI-STKQGDHLESSYALVCAGLQADEMALKSGCSLEPAIVPFRGEYLLLNPAKQH 291
                 VTI   K G  + +   L C GLQ+D +A K+GC  +P IVPFRGEYLLL   KQH
Sbjct:   223 TDYPVTIHGAKPGQTVRTKNVLTCGGLQSDLLAEKTGCPRDPRIVPFRGEYLLLTKEKQH 282

Query:   292 LVRGNIYPVPDPNFPFLGVHFTPRMDGSVWLGPNAVLAFKKEGYRWRDFSVRELFSTLRY 351
             +V+GNIYPVPDP FPFLGVHFTPRMDGS+WLGPNAVLA K+EGY W D ++ ELF  LRY
Sbjct:   283 MVKGNIYPVPDPRFPFLGVHFTPRMDGSIWLGPNAVLALKREGYTWGDINLFELFDALRY 342

Query:   352 PGFWRLGLKYTRYGSKEMIMSWFPSMRVNELKQYIEEIEAGDIQRGPSGVRAQALSSSGD 411
             PGF ++  KY  +G  EM  SWF ++++  L++YI +I   DIQRGP+GVRAQA+   G+
Sbjct:   343 PGFVKMASKYIGFGLSEMSKSWFINLQIKALQKYIPDITEYDIQRGPAGVRAQAMDLDGN 402

Query:   412 LVDDF 416
             LVDDF
Sbjct:   403 LVDDF 407


GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0005811 "lipid particle" evidence=IDA
WB|WBGene00021564 Y45G12B.3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-090319-6 l2hgdh "L-2-hydroxyglutarate dehydrogenase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NBV3 L2HGDH "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1SHX9 L2HGDH "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1306250 L2hgdh "L-2-hydroxyglutarate dehydrogenase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2384968 L2hgdh "L-2-hydroxyglutarate dehydrogenase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H9P8 L2HGDH "L-2-hydroxyglutarate dehydrogenase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A7MBI3 L2HGDH "L-2-hydroxyglutarate dehydrogenase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RRS4 L2HGDH "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q55GI5L2HDH_DICDI1, ., 1, ., 9, 9, ., 20.42250.80970.8587yesN/A
Q91YP0L2HDH_MOUSE1, ., 1, ., 9, 9, ., 20.50410.73360.7478yesN/A
Q9N4Z0L2HDH_CAEEL1, ., 1, ., 9, 9, ., 20.53290.75890.8290yesN/A
A7MBI3L2HDH_BOVIN1, ., 1, ., 9, 9, ., 20.50130.73360.7494yesN/A
Q9H9P8L2HDH_HUMAN1, ., 1, ., 9, 9, ., 20.51450.77580.7926yesN/A
Q5R9N7L2HDH_PONAB1, ., 1, ., 9, 9, ., 20.47220.68280.7708yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.990.921
4th Layer1.1.99.20.914

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query473
PRK11728393 PRK11728, PRK11728, hydroxyglutarate oxidase; Prov 0.0
COG0579429 COG0579, COG0579, Predicted dehydrogenase [General 1e-108
pfam01266234 pfam01266, DAO, FAD dependent oxidoreductase 6e-46
COG0665387 COG0665, DadA, Glycine/D-amino acid oxidases (deam 4e-28
PRK11728 393 PRK11728, PRK11728, hydroxyglutarate oxidase; Prov 6e-12
PTZ00383497 PTZ00383, PTZ00383, malate:quinone oxidoreductase; 1e-09
TIGR02352337 TIGR02352, thiamin_ThiO, glycine oxidase ThiO 1e-06
COG0578 532 COG0578, GlpA, Glycerol-3-phosphate dehydrogenase 2e-06
COG0579 429 COG0579, COG0579, Predicted dehydrogenase [General 1e-05
pfam01266234 pfam01266, DAO, FAD dependent oxidoreductase 3e-04
COG0644396 COG0644, FixC, Dehydrogenases (flavoproteins) [Ene 5e-04
TIGR01320483 TIGR01320, mal_quin_oxido, malate:quinone-oxidored 8e-04
TIGR01988387 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hyd 0.002
TIGR01373407 TIGR01373, soxB, sarcosine oxidase, beta subunit f 0.002
COG0654387 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydrox 0.002
COG0578532 COG0578, GlpA, Glycerol-3-phosphate dehydrogenase 0.003
COG1232444 COG1232, HemY, Protoporphyrinogen oxidase [Coenzym 0.004
>gnl|CDD|183292 PRK11728, PRK11728, hydroxyglutarate oxidase; Provisional Back     alignment and domain information
 Score =  523 bits (1350), Expect = 0.0
 Identities = 178/362 (49%), Positives = 235/362 (64%), Gaps = 3/362 (0%)

Query: 56  ALYDVVVVGGGIVGVATARELKLNYPKMKICLVEKEKELGMHQTGHNSGVVHAGIYYKPG 115
           A+YD V++GGGIVG++TA +L+  YP  +I ++EKE     HQTGHNSGV+HAG+YY PG
Sbjct: 1   AMYDFVIIGGGIVGLSTAMQLQERYPGARIAVLEKESGPARHQTGHNSGVIHAGVYYTPG 60

Query: 116 TLKAKLCVEGMNLAYEYFDKRNIPYKKCGKLIVALNEQ-LEPLHDLYERSIQNNVKDVRL 174
           +LKA+ C  G      + D+  IPY++CGKL+VA +E  LE +  LYER+  N + +V  
Sbjct: 61  SLKARFCRRGNEATKAFCDQHGIPYEECGKLLVATSELELERMEALYERARANGI-EVER 119

Query: 175 VSAEEIKTIEPYCKGVKAIHSPNTGIVDWGLVTRVMGEEFCELGGEIRLNQQVESFKENP 234
           + AEE++  EP  +G+ AI  P+TGIVD+  V   M E     GGEIRL  +V +  E+ 
Sbjct: 120 LDAEELREREPNIRGLGAIFVPSTGIVDYRAVAEAMAELIQARGGEIRLGAEVTALDEHA 179

Query: 235 ESVTISTKQGDHLESSYALVCAGLQADEMALKSGCSLEPAIVPFRGEYLLLNPAKQHLVR 294
             V + T QG+  E+   + CAGL +D +A  +G   +  IVPFRGEY  L P K  LV 
Sbjct: 180 NGVVVRTTQGE-YEARTLINCAGLMSDRLAKMAGLEPDFRIVPFRGEYYRLAPEKNQLVN 238

Query: 295 GNIYPVPDPNFPFLGVHFTPRMDGSVWLGPNAVLAFKKEGYRWRDFSVRELFSTLRYPGF 354
             IYPVPDP FPFLGVH T  +DGSV +GPNAVLAFK+EGYR RDFS+R+L   L YPGF
Sbjct: 239 HLIYPVPDPAFPFLGVHLTRMIDGSVTVGPNAVLAFKREGYRKRDFSLRDLLEILTYPGF 298

Query: 355 WRLGLKYTRYGSKEMIMSWFPSMRVNELKQYIEEIEAGDIQRGPSGVRAQALSSSGDLVD 414
           W+L  K+ R G  EM  S   S  +  +++Y   +   D+Q  P+GVRAQA+S  G LVD
Sbjct: 299 WKLAQKHWRSGLGEMKNSLSKSGYLRLVQKYCPSLTLSDLQPYPAGVRAQAVSRDGKLVD 358

Query: 415 DF 416
           DF
Sbjct: 359 DF 360


Length = 393

>gnl|CDD|223652 COG0579, COG0579, Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>gnl|CDD|216400 pfam01266, DAO, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|223737 COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|183292 PRK11728, PRK11728, hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|240393 PTZ00383, PTZ00383, malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|233831 TIGR02352, thiamin_ThiO, glycine oxidase ThiO Back     alignment and domain information
>gnl|CDD|223651 COG0578, GlpA, Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|223652 COG0579, COG0579, Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>gnl|CDD|216400 pfam01266, DAO, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|130387 TIGR01320, mal_quin_oxido, malate:quinone-oxidoreductase Back     alignment and domain information
>gnl|CDD|233671 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>gnl|CDD|233383 TIGR01373, soxB, sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>gnl|CDD|223727 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|223651 COG0578, GlpA, Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|224153 COG1232, HemY, Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 473
KOG2665|consensus453 100.0
PRK11728393 hydroxyglutarate oxidase; Provisional 100.0
COG0579429 Predicted dehydrogenase [General function predicti 100.0
PTZ00383497 malate:quinone oxidoreductase; Provisional 100.0
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 100.0
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 100.0
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 100.0
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 100.0
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 100.0
PRK05257494 malate:quinone oxidoreductase; Validated 100.0
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 100.0
PRK11259376 solA N-methyltryptophan oxidase; Provisional 100.0
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 100.0
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 100.0
PRK13339497 malate:quinone oxidoreductase; Reviewed 100.0
KOG2844|consensus 856 100.0
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 100.0
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 100.0
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 100.0
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 100.0
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 100.0
KOG2853|consensus509 100.0
PLN02464 627 glycerol-3-phosphate dehydrogenase 100.0
PRK13369 502 glycerol-3-phosphate dehydrogenase; Provisional 100.0
PRK12266 508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 99.97
TIGR03377 516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 99.96
COG0578 532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 99.96
KOG2820|consensus399 99.95
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 99.94
KOG3923|consensus342 99.89
KOG0042|consensus 680 99.88
KOG2852|consensus380 99.88
COG2081408 Predicted flavoproteins [General function predicti 99.69
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 99.61
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 99.59
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.57
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 99.54
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 99.54
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 99.51
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 99.49
PRK06481506 fumarate reductase flavoprotein subunit; Validated 99.49
PLN02463447 lycopene beta cyclase 99.47
PLN02697529 lycopene epsilon cyclase 99.46
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 99.45
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 99.44
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 99.44
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 99.44
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 99.43
PRK07121492 hypothetical protein; Validated 99.43
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.41
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 99.41
PRK10157428 putative oxidoreductase FixC; Provisional 99.41
PRK08274466 tricarballylate dehydrogenase; Validated 99.4
PRK06847375 hypothetical protein; Provisional 99.4
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 99.4
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 99.39
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 99.38
PRK06185407 hypothetical protein; Provisional 99.38
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 99.38
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 99.37
PRK08244 493 hypothetical protein; Provisional 99.37
PRK07804 541 L-aspartate oxidase; Provisional 99.37
PRK06184 502 hypothetical protein; Provisional 99.37
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 99.36
PRK06834 488 hypothetical protein; Provisional 99.36
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 99.35
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 99.35
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 99.35
PRK07190 487 hypothetical protein; Provisional 99.34
TIGR00275400 flavoprotein, HI0933 family. The model when search 99.33
PRK08013400 oxidoreductase; Provisional 99.33
PRK10015429 oxidoreductase; Provisional 99.32
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 99.32
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.31
PRK06175433 L-aspartate oxidase; Provisional 99.31
PRK09126392 hypothetical protein; Provisional 99.3
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 99.3
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.3
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 99.29
COG1233487 Phytoene dehydrogenase and related proteins [Secon 99.29
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 99.29
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 99.28
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 99.28
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 99.28
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 99.27
PRK06134581 putative FAD-binding dehydrogenase; Reviewed 99.27
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 99.27
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 99.27
PRK08163396 salicylate hydroxylase; Provisional 99.26
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 99.26
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 99.26
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 99.26
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 99.25
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 99.25
PRK12842574 putative succinate dehydrogenase; Reviewed 99.24
PLN02815 594 L-aspartate oxidase 99.24
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.23
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 99.23
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 99.23
TIGR02730493 carot_isom carotene isomerase. Members of this fam 99.22
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 99.22
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 99.22
PRK12845 564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.22
PLN02172461 flavin-containing monooxygenase FMO GS-OX 99.22
PRK07588391 hypothetical protein; Provisional 99.22
PRK07395 553 L-aspartate oxidase; Provisional 99.22
PRK08275 554 putative oxidoreductase; Provisional 99.21
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.21
PRK06126 545 hypothetical protein; Provisional 99.21
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 99.2
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 99.2
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 99.2
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.2
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 99.19
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 99.19
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 99.19
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 99.19
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 99.18
PRK12844 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.18
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 99.18
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 99.18
PRK06753373 hypothetical protein; Provisional 99.18
PRK08132 547 FAD-dependent oxidoreductase; Provisional 99.17
PRK08071 510 L-aspartate oxidase; Provisional 99.17
PRK07512 513 L-aspartate oxidase; Provisional 99.17
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 99.17
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 99.17
PRK08401466 L-aspartate oxidase; Provisional 99.16
PRK02106560 choline dehydrogenase; Validated 99.15
PRK07233434 hypothetical protein; Provisional 99.15
PRK06996398 hypothetical protein; Provisional 99.14
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 99.13
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 99.13
PRK07045388 putative monooxygenase; Reviewed 99.13
PRK12834 549 putative FAD-binding dehydrogenase; Reviewed 99.13
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 99.13
PRK12839572 hypothetical protein; Provisional 99.13
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.13
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 99.12
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 99.12
PRK05868372 hypothetical protein; Validated 99.12
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 99.12
PRK07236386 hypothetical protein; Provisional 99.12
PLN02661357 Putative thiazole synthesis 99.11
PLN02985514 squalene monooxygenase 99.11
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 99.11
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 99.11
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 99.1
PRK09077 536 L-aspartate oxidase; Provisional 99.09
PRK11445351 putative oxidoreductase; Provisional 99.09
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 99.08
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 99.07
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 99.07
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 99.07
PRK06116450 glutathione reductase; Validated 99.06
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 99.06
PF01134392 GIDA: Glucose inhibited division protein A; InterP 99.05
PRK13977 576 myosin-cross-reactive antigen; Provisional 99.04
COG1231450 Monoamine oxidase [Amino acid transport and metabo 99.03
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 99.03
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 99.02
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 99.02
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 99.02
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 99.02
PRK06475400 salicylate hydroxylase; Provisional 99.01
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 99.01
PRK08294 634 phenol 2-monooxygenase; Provisional 99.0
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 99.0
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 98.99
PLN02676487 polyamine oxidase 98.99
PRK07538413 hypothetical protein; Provisional 98.99
PRK12416463 protoporphyrinogen oxidase; Provisional 98.98
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 98.97
PRK14694468 putative mercuric reductase; Provisional 98.97
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 98.97
PRK07208479 hypothetical protein; Provisional 98.97
PRK09897 534 hypothetical protein; Provisional 98.96
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.95
PRK05976472 dihydrolipoamide dehydrogenase; Validated 98.94
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.94
PRK11883451 protoporphyrinogen oxidase; Reviewed 98.94
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 98.93
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 98.93
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 98.93
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 98.93
COG1053 562 SdhA Succinate dehydrogenase/fumarate reductase, f 98.92
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 98.91
COG0029 518 NadB Aspartate oxidase [Coenzyme metabolism] 98.91
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 98.9
PLN02268435 probable polyamine oxidase 98.9
PLN02568539 polyamine oxidase 98.9
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 98.89
KOG1399|consensus448 98.89
PTZ00058 561 glutathione reductase; Provisional 98.89
PRK06370463 mercuric reductase; Validated 98.89
COG2303542 BetA Choline dehydrogenase and related flavoprotei 98.88
PTZ00367 567 squalene epoxidase; Provisional 98.88
PRK10262321 thioredoxin reductase; Provisional 98.88
PRK14727479 putative mercuric reductase; Provisional 98.87
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.87
PLN02785587 Protein HOTHEAD 98.87
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 98.86
KOG2415|consensus 621 98.86
KOG1298|consensus509 98.84
KOG2614|consensus420 98.83
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 98.83
PRK13748561 putative mercuric reductase; Provisional 98.83
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 98.83
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 98.82
PLN02507499 glutathione reductase 98.82
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 98.81
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 98.81
PLN02612567 phytoene desaturase 98.81
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 98.8
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 98.79
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 98.79
TIGR02053463 MerA mercuric reductase. This model represents the 98.79
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 98.78
PRK06327475 dihydrolipoamide dehydrogenase; Validated 98.78
KOG2404|consensus477 98.77
PLN02546558 glutathione reductase 98.77
PTZ00052499 thioredoxin reductase; Provisional 98.75
PLN02529 738 lysine-specific histone demethylase 1 98.75
PRK07845466 flavoprotein disulfide reductase; Reviewed 98.74
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 98.73
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 98.72
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 98.71
PLN02576496 protoporphyrinogen oxidase 98.69
PRK09564444 coenzyme A disulfide reductase; Reviewed 98.68
PRK14989 847 nitrite reductase subunit NirD; Provisional 98.68
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 98.65
KOG1335|consensus506 98.64
COG2907447 Predicted NAD/FAD-binding protein [General functio 98.64
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 98.64
PRK09564 444 coenzyme A disulfide reductase; Reviewed 98.64
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 98.64
PRK12779 944 putative bifunctional glutamate synthase subunit b 98.62
PRK13512438 coenzyme A disulfide reductase; Provisional 98.62
KOG1238|consensus623 98.62
PTZ00153 659 lipoamide dehydrogenase; Provisional 98.62
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 98.6
PLN02328 808 lysine-specific histone demethylase 1 homolog 98.59
COG3573 552 Predicted oxidoreductase [General function predict 98.59
TIGR02462 544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 98.59
PLN02487569 zeta-carotene desaturase 98.54
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 98.54
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 98.54
PRK06292460 dihydrolipoamide dehydrogenase; Validated 98.54
KOG0685|consensus498 98.53
KOG2960|consensus328 98.5
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 98.5
PRK07846451 mycothione reductase; Reviewed 98.5
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 98.48
KOG0404|consensus322 98.48
PRK13512 438 coenzyme A disulfide reductase; Provisional 98.47
PLN03000 881 amine oxidase 98.47
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 98.47
KOG4254|consensus561 98.46
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 98.45
PLN02976 1713 amine oxidase 98.44
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 98.42
PRK098531019 putative selenate reductase subunit YgfK; Provisio 98.41
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 98.39
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 98.39
PRK07845466 flavoprotein disulfide reductase; Reviewed 98.38
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 98.38
PRK12831464 putative oxidoreductase; Provisional 98.37
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 98.36
PLN02507499 glutathione reductase 98.35
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 98.35
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 98.34
PTZ00318424 NADH dehydrogenase-like protein; Provisional 98.33
PLN02852491 ferredoxin-NADP+ reductase 98.32
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 98.31
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 98.31
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 98.3
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 98.3
PRK05976472 dihydrolipoamide dehydrogenase; Validated 98.3
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 98.3
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 98.29
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 98.29
KOG0029|consensus501 98.28
PTZ00318424 NADH dehydrogenase-like protein; Provisional 98.28
PRK06370463 mercuric reductase; Validated 98.27
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 98.27
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 98.27
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 98.25
PRK06327475 dihydrolipoamide dehydrogenase; Validated 98.23
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 98.22
KOG1336|consensus478 98.22
PRK07846451 mycothione reductase; Reviewed 98.21
COG4529474 Uncharacterized protein conserved in bacteria [Fun 98.2
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 98.16
PRK12770352 putative glutamate synthase subunit beta; Provisio 98.14
KOG1346|consensus659 98.13
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 98.13
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 98.12
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 98.12
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 98.11
PRK14989 847 nitrite reductase subunit NirD; Provisional 98.11
PLN02546558 glutathione reductase 98.1
PRK12814652 putative NADPH-dependent glutamate synthase small 98.09
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 98.09
PTZ00058561 glutathione reductase; Provisional 98.09
KOG2311|consensus 679 98.08
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 98.07
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 98.06
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 98.05
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 98.05
COG3349485 Uncharacterized conserved protein [Function unknow 98.01
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 97.99
PRK05675 570 sdhA succinate dehydrogenase flavoprotein subunit; 97.99
KOG0405|consensus478 97.99
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 97.98
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 97.96
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 97.96
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 97.95
KOG1276|consensus491 97.95
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 97.95
PRK06292460 dihydrolipoamide dehydrogenase; Validated 97.91
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 97.89
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 97.86
PTZ00153659 lipoamide dehydrogenase; Provisional 97.84
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 97.84
PRK10262321 thioredoxin reductase; Provisional 97.8
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 97.8
PRK13984604 putative oxidoreductase; Provisional 97.8
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 97.77
PRK12771564 putative glutamate synthase (NADPH) small subunit; 97.74
PRK12770352 putative glutamate synthase subunit beta; Provisio 97.71
KOG4716|consensus503 97.7
TIGR01816 565 sdhA_forward succinate dehydrogenase, flavoprotein 97.68
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 97.68
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 97.63
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 97.56
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 97.51
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 97.51
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 97.4
PF00996438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 97.38
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 97.37
KOG0405|consensus478 97.35
PTZ00188506 adrenodoxin reductase; Provisional 97.32
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 97.29
PRK06567 1028 putative bifunctional glutamate synthase subunit b 97.24
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 97.23
KOG3855|consensus481 97.19
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in 97.18
KOG1800|consensus468 97.15
PRK12831464 putative oxidoreductase; Provisional 97.15
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 97.06
PLN02172461 flavin-containing monooxygenase FMO GS-OX 97.03
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 96.95
PRK12814652 putative NADPH-dependent glutamate synthase small 96.93
PRK098531019 putative selenate reductase subunit YgfK; Provisio 96.83
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 96.75
KOG3851|consensus446 96.7
KOG1238|consensus 623 96.63
KOG2495|consensus491 96.48
KOG1336|consensus478 96.44
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 96.37
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 96.35
PLN02852491 ferredoxin-NADP+ reductase 96.17
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 96.14
PRK12779944 putative bifunctional glutamate synthase subunit b 96.11
KOG0399|consensus2142 96.0
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 95.92
KOG2665|consensus453 95.72
KOG1439|consensus440 95.44
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 95.38
PRK13984604 putative oxidoreductase; Provisional 95.38
TIGR03385 427 CoA_CoA_reduc CoA-disulfide reductase. Members of 95.34
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 95.23
KOG2755|consensus334 95.1
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 95.04
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 94.98
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 94.95
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 94.93
KOG0029|consensus501 94.92
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 94.9
KOG1346|consensus 659 94.86
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 94.81
PRK14727479 putative mercuric reductase; Provisional 94.79
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 94.66
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 94.63
COG0579429 Predicted dehydrogenase [General function predicti 94.54
COG4716587 Myosin-crossreactive antigen [Function unknown] 94.53
TIGR03467419 HpnE squalene-associated FAD-dependent desaturase. 94.5
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 94.43
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 94.13
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 94.06
PRK13339497 malate:quinone oxidoreductase; Reviewed 94.02
COG0569225 TrkA K+ transport systems, NAD-binding component [ 94.01
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 93.96
KOG4405|consensus 547 93.95
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 93.72
TIGR02053463 MerA mercuric reductase. This model represents the 93.7
PRK12771564 putative glutamate synthase (NADPH) small subunit; 93.69
PRK05708305 2-dehydropantoate 2-reductase; Provisional 93.57
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.57
KOG2495|consensus491 93.49
PRK06249313 2-dehydropantoate 2-reductase; Provisional 93.47
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 93.39
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 93.34
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 93.23
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.16
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.15
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 93.12
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 93.12
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 93.1
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 93.07
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.04
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.97
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 92.96
PRK11728393 hydroxyglutarate oxidase; Provisional 92.87
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 92.84
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.81
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 92.79
PRK02106560 choline dehydrogenase; Validated 92.79
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 92.69
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.68
PLN02353473 probable UDP-glucose 6-dehydrogenase 92.56
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 92.56
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 92.53
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 92.49
PLN02785587 Protein HOTHEAD 92.43
PRK06719157 precorrin-2 dehydrogenase; Validated 92.39
PRK05257494 malate:quinone oxidoreductase; Validated 92.36
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 92.3
PRK06718202 precorrin-2 dehydrogenase; Reviewed 92.27
PRK12921305 2-dehydropantoate 2-reductase; Provisional 92.13
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 92.11
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 91.99
COG5044434 MRS6 RAB proteins geranylgeranyltransferase compon 91.99
PRK08229341 2-dehydropantoate 2-reductase; Provisional 91.94
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 91.87
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 91.8
PRK06116450 glutathione reductase; Validated 91.73
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 91.71
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.54
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.54
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 91.5
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 91.34
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 91.26
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 91.25
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 91.22
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 91.22
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 91.22
PRK15116268 sulfur acceptor protein CsdL; Provisional 91.18
PTZ00383497 malate:quinone oxidoreductase; Provisional 91.11
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.04
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 91.0
PRK13748561 putative mercuric reductase; Provisional 90.98
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 90.98
PTZ00052499 thioredoxin reductase; Provisional 90.98
PTZ00082321 L-lactate dehydrogenase; Provisional 90.93
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 90.8
PRK14694468 putative mercuric reductase; Provisional 90.68
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 90.64
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 90.49
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 90.36
COG2303542 BetA Choline dehydrogenase and related flavoprotei 90.31
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 90.27
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 90.22
KOG2304|consensus298 90.18
PRK11259376 solA N-methyltryptophan oxidase; Provisional 90.15
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 90.14
PRK04148134 hypothetical protein; Provisional 90.1
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 89.97
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 89.92
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 89.88
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 89.8
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 89.68
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 89.56
cd01483143 E1_enzyme_family Superfamily of activating enzymes 89.56
PRK07417279 arogenate dehydrogenase; Reviewed 89.52
PRK12549284 shikimate 5-dehydrogenase; Reviewed 89.48
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 89.42
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 89.37
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 89.08
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 89.02
TIGR02279503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 89.0
PRK06223307 malate dehydrogenase; Reviewed 88.95
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 88.93
PRK10015429 oxidoreductase; Provisional 88.72
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 88.65
PRK065671028 putative bifunctional glutamate synthase subunit b 88.61
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 88.6
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 88.59
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 88.38
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 88.37
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 88.33
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 88.29
PRK08268507 3-hydroxy-acyl-CoA dehydrogenase; Validated 88.16
COG4529474 Uncharacterized protein conserved in bacteria [Fun 88.1
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 88.03
KOG4716|consensus503 88.01
PF13478136 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 87.75
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 87.73
PRK11730715 fadB multifunctional fatty acid oxidation complex 87.64
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 87.64
>KOG2665|consensus Back     alignment and domain information
Probab=100.00  E-value=2.4e-48  Score=340.97  Aligned_cols=370  Identities=55%  Similarity=0.963  Sum_probs=349.8

Q ss_pred             CCcccEEEEcCChHHHHHHHHHHhcCCCCeEEEEeccCcccCcccCCCcceEEeeccCCCchhHHHHHHHhHHHHHHHHH
Q psy7710          55 PALYDVVVVGGGIVGVATARELKLNYPKMKICLVEKEKELGMHQTGHNSGVVHAGIYYKPGTLKAKLCVEGMNLAYEYFD  134 (473)
Q Consensus        55 ~~~~dVvIIGaGi~Gl~~A~~L~~~~~G~~V~viE~~~~~g~~~s~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  134 (473)
                      ..++|+||||||+.|++.|.+|.-+.|+.+|.|+|+...++-..|++|+|.+|+|++|.|+++++++|.++.++.+++++
T Consensus        46 ~~~~D~VvvGgGiVGlAsARel~lrhp~l~V~vleke~~la~hqSghNSgViHaGIYY~P~SLKAklCV~G~~LlY~yc~  125 (453)
T KOG2665|consen   46 KERYDLVVVGGGIVGLASARELSLRHPSLKVAVLEKEKSLAVHQSGHNSGVIHAGIYYKPGSLKAKLCVEGRELLYEYCD  125 (453)
T ss_pred             cccccEEEECCceeehhhhHHHhhcCCCceEEeeehhhhhceeecccccceeeeeeeeCCcccchhhhhccHHHHHHHhh
Confidence            46799999999999999999999998999999999998999999999999999999999999999999999999999999


Q ss_pred             hcCCCCcccCeEEEEeCc-ChhhHHHHHHHHHhCCCCcceeeCHHHHHhhcCCcccceeEecCCccceeHHHHHHHHHHH
Q psy7710         135 KRNIPYKKCGKLIVALNE-QLEPLHDLYERSIQNNVKDVRLVSAEEIKTIEPYCKGVKAIHSPNTGIVDWGLVTRVMGEE  213 (473)
Q Consensus       135 ~~~~~~~~~g~l~~~~~~-~~~~~~~~~~~~~~~g~~~~~~l~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~l~~~  213 (473)
                      +..+++.+.|.+.++... +...++.+++...++++++.++++..++.+++|......++++|..|.+|...++..+.+.
T Consensus       126 e~~IpyKk~GKLIVAt~~~EiprLd~L~~~g~qN~v~glrmieg~ei~~~EP~crgvkAl~sPhtGIvD~~~v~ls~~ed  205 (453)
T KOG2665|consen  126 EKKIPYKKTGKLIVATESEEIPRLDALMHRGTQNGVPGLRMIEGSEIMEMEPYCRGVKALLSPHTGIVDWGSVTLSFGED  205 (453)
T ss_pred             hcCCChhhcceEEEEeChhhcchHHHHHHhhhhcCCCCeeeeccchhhhcChhhhhhhhhcCCCcceeehHHHHHHHHHH
Confidence            999999999999999999 9999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHcCcEEEeCceEEEEEEcCCe-----EEEEcCCCcEEEcCEEEEcCCcChHHHHHhcCCCCCCceeeeeeEEEEeCcC
Q psy7710         214 FCELGGEIRLNQQVESFKENPES-----VTISTKQGDHLESSYALVCAGLQADEMALKSGCSLEPAIVPFRGEYLLLNPA  288 (473)
Q Consensus       214 ~~~~Gv~i~~~~~V~~i~~~~~~-----v~v~~~~g~~i~ad~VV~aaG~~s~~l~~~~g~~~~~~~~p~~g~~~~~~~~  288 (473)
                      ++..|.++.+|-++..+..++..     +.|....+++++++.||-|+|..++.+....|++.++.+.|.+|.++.+.+.
T Consensus       206 F~~~gg~i~~n~~l~g~~~n~~~~~~Ypivv~ngk~ee~r~~~~vtc~gl~sdr~aa~sgc~~dPriVpfrG~ylll~~e  285 (453)
T KOG2665|consen  206 FDFMGGRIYTNFRLQGIAQNKEATFSYPIVVLNGKGEEKRTKNVVTCAGLQSDRCAALSGCELDPRIVPFRGEYLLLKPE  285 (453)
T ss_pred             HHHhcccccccceeccchhccCCCCCCceEEecCccceeEEeEEEEeccccHhHHHHHhCCCCCCeeeeccchhhhcChH
Confidence            99999999999999999876542     4566666789999999999999999999999999999999999999999999


Q ss_pred             cccCcccccccCCCCCCCccEEEEecCCCCeEEECCCccccccccCcccccchhHHHhhhccCCcchhccchhhhhchHH
Q psy7710         289 KQHLVRGNIYPVPDPNFPFLGVHFTPRMDGSVWLGPNAVLAFKKEGYRWRDFSVRELFSTLRYPGFWRLGLKYTRYGSKE  368 (473)
Q Consensus       289 ~~~~~~~~~~~~~~~~~~~~~~~~~p~~~g~~~iG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  368 (473)
                      +...+++.+||.|++++|+.|+++.|+.+|.+++|+.+...+++++|.+.++++.++.+.+++.++.++.++++.+++.+
T Consensus       286 k~h~vk~niyPvpd~RFpflGvhftPrm~g~iwlgpnavLa~kregy~~g~i~~~~~~e~i~~sg~~k~~~k~f~ygv~e  365 (453)
T KOG2665|consen  286 KLHLVKGNIYPVPDPRFPFLGVHFTPRMDGSIWLGPNAVLAVKREGYLNGDISFGDLVEWIEYSGDTKLASKKFDYGVNE  365 (453)
T ss_pred             HhccccCceeeCCCCCCccccccccCcCCCceecCCCceEEEEEEeeccccccccchhhheecCchHHHHHhhcCcccch
Confidence            88889999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhhcchhHHHHHhhcccCCCCCCcccCCCeeceEeeCCCCccccccceeeeecCC
Q psy7710         369 MIMSWFPSMRVNELKQYIEEIEAGDIQRGPSGVRAQALSSSGDLVDDFGVKAIHSPH  425 (473)
Q Consensus       369 ~~~~~~~~~~~~~~~~~~P~l~~~~i~~~w~G~rp~~~t~d~~p~~g~~~~~g~~~~  425 (473)
                      +....|....+..+++++|+|.+.+|.+..+|+|.+.++.||..+++|.+..| .+|
T Consensus       366 ~~k~~f~~aqvk~lqkyiPdlk~~di~rGpaGvRaqald~~gnlv~DFVfd~g-~g~  421 (453)
T KOG2665|consen  366 MYKEKFIAAQVKELQKYIPDLKDSDIERGPAGVRAQALDGDGNLVDDFVFDGG-EGH  421 (453)
T ss_pred             HhhhhhhhhhhHHHHHhCccccccccccCcccccchhccCCCCCchheEEecC-ccc
Confidence            99999999999999999999999999999999998888999998999988876 444



>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>KOG2844|consensus Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>KOG2853|consensus Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>KOG2820|consensus Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>KOG3923|consensus Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information
>KOG2852|consensus Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>KOG2415|consensus Back     alignment and domain information
>KOG1298|consensus Back     alignment and domain information
>KOG2614|consensus Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>KOG2404|consensus Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>KOG1238|consensus Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>KOG0685|consensus Back     alignment and domain information
>KOG2960|consensus Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0404|consensus Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>KOG4254|consensus Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>KOG0029|consensus Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>KOG1336|consensus Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>KOG1346|consensus Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>KOG2311|consensus Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG0405|consensus Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>KOG1276|consensus Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>KOG4716|consensus Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>KOG0405|consensus Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>KOG3855|consensus Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1800|consensus Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>KOG3851|consensus Back     alignment and domain information
>KOG1238|consensus Back     alignment and domain information
>KOG2495|consensus Back     alignment and domain information
>KOG1336|consensus Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>KOG0399|consensus Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2665|consensus Back     alignment and domain information
>KOG1439|consensus Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>KOG2755|consensus Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>KOG0029|consensus Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>KOG1346|consensus Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>COG4716 Myosin-crossreactive antigen [Function unknown] Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG4405|consensus Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG2495|consensus Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>KOG2304|consensus Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>KOG4716|consensus Back     alignment and domain information
>PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query473
3dme_A369 Crystal Structure Of Conserved Exported Protein Fro 3e-21
>pdb|3DME|A Chain A, Crystal Structure Of Conserved Exported Protein From Bordetella Pertussis. Northeast Structural Genomics Target Ber141 Length = 369 Back     alignment and structure

Iteration: 1

Score = 100 bits (248), Expect = 3e-21, Method: Compositional matrix adjust. Identities = 79/263 (30%), Positives = 124/263 (47%), Gaps = 15/263 (5%) Query: 71 ATARELKLNYPKMKICLVEKEKELGMHQTGHNSGVVHAGIYYKPGTLKAKLCVEGMNLAY 130 A AR L ++ + E + +G + NS V+HAGIYY +LKA+LCV G +L Y Sbjct: 18 AIARALAAG--GHEVLVAEAAEGIGTGTSSRNSEVIHAGIYYPADSLKARLCVRGKHLLY 75 Query: 131 EYFDKRNIPYKKCGKLIVALNE-QLEPLHDLYERSIQNNVKDVRLVSAEEIKTIEPYCKG 189 EY R +P+++ GKLIVA ++ + L + R+ N V D++ + + +EP Sbjct: 76 EYCAARGVPHQRLGKLIVATSDAEASQLDSIARRAGANGVDDLQHIDGAAARRLEPALHC 135 Query: 190 VKAIHSPNTGIVD-WGLVTRVMGEEFCELGGEIRLNQQVESFKENPES---VTISTKQGD 245 A+ SP+TGIVD L+ G+ + G ++ + + + + PE + + Sbjct: 136 TAALVSPSTGIVDSHALMLAYQGDAESD-GAQLVFHTPLIAGRVRPEGGFELDFGGAEPM 194 Query: 246 HLESSYALVCAGLQADEMALKSGCSLEPAIVP---FRGEYLLLNPAKQHLVRGNIYPVPD 302 L + AGL A +A + +I P +G Y L A + IYPV Sbjct: 195 TLSCRVLINAAGLHAPGLARRIEGIPRDSIPPEYLCKGSYFTL--AGRAPFSRLIYPV-- 250 Query: 303 PNFPFLGVHFTPRMDGSVWLGPN 325 P LGVH T + G GP+ Sbjct: 251 PQHAGLGVHLTLDLGGQAKFGPD 273

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query473
3dme_A369 Conserved exported protein; structural genomics, P 1e-143
3dme_A 369 Conserved exported protein; structural genomics, P 7e-11
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 5e-34
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 2e-27
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 1e-23
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 1e-22
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 2e-21
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 3e-20
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 2e-19
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 6e-19
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 5e-16
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 9e-15
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 7e-13
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 4e-10
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 3e-04
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 5e-09
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 9e-05
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 1e-08
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 2e-08
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 1e-05
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 3e-05
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 2e-04
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 4e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
3utf_A513 UDP-galactopyranose mutase; nucleotide binding, fl 5e-04
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 5e-04
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 6e-04
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 9e-04
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Length = 369 Back     alignment and structure
 Score =  414 bits (1066), Expect = e-143
 Identities = 92/366 (25%), Positives = 148/366 (40%), Gaps = 48/366 (13%)

Query: 58  YDVVVVGGGIVGVATARELKLNYPKMKICLVEKEKELGMHQTGHNSGVVHAGIYYKPGTL 117
            D +V+G G+VG+A AR L       ++ + E  + +G   +  NS V+HAGIYY   +L
Sbjct: 5   IDCIVIGAGVVGLAIARALAA--GGHEVLVAEAAEGIGTGTSSRNSEVIHAGIYYPADSL 62

Query: 118 KAKLCVEGMNLAYEYFDKRNIPYKKCGKLIVALNE-QLEPLHDLYERSIQNNVKDVRLVS 176
           KA+LCV G +L YEY   R +P+++ GKLIVA ++ +   L  +  R+  N V D++ + 
Sbjct: 63  KARLCVRGKHLLYEYCAARGVPHQRLGKLIVATSDAEASQLDSIARRAGANGVDDLQHID 122

Query: 177 AEEIKTIEPYCKGVKAIHSPNTGIVDWGLVTRVMGEEFCELGGEIRLNQQVESFKENPES 236
               + +EP      A+ SP+TGIVD   +      +    G ++  +  + + +  PE 
Sbjct: 123 GAAARRLEPALHCTAALVSPSTGIVDSHALMLAYQGDAESDGAQLVFHTPLIAGRVRPEG 182

Query: 237 ---VTISTKQGDHLESSYALVCAGLQADEMALKSGCSLE---PAIVPFRGEYLLLNPAKQ 290
              +     +   L     +  AGL A  +A +         P     +G Y  L  A +
Sbjct: 183 GFELDFGGAEPMTLSCRVLINAAGLHAPGLARRIEGIPRDSIPPEYLCKGSYFTL--AGR 240

Query: 291 HLVRGNIYPVPDPNFPFLGVHFTPRMDGSVWLGPNAVLAFKKEGYRWRDFSVRELFSTLR 350
                 IYPVP      LGVH T  + G    GP+       E Y               
Sbjct: 241 APFSRLIYPVPQH--AGLGVHLTLDLGGQAKFGPDTEW-IATEDYTLDPRRADVF----- 292

Query: 351 YPGFWRLGLKYTRYGSKEMIMSWFPSMRVNELKQYIEEIEAGDIQRGPSGVRAQALSSSG 410
                                          ++ Y   +  G +  G +G+R + +S   
Sbjct: 293 ----------------------------YAAVRSYWPALPDGALAPGYTGIRPK-ISGPH 323

Query: 411 DLVDDF 416
           +   DF
Sbjct: 324 EPAADF 329


>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Length = 369 Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Length = 381 Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Length = 382 Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Length = 448 Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Length = 405 Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Length = 389 Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Length = 382 Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Length = 372 Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Length = 397 Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Length = 438 Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Length = 830 Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Length = 405 Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Length = 344 Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Length = 344 Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} SCOP: c.3.1.6 PDB: 3fpz_A* Length = 326 Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} SCOP: c.3.1.6 PDB: 3fpz_A* Length = 326 Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Length = 363 Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Length = 351 Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Length = 584 Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Length = 475 Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Length = 477 Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Length = 504 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3utf_A UDP-galactopyranose mutase; nucleotide binding, flavin adenine dinucleotide BIND isomerase; HET: FDA; 2.25A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Length = 513 Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Length = 470 Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Length = 399 Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Length = 424 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query473
3dme_A369 Conserved exported protein; structural genomics, P 100.0
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 100.0
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 100.0
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 100.0
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 100.0
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 100.0
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 100.0
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 100.0
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 100.0
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 100.0
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 100.0
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 100.0
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 100.0
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 100.0
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 99.98
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 99.97
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 99.97
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 99.97
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 99.97
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 99.65
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 99.6
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 99.58
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 99.57
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 99.55
2gqf_A401 Hypothetical protein HI0933; structural genomics, 99.53
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 99.53
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 99.49
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 99.48
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 99.47
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 99.47
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 99.47
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 99.46
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 99.46
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 99.46
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 99.45
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 99.45
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 99.45
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 99.45
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 99.43
3atr_A453 Conserved archaeal protein; saturating double bond 99.43
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 99.43
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 99.41
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 99.4
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 99.39
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 99.38
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 99.38
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 99.37
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 99.36
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 99.35
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 99.35
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 99.35
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 99.32
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 99.32
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.32
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 99.31
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 99.3
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 99.3
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 99.3
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 99.29
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 99.29
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 99.29
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 99.27
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 99.27
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 99.27
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.25
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 99.25
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 99.25
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 99.24
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 99.24
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 99.24
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 99.23
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 99.23
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 99.22
2cul_A232 Glucose-inhibited division protein A-related PROT 99.22
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 99.21
4fk1_A304 Putative thioredoxin reductase; structural genomic 99.21
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 99.21
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 99.21
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 99.2
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 99.2
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 99.2
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 99.2
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 99.19
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 99.19
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 99.19
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 99.18
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 99.18
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 99.18
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 99.17
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 99.16
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 99.16
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 99.16
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 99.13
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 99.13
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 99.13
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 99.13
4dna_A463 Probable glutathione reductase; structural genomic 99.13
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 99.13
2bry_A497 NEDD9 interacting protein with calponin homology a 99.13
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 99.13
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 99.13
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 99.12
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 99.12
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 99.12
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 99.11
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 99.11
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 99.1
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 99.09
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 99.08
4hb9_A412 Similarities with probable monooxygenase; flavin, 99.08
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 99.08
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 99.08
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 99.08
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 99.06
4gut_A776 Lysine-specific histone demethylase 1B; histone de 99.05
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 99.05
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 99.05
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 99.05
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 99.04
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 99.03
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 99.03
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 99.03
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 99.02
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 99.02
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 99.01
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 99.0
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 99.0
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 99.0
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 99.0
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 99.0
1fec_A490 Trypanothione reductase; redox-active center, oxid 98.99
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 98.97
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 98.96
3r9u_A315 Thioredoxin reductase; structural genomics, center 98.95
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 98.94
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 98.94
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 98.93
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 98.92
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 98.91
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 98.91
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 98.9
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.9
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 98.9
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 98.89
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 98.89
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 98.88
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 98.87
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 98.87
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 98.85
1ojt_A482 Surface protein; redox-active center, glycolysis, 98.85
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 98.84
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 98.84
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 98.84
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 98.84
3oc4_A 452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.82
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.81
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 98.81
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 98.8
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.8
2a8x_A 464 Dihydrolipoyl dehydrogenase, E3 component of alpha 98.78
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 98.77
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 98.77
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 98.77
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 98.76
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.76
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.74
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.74
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 98.74
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 98.74
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.73
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 98.73
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 98.71
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 98.7
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 98.69
1q1r_A 431 Putidaredoxin reductase; glutathione reductase fol 98.68
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 98.67
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 98.67
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 98.67
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 98.66
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.66
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 98.65
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 98.65
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 98.63
1nhp_A 447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.63
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 98.63
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 98.63
3cgb_A 480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 98.62
2cdu_A 452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 98.61
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 98.6
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 98.6
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 98.58
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 98.58
2bc0_A 490 NADH oxidase; flavoprotein, pyridine nucleotide di 98.57
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 98.57
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 98.57
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.56
1ojt_A482 Surface protein; redox-active center, glycolysis, 98.56
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 98.56
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.56
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 98.56
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 98.55
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.55
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.55
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.54
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.54
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 98.54
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 98.52
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 98.52
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 98.52
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 98.51
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 98.5
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 98.5
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 98.5
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 98.49
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 98.48
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 98.46
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 98.45
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 98.43
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 98.43
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.42
4fk1_A304 Putative thioredoxin reductase; structural genomic 98.42
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 98.4
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 98.39
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 98.38
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.38
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 98.37
4eqs_A 437 Coenzyme A disulfide reductase; oxidoreductase; HE 98.36
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 98.34
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 98.31
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 98.27
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 98.26
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 98.26
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.2
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 98.19
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 98.18
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 98.17
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 98.15
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 98.14
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 98.1
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.1
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 98.1
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 98.1
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 98.08
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.06
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 98.06
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 98.05
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 98.05
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 98.02
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 97.99
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 97.95
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 97.95
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 97.9
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 97.86
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 97.86
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 97.85
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 97.85
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 97.83
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 97.83
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 97.82
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 97.79
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 97.75
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 97.73
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 97.71
3r9u_A315 Thioredoxin reductase; structural genomics, center 97.7
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 97.69
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 97.63
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 97.59
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 97.59
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 97.56
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 97.55
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 97.5
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 97.45
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 97.43
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 97.42
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 97.34
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 97.34
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 97.3
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 97.28
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 97.27
1vg0_A650 RAB proteins geranylgeranyltransferase component A 97.24
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 97.23
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 97.16
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 97.14
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 97.12
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 97.0
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 96.85
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 96.69
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 96.66
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 96.64
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 96.53
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 96.45
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 96.16
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 95.6
1lss_A140 TRK system potassium uptake protein TRKA homolog; 95.43
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 95.39
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 95.18
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 95.11
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 95.09
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 94.88
3qvp_A 583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 94.79
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 94.69
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 94.67
1id1_A153 Putative potassium channel protein; RCK domain, E. 94.6
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 94.59
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 94.43
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 94.21
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 94.13
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 93.83
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 93.81
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 93.8
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 93.73
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 93.54
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 93.5
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 93.48
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 93.42
3fim_B 566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 93.39
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 93.34
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 93.2
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 93.08
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 93.06
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 92.94
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 92.87
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 92.79
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 92.77
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 92.72
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 92.71
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 92.64
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 92.64
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 92.55
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 92.53
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 92.46
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 92.42
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 92.32
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 92.27
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 92.17
4g65_A461 TRK system potassium uptake protein TRKA; structur 92.11
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 92.11
3l6d_A306 Putative oxidoreductase; structural genomics, prot 92.1
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 92.09
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 92.09
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 92.02
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 91.98
3tl2_A315 Malate dehydrogenase; center for structural genomi 91.91
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 91.76
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 91.75
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 91.65
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 91.64
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 91.54
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 91.53
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 91.53
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 91.34
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 91.29
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 91.22
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 90.97
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 90.94
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 90.92
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 90.91
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 90.9
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 90.9
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 90.77
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 90.69
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 90.68
3qha_A296 Putative oxidoreductase; seattle structural genomi 90.64
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 90.64
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 90.58
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 90.56
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 90.52
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 90.47
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 90.37
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 90.24
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 90.2
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 90.2
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 90.07
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 90.03
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 90.03
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 89.97
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 89.91
3mog_A483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 89.82
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 89.82
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 89.8
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 89.71
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 89.63
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 89.62
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 89.57
3c85_A183 Putative glutathione-regulated potassium-efflux S 89.55
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 89.52
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 89.5
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 89.47
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 89.43
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 89.34
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 89.34
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 89.32
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 89.27
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 89.23
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 89.19
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 89.18
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 89.17
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 89.17
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 89.13
1fec_A490 Trypanothione reductase; redox-active center, oxid 89.12
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 89.09
3ius_A286 Uncharacterized conserved protein; APC63810, silic 89.09
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 89.08
4ezb_A317 Uncharacterized conserved protein; structural geno 89.07
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 89.0
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 88.99
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 88.94
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 88.76
4dna_A463 Probable glutathione reductase; structural genomic 88.75
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 88.73
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 88.66
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 88.56
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 88.56
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 88.54
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 88.48
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 88.48
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 88.38
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 88.37
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 88.35
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 88.31
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 88.26
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 88.26
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 88.18
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 88.17
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 88.0
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 87.99
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 87.91
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 87.9
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 87.89
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 87.83
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 87.8
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 87.77
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 87.74
3ojo_A431 CAP5O; rossmann fold, complex with cofactor NAD an 87.67
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 87.64
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 87.63
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 87.55
3dme_A369 Conserved exported protein; structural genomics, P 87.5
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 87.49
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 87.48
2wtb_A725 MFP2, fatty acid multifunctional protein (ATMFP2); 87.46
2cul_A232 Glucose-inhibited division protein A-related PROT 87.4
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 87.39
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 87.3
4gwg_A484 6-phosphogluconate dehydrogenase, decarboxylating; 87.29
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 87.24
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 87.24
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 87.22
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 87.22
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 87.21
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 87.21
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 87.15
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 87.12
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 87.09
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 87.08
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 87.07
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 87.01
1vpd_A299 Tartronate semialdehyde reductase; structural geno 86.95
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 86.9
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 86.89
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 86.85
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 86.84
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 86.82
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 86.81
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 86.73
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 86.71
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 86.71
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 86.68
1pgj_A478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 86.66
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 86.63
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 86.62
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 86.62
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 86.58
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 86.41
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 86.37
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 86.34
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 86.29
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 86.28
2pgd_A482 6-phosphogluconate dehydrogenase; oxidoreductase ( 86.25
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 86.25
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 86.23
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 86.16
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 86.14
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 86.13
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 86.07
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 86.05
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 86.03
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 86.02
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 86.02
2rir_A300 Dipicolinate synthase, A chain; structural genomic 86.0
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 85.95
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 85.89
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 85.88
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 85.86
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 85.8
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 85.75
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 85.71
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 85.67
1wdk_A715 Fatty oxidation complex alpha subunit; alpha2BETA2 85.61
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 85.6
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
Probab=100.00  E-value=9.6e-41  Score=325.38  Aligned_cols=345  Identities=26%  Similarity=0.418  Sum_probs=278.9

Q ss_pred             CcccEEEEcCChHHHHHHHHHHhcCCCCeEEEEeccCcccCcccCCCcceEEeeccCCCchhHHHHHHHhHHHHHHHHHh
Q psy7710          56 ALYDVVVVGGGIVGVATARELKLNYPKMKICLVEKEKELGMHQTGHNSGVVHAGIYYKPGTLKAKLCVEGMNLAYEYFDK  135 (473)
Q Consensus        56 ~~~dVvIIGaGi~Gl~~A~~L~~~~~G~~V~viE~~~~~g~~~s~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  135 (473)
                      .++||+|||||++|+++|++|+++  |.+|+||||++.+++++|+.+.|+++.+..+.......++...+.+.+.++.++
T Consensus         3 ~~~dvvIIG~G~~Gl~~A~~La~~--G~~V~vlE~~~~~~~~~s~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (369)
T 3dme_A            3 TDIDCIVIGAGVVGLAIARALAAG--GHEVLVAEAAEGIGTGTSSRNSEVIHAGIYYPADSLKARLCVRGKHLLYEYCAA   80 (369)
T ss_dssp             CCEEEEEECCSHHHHHHHHHHHHT--TCCEEEECSSSSSSCSTTSSSCCEECCCCSSCTTCHHHHHHHHHHHHHHHHHHH
T ss_pred             CcCCEEEECCCHHHHHHHHHHHhC--CCeEEEEeCCCCCCCccCcCCccccccCccCCCCCHhHHHHHHHHHHHHHHHHH
Confidence            468999999999999999999999  999999999877899999999999999887777777778888899999999998


Q ss_pred             cCCCCcccCeEEEEeCc-ChhhHHHHHHHHHhCCCCcceeeCHHHHHhhcCCcccceeEecCCccceeHHHHHHHHHHHH
Q psy7710         136 RNIPYKKCGKLIVALNE-QLEPLHDLYERSIQNNVKDVRLVSAEEIKTIEPYCKGVKAIHSPNTGIVDWGLVTRVMGEEF  214 (473)
Q Consensus       136 ~~~~~~~~g~l~~~~~~-~~~~~~~~~~~~~~~g~~~~~~l~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~l~~~~  214 (473)
                      .++.+...+.+.+..+. +.+.+..........+++..++++.+++...+|.+...++++.+..+.+++..++..|.+.+
T Consensus        81 ~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~l~~~~  160 (369)
T 3dme_A           81 RGVPHQRLGKLIVATSDAEASQLDSIARRAGANGVDDLQHIDGAAARRLEPALHCTAALVSPSTGIVDSHALMLAYQGDA  160 (369)
T ss_dssp             HTCCEECCCEEEEECSHHHHTTHHHHHHHHHHTTCCCCEEEEHHHHHHHCTTCCCSEEEEETTCEEECHHHHHHHHHHHH
T ss_pred             cCCCcccCCEEEEecCHHHHHHHHHHHHHHHHcCCCceeecCHHHHHHhCCCceeeeeeECCCCEEECHHHHHHHHHHHH
Confidence            88888889999988877 67777777888888888438999999999999988778899999999999999999999999


Q ss_pred             HHcCcEEEeCceEEEEEEcCCe-EEEEcCCC--cEEEcCEEEEcCCcChHHHHHhc-CCCC--CCceeeeeeEEEEeCcC
Q psy7710         215 CELGGEIRLNQQVESFKENPES-VTISTKQG--DHLESSYALVCAGLQADEMALKS-GCSL--EPAIVPFRGEYLLLNPA  288 (473)
Q Consensus       215 ~~~Gv~i~~~~~V~~i~~~~~~-v~v~~~~g--~~i~ad~VV~aaG~~s~~l~~~~-g~~~--~~~~~p~~g~~~~~~~~  288 (473)
                      +++|++|+++++|++|..++++ +.|++.+|  .+++||.||+|+|.|+..|++++ |++.  .+++.|.|||++.++.+
T Consensus       161 ~~~Gv~i~~~~~v~~i~~~~~~~~~v~~~~g~~~~~~a~~VV~A~G~~s~~l~~~~~g~~~~~~~~i~p~rG~~~~~~~~  240 (369)
T 3dme_A          161 ESDGAQLVFHTPLIAGRVRPEGGFELDFGGAEPMTLSCRVLINAAGLHAPGLARRIEGIPRDSIPPEYLCKGSYFTLAGR  240 (369)
T ss_dssp             HHTTCEEECSCCEEEEEECTTSSEEEEECTTSCEEEEEEEEEECCGGGHHHHHHTEETSCGGGSCCCEEEEEEEEECSSS
T ss_pred             HHCCCEEECCCEEEEEEEcCCceEEEEECCCceeEEEeCEEEECCCcchHHHHHHhcCCCccccceeeecceEEEEECCC
Confidence            9999999999999999988655 88888887  48999999999999999999999 8752  24789999999998764


Q ss_pred             cccCcccccccCCCCCCCccEEEEecCCCCeEEECCCccccccccCcccccchhHHHhhhccCCcchhccchhhhhchHH
Q psy7710         289 KQHLVRGNIYPVPDPNFPFLGVHFTPRMDGSVWLGPNAVLAFKKEGYRWRDFSVRELFSTLRYPGFWRLGLKYTRYGSKE  368 (473)
Q Consensus       289 ~~~~~~~~~~~~~~~~~~~~~~~~~p~~~g~~~iG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  368 (473)
                      .  ...+.+|..|...  ..++++.++.+|++++|++.++.   ++++. ..++                          
T Consensus       241 ~--~~~~~~~~~p~~~--~~~~~~~~~~~g~~~iG~t~e~~---~~~~~-~~~~--------------------------  286 (369)
T 3dme_A          241 A--PFSRLIYPVPQHA--GLGVHLTLDLGGQAKFGPDTEWI---ATEDY-TLDP--------------------------  286 (369)
T ss_dssp             C--SCSSEEEECTTCS--SCCCCEEECTTSCEEECCCCEEE---SSCCC-CCCG--------------------------
T ss_pred             C--ccCceeecCCCCC--CceEEEeCccCCcEEECCCcccc---ccccc-ccCH--------------------------
Confidence            2  2344556555432  23567777788999999987641   11111 0011                          


Q ss_pred             HHhhhcchhHHHHHhhcccCCCCCCcccCCCeeceEee---CCCCccc---------cccceeeeecCCccccchHHHHH
Q psy7710         369 MIMSWFPSMRVNELKQYIEEIEAGDIQRGPSGVRAQAL---SSSGDLV---------DDFGVKAIHSPHTGIVDWGLVTR  436 (473)
Q Consensus       369 ~~~~~~~~~~~~~~~~~~P~l~~~~i~~~w~G~rp~~~---t~d~~p~---------~g~~~~~g~~~~~gi~~~~~~a~  436 (473)
                          ..++.+++.+.+++|.|.+.++.+.|+|+||++.   ++|+.|+         .|+|+++||+++ |+.    .+|
T Consensus       287 ----~~~~~l~~~~~~~~P~l~~~~v~~~w~G~Rp~~~~~~~~d~~p~i~g~~~~~~~~l~~~~G~~~~-G~t----~ap  357 (369)
T 3dme_A          287 ----RRADVFYAAVRSYWPALPDGALAPGYTGIRPKISGPHEPAADFAIAGPASHGVAGLVNLYGIESP-GLT----ASL  357 (369)
T ss_dssp             ----GGGGGHHHHHHTTCTTCCTTCCEEEEEEEEEESSCTTSCCCCCEEECHHHHCCTTEEEEECCCTT-HHH----HHH
T ss_pred             ----HHHHHHHHHHHHHCCCCChhhceecceeccccccCCCCCcCCeEEecccccCCCCEEEEeCCCCc-hHh----ccH
Confidence                1134567999999999999999999999999853   2566664         378999998765 564    455


Q ss_pred             HHHHHHHhh
Q psy7710         437 VMGEEFCEL  445 (473)
Q Consensus       437 ~~g~~~~~~  445 (473)
                      .+|+.++++
T Consensus       358 ~~a~~~a~~  366 (369)
T 3dme_A          358 AIAEETLAR  366 (369)
T ss_dssp             HHHHHHHHH
T ss_pred             HHHHHHHHH
Confidence            555555543



>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 473
d1pj5a2305 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine ox 3e-20
d1ryia1276 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { 3e-18
d1kifa1246 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N 2e-15
d2gf3a1281 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac 5e-14
d1c0pa1268 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida 4e-11
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 1e-06
d2gqfa1253 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H 5e-06
d1m6ia1213 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing f 1e-05
d1m6ia1213 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing f 4e-04
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 2e-05
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 0.002
d2gmha1380 c.3.1.2 (A:4-236,A:336-482) Electron transfer flav 2e-05
d2gmha1380 c.3.1.2 (A:4-236,A:336-482) Electron transfer flav 0.002
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 4e-05
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 8e-05
d1kf6a2311 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Es 2e-04
d1kf6a2311 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Es 0.002
d1qo8a2317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 2e-04
d1d4ca2322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 2e-04
d1i8ta1298 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu 2e-04
d1nhpa1198 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enter 2e-04
d2gjca1311 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th 2e-04
d3c96a1288 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps 3e-04
d1fcda1186 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulf 3e-04
d2iida1370 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M 4e-04
d1pn0a1360 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So 4e-04
d1pn0a1360 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So 0.002
d1chua2305 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E 4e-04
d1k0ia1292 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr 5e-04
d2ivda1347 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox 6e-04
d2v5za1383 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H 7e-04
d2v5za1383 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H 0.004
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 8e-04
d2gv8a1335 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monox 0.001
d2voua1265 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr 0.001
d2voua1265 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr 0.002
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 0.001
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 0.001
d1jnra2356 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reduct 0.002
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 0.002
d1feca1240 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas 0.002
d2bs2a2336 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo 0.003
d1gesa1217 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase 0.004
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 0.004
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: N,N-dimethylglycine oxidase
species: Arthrobacter globiformis [TaxId: 1665]
 Score = 89.0 bits (219), Expect = 3e-20
 Identities = 39/216 (18%), Positives = 73/216 (33%), Gaps = 8/216 (3%)

Query: 58  YDVVVVGGGIVGVATARELKLNYPKMKICLVEK-EKELGMHQTGHNSGVVHAGIYYKPGT 116
             +V++G GIVG   A EL        I ++++    +    T H  G+V       P  
Sbjct: 2   PRIVIIGAGIVGTNLADELVTRGWN-NITVLDQGPLNMPGGSTSHAPGLVF---QTNPSK 57

Query: 117 LKAKLCVEGMNLAYEYFDKRNIPYKKCGKLIVALNEQLEPLHDLYERSIQNNVKDVRLVS 176
             A      +       +     + + G L VA  E                  + RL+S
Sbjct: 58  TMASFAKYTVEKLLSLTEDGVSCFNQVGGLEVATTETRLADLKRKLGYAAAWGIEGRLLS 117

Query: 177 AEEIKTIEPYCKG---VKAIHSPNTGIVDWGLVTRVMGEEFCELGGEIRLNQQVESFKEN 233
             E + + P   G   +  +H P+ G+       +++ +     G   R +  V   +++
Sbjct: 118 PAECQELYPLLDGENILGGLHVPSDGLASAARAVQLLIKRTESAGVTYRGSTTVTGIEQS 177

Query: 234 PESVTISTKQGDHLESSYALVCAGLQADEMALKSGC 269
              VT        + +   + CAG    ++    G 
Sbjct: 178 GGRVTGVQTADGVIPADIVVSCAGFWGAKIGAMIGM 213


>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 246 Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 213 Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 213 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 311 Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 311 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 198 Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Length = 186 Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305 Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 335 Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 356 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query473
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.97
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.97
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.96
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.67
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 99.64
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.6
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 99.59
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 99.58
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 99.57
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 99.53
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.53
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 99.49
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 99.46
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 99.46
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 99.35
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 99.35
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.33
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 99.32
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 99.31
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.25
d1ryia288 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.25
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.24
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 99.23
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.22
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 99.2
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 99.2
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.19
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 99.18
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 99.17
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 99.16
d1kifa293 D-aminoacid oxidase {Pig (Sus scrofa) [TaxId: 9823 99.15
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 99.14
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.14
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 99.13
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.13
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 99.13
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 99.12
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.11
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 99.07
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.06
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 99.05
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.04
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.04
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.04
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 99.03
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.02
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 99.02
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 99.02
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 99.01
d1c0pa295 D-aminoacid oxidase {Rhodotorula gracilis [TaxId: 99.01
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 99.01
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 98.99
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.96
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 98.94
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 98.93
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.91
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.9
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 98.9
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.89
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 98.84
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 98.77
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.69
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.68
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.67
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 98.67
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 98.66
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.61
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.58
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.58
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 98.54
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.53
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 98.52
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.49
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 98.47
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.45
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.43
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.4
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 98.31
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 98.26
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 98.26
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 98.24
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 98.21
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 98.2
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 98.15
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.15
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.08
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 98.05
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 98.04
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 97.93
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.93
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 97.65
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.53
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 97.46
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 97.36
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 97.22
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.79
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 96.78
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 96.75
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.74
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.37
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 96.37
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 96.34
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 96.29
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 96.11
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 96.05
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.05
d1pj5a3119 N,N-dimethylglycine oxidase {Arthrobacter globifor 95.93
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 95.86
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 95.81
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 95.8
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 95.77
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 95.68
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 95.64
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 95.62
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 95.25
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.14
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 95.12
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 95.1
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 94.99
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 94.92
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 94.82
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 94.53
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 94.48
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 94.48
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 94.26
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 94.25
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 94.2
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 94.15
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 94.14
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 94.1
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 93.93
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 93.38
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 93.33
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 93.32
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 93.31
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 93.17
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 93.11
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 93.1
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 93.07
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 93.0
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 92.93
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 92.89
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 92.87
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 92.78
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 92.73
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 92.68
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 92.59
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 92.55
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 92.53
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 92.47
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 92.42
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 92.42
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 92.33
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 92.28
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 92.27
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 91.94
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 91.71
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 91.7
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 91.7
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 91.63
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 91.56
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 91.43
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 90.97
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 90.91
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 90.74
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 90.72
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 90.68
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 90.56
d1id1a_153 Rck domain from putative potassium channel Kch {Es 90.46
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 90.28
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 90.14
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 90.0
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 89.95
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 89.78
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 89.69
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 89.6
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 89.58
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 89.16
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 89.03
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 88.91
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 88.71
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 88.59
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 88.55
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 88.43
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 88.2
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 88.14
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 88.12
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 88.09
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 87.87
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 87.81
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 87.81
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 87.68
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 87.65
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 87.63
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 87.53
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 87.43
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 87.25
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 87.14
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 86.97
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 86.96
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 86.71
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 86.7
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 86.65
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 86.54
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 86.38
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 86.36
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 86.34
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 86.24
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 86.09
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 85.78
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 85.71
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 85.6
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 85.52
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 85.48
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 85.41
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 85.39
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 85.0
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 84.87
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 84.71
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 84.53
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 84.33
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 84.23
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 83.15
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 83.05
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 82.96
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 82.8
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 82.79
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 82.76
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 82.73
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 82.44
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 82.39
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 82.23
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 81.41
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 80.96
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 80.83
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 80.8
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 80.55
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: N,N-dimethylglycine oxidase
species: Arthrobacter globiformis [TaxId: 1665]
Probab=99.97  E-value=1.8e-32  Score=257.46  Aligned_cols=215  Identities=20%  Similarity=0.282  Sum_probs=178.9

Q ss_pred             ccEEEEcCChHHHHHHHHHHhcCCCC-eEEEEeccC-cccCcccCCCcceEEeeccCCCchhHHHHHHHhHHHHHHHHHh
Q psy7710          58 YDVVVVGGGIVGVATARELKLNYPKM-KICLVEKEK-ELGMHQTGHNSGVVHAGIYYKPGTLKAKLCVEGMNLAYEYFDK  135 (473)
Q Consensus        58 ~dVvIIGaGi~Gl~~A~~L~~~~~G~-~V~viE~~~-~~g~~~s~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  135 (473)
                      .||+|||||++|+++|++|+++  |. +|+||||+. ..++++|+++.|+++..   .+......+...+...+.++.+.
T Consensus         2 ~dViIIGaGi~G~s~A~~La~~--G~~~V~liE~~~~~~~~gas~~~~G~i~~~---~~~~~~~~l~~~~~~~~~~~~~~   76 (305)
T d1pj5a2           2 PRIVIIGAGIVGTNLADELVTR--GWNNITVLDQGPLNMPGGSTSHAPGLVFQT---NPSKTMASFAKYTVEKLLSLTED   76 (305)
T ss_dssp             CCEEEECCSHHHHHHHHHHHHT--TCCCEEEECSSCTTCCCSGGGTCCCEECCC---CSCHHHHHHHHHHHHHHHHCEET
T ss_pred             CCEEEECcCHHHHHHHHHHHHc--CCCcEEEEeCCCCCCCccccccccceeccC---CCCHHHHHHHHHHHHHHHhhhhc
Confidence            5899999999999999999999  75 799999983 23467888999988753   34444566777788888777655


Q ss_pred             cCCCCcccCeEEEEeCc-ChhhHHHHHHHHHhCCCCcceeeCHHHHHhhcCCccc---ceeEecCCccceeHHHHHHHHH
Q psy7710         136 RNIPYKKCGKLIVALNE-QLEPLHDLYERSIQNNVKDVRLVSAEEIKTIEPYCKG---VKAIHSPNTGIVDWGLVTRVMG  211 (473)
Q Consensus       136 ~~~~~~~~g~l~~~~~~-~~~~~~~~~~~~~~~g~~~~~~l~~~~~~~~~p~~~~---~~~~~~~~~~~~~~~~~~~~l~  211 (473)
                      ....+.+.|.+....+. ..+......+..+..+. +.++++.+++.+.+|....   .++++.+.+++++|..++..+.
T Consensus        77 ~~~~~~~~g~l~~~~~~~~~~~~~~~~~~~~~~~~-~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~p~~l~~~l~  155 (305)
T d1pj5a2          77 GVSCFNQVGGLEVATTETRLADLKRKLGYAAAWGI-EGRLLSPAECQELYPLLDGENILGGLHVPSDGLASAARAVQLLI  155 (305)
T ss_dssp             TEESEECCCEEEEESSHHHHHHHHHHHHHHHHHTC-CCEEECHHHHHHHCTTSCGGGCCEEEEETTCEEECHHHHHHHHH
T ss_pred             ccccccccccccccchhhhHHHHHHHHHHHHhhcc-cccccchHHhhhhcccccccccccceecccccccchhhhhhhHH
Confidence            55567888999888877 66777777777777787 7899999999998886543   6789999999999999999999


Q ss_pred             HHHHHcCcEEEeCceEEEEEEcCCeEE-EEcCCCcEEEcCEEEEcCCcChHHHHHhcCCCCCCceeeeeeE
Q psy7710         212 EEFCELGGEIRLNQQVESFKENPESVT-ISTKQGDHLESSYALVCAGLQADEMALKSGCSLEPAIVPFRGE  281 (473)
Q Consensus       212 ~~~~~~Gv~i~~~~~V~~i~~~~~~v~-v~~~~g~~i~ad~VV~aaG~~s~~l~~~~g~~~~~~~~p~~g~  281 (473)
                      +.++++|++|+++++|++|..+++++. |+|++| +++||.||+|+|+|+.+|++++|+.+  |+.+...+
T Consensus       156 ~~a~~~gv~i~~~~~V~~i~~~~~~v~~V~T~~g-~i~a~~VV~aaG~~s~~l~~~~g~~l--P~~~~~~~  223 (305)
T d1pj5a2         156 KRTESAGVTYRGSTTVTGIEQSGGRVTGVQTADG-VIPADIVVSCAGFWGAKIGAMIGMAV--PPDGGPLL  223 (305)
T ss_dssp             HHHHHTTCEEECSCCEEEEEEETTEEEEEEETTE-EEECSEEEECCGGGHHHHHHTTTCCC--CTTSCCEE
T ss_pred             hhhhcccccccCCceEEEEEEeCCEEEEEeccce-eEECCEEEEecchhHHHHHHHcCCcc--cccccccc
Confidence            999999999999999999999888764 999998 89999999999999999999999865  44554433



>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ryia2 d.16.1.3 (A:219-306) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1kifa2 d.16.1.3 (A:195-287) D-aminoacid oxidase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1c0pa2 d.16.1.3 (A:1194-1288) D-aminoacid oxidase {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1pj5a3 d.16.1.5 (A:220-338) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure