Psyllid ID: psy7734

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------35
MSVHSGSNESDAWALLALKSTSPSPSKIQWKSGTAIAKLQGREFEYMVRQKRITIGRNSSRGDVDVNMGLSSFISRRHIEIFFEHPNFFMTCNGKNGVFVDGNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPGSEHKLIEQAFRRRRQRGVPCFRAPFGLSSRCTLRFPSTNIRLQFQSLVNESDPAPTGQSVSSSGVGVMGNPATSSLLPPLRINIPDHPHTEISSSPFPSPTGTISAANSCPTSPRGLHNRRNVSADLHMAAHYAAAHTNVVNHMSLSISQDDSKPPYSYAQLIVQAVASAHDKQLTLSGIYSFITKNYPYYRTADKGWQVNYTYLDTTSVVAW
cccccccccccHHHHHHccccccccccccccccccEEEEEEcccEEEEEccEEEEccccccccccccccccHHHHHHHHHHHHcccccEEEEcccccEEccccEEccccccccccccccccccccccccEEEEccccHHHHcHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHccccccccHHHHHHHHHccccccccccccccccEEEcccccEEcc
ccccccccccHHHHHHHHHccccccccccccccccEEEEEcccEEEEEEEEEEEEEEccccccEEEEcccccEEEccEEEEEEccccEEEEEEccccEEEcccEEEccccccccEEEcccccccccccEEEEEccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccccccccccccccHccccccccccHcHccccccccccccccccHHHHHHHHHHHHHcccccEcHHHHHHHHHHccccEEEcccccEEEcEEccccEEEEc
msvhsgsneSDAWALLALkstspspskiqwkSGTAIAKLQGREFEYMVRQKRItigrnssrgdvdvnmGLSSFISRRHIEIffehpnffmtcngkngvfvdgnsirhnlslnryfikvprsqeepgkgsfwridpgsehKLIEQAFRRRRqrgvpcfrapfglssrctlrfpstniRLQFQSlvnesdpaptgqsvsssgvgvmgnpatssllpplrinipdhphteissspfpsptgtisaanscptsprglhnrrnvSADLHMAAHYAAAHTNVVNHMslsisqddskppysYAQLIVQAVASAHDKQLTLSGIYSFItknypyyrtadkgwqvnytyldttsvvaw
msvhsgsneSDAWALLALKstspspskiqwksGTAIAKLQGREFEYMVRQKRitigrnssrgdvdvNMGLSSFISRRHIEIFFEHPNFFMTCNGKNGVFVDGNSIRHNLSLNRYFIkvprsqeepgkgsfwridpgseHKLIEQAFrrrrqrgvpcfrapfglssrctlrfPSTNIRLQFQSLVNESDPAPTGQSVSSSGVGVMGNPATSSLLPPLRINIPDHPHTEISSSPFPSPTGTISAANSCPTSPRGLHNRRNVSADLHMAAHYAAAHTNVVNHMSLSISQDDSKPPYSYAQLIVQAVASAHDKQLTLSGIYSFITKNYPYYRTADKGWQVNYTYLDTTSVVAW
MSVHSGSNESDAWALLALKSTSPSPSKIQWKSGTAIAKLQGREFEYMVRQKRITIGRNSSRGDVDVNMGLSSFISRRHIEIFFEHPNFFMTCNGKNGVFVDGNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPGSEHKLIEQAFRRRRQRGVPCFRAPFGLSSRCTLRFPSTNIRLQFQSLVNESDPAPTgqsvsssgvgvmgNPATSSLLPPLRINIPDHPHTEISSSPFPSPTGTISAANSCPTSPRGLHNRRNVSadlhmaahyaaahTNVVNHMSLSISQDDSKPPYSYAQLIVQAVASAHDKQLTLSGIYSFITKNYPYYRTADKGWQVNYTYLDTTSVVAW
*****************************WKSGTAIAKLQGREFEYMVRQKRITIGRNSSRGDVDVNMGLSSFISRRHIEIFFEHPNFFMTCNGKNGVFVDGNSIRHNLSLNRYFIKV***********FWRID****HKLIEQAFRRRRQRGVPCFRAPFGLSSRCTLRFPSTNIRLQFQ*********************************************************************************LHMAAHYAAAHTNVVNHMSL**********YSYAQLIVQAVASAHDKQLTLSGIYSFITKNYPYYRTADKGWQVNYTYLDTTSVV**
**************************************LQGREFEYM************************SFISRRHIEIFFEHPNFFMTCNGKNGVFVDGNSI**************************RIDPGSE********************APFGLSSRCTLRFPSTNIRLQFQSLVNESDP*************VMGNPATSSLLPPLRINIPDHPHTEISSSPFPSPTGTISAANSCPTSPRGLHNRRNVSAD***************************KPPYSYAQLIVQAVASAHDKQLTLSGIYSFITKNYPYYRTADKGWQVNYTYLDTTSVVAW
**********DAWALLALKSTSPSPSKIQWKSGTAIAKLQGREFEYMVRQKRITIGRNSSRGDVDVNMGLSSFISRRHIEIFFEHPNFFMTCNGKNGVFVDGNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPGSEHKLIEQAFRRRRQRGVPCFRAPFGLSSRCTLRFPSTNIRLQFQSLVN***************VGVMGNPATSSLLPPLRINIPDHPHTEISSSPFPSPTGTISAANSCPTSPRGLHNRRNVSADLHMAAHYAAAHTNVVNHMSLSISQDDSKPPYSYAQLIVQAVASAHDKQLTLSGIYSFITKNYPYYRTADKGWQVNYTYLDTTSVVAW
************WA*LALKSTSPSPSKIQWKSGTAIAKLQGREFEYMVRQKRITIGRNSSRGDVDVNMGLSSFISRRHIEIFFEHPNFFMTCNGKNGVFVDGNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPGSEHKLIEQAFRRRRQRGVPCFRAPFGLSSRCTLRFPSTNI**Q************************************************************************************************************DSKPPYSYAQLIVQAVASAHDKQLTLSGIYSFITKNYPYYRTADKGWQVNYTYLDTTSVVAW
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVHSGSNESDAWALLALKSTSPSPSKIQWKSGTAIAKLQGREFEYMVRQKRITIGRNSSRGDVDVNMGLSSFISRRHIEIFFEHPNFFMTCNGKNGVFVDGNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPGSEHKLIEQAFRRRRQRGVPCFRAPFGLSSRCTLRFPSTNIRLQFQSLVNESDPAPTGQSVSSSGVGVMGNPATSSLLPPLRINIPDHPHTEISSSPFPSPTGTISAANSCPTSPRGLHNRRNVSADLHMAAHYAAAHTNVVNHMSLSISQDDSKPPYSYAQLIVQAVASAHDKQLTLSGIYSFITKNYPYYRTADKGWQVNYTYLDTTSVVAW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query349 2.2.26 [Sep-21-2011]
P42128 719 Forkhead box protein K1 O yes N/A 0.687 0.333 0.442 2e-61
P85037 733 Forkhead box protein K1 O yes N/A 0.673 0.320 0.446 8e-61
Q01167 660 Forkhead box protein K2 O no N/A 0.690 0.365 0.442 2e-58
Q3UCQ1 651 Forkhead box protein K2 O no N/A 0.690 0.370 0.443 5e-57
Q7ZX03 642 Forkhead box protein K2 O N/A N/A 0.681 0.370 0.439 7e-56
O14270 743 Fork head transcription f yes N/A 0.813 0.382 0.274 3e-14
Q92949421 Forkhead box protein J1 O no N/A 0.137 0.114 0.666 3e-13
Q63247421 Forkhead box protein J1 O no N/A 0.137 0.114 0.666 3e-13
Q61660421 Forkhead box protein J1 O no N/A 0.137 0.114 0.666 3e-13
Q708W1439 Forkhead box protein J1-B N/A N/A 0.137 0.109 0.625 6e-12
>sp|P42128|FOXK1_MOUSE Forkhead box protein K1 OS=Mus musculus GN=Foxk1 PE=1 SV=2 Back     alignment and function desciption
 Score =  236 bits (602), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 142/321 (44%), Positives = 187/321 (58%), Gaps = 81/321 (25%)

Query: 28  IQWKSGTAIAKLQGREFEYMVRQKRITIGRNSSRGDVDVNMGLSSFISRRHIEIFFEHPN 87
           ++   G A+A+L+GREFE+++RQ  +TIGRNSS+G VD++MGLSSFISRRH+++ F+ P+
Sbjct: 84  VRQSPGPALARLEGREFEFLMRQPSVTIGRNSSQGSVDLSMGLSSFISRRHLQLSFQEPH 143

Query: 88  FFMTCNGKNGVFVDGNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPGSEHKLIEQAFR 147
           F++ C GKNGVFVDG                                          AF+
Sbjct: 144 FYLRCLGKNGVFVDG------------------------------------------AFQ 161

Query: 148 RRRQRGVPCFRAPFGLSSRCTLRFPSTNIRLQFQSLVNESDPAPTGQSVSSSGVGVMGNP 207
           RR   G P  + P     +CT RFPST I++QF SL ++ + AP                
Sbjct: 162 RR---GAPALQLP----QQCTFRFPSTAIKIQFTSLYHKEE-APA--------------- 198

Query: 208 ATSSLLP------PLRINIPDHPHTEISSSPFPSPTGTISAANSCPTSPRGLHNR----- 256
             S L P      PL+I+IP+ P      SP PSPTGTIS  NSCP SPRG  +      
Sbjct: 199 --SPLRPLYPQISPLKIHIPE-PDLRSLVSPIPSPTGTISVPNSCPASPRGAGSSSYRFV 255

Query: 257 RNVSADLHMAAHYAAAHTNV--VNHMSLSISQDDSKPPYSYAQLIVQAVASAHDKQLTLS 314
           +NV++DL +AA +AA   +    +       +D+SKPPYSYAQLIVQA++SA D+QLTLS
Sbjct: 256 QNVTSDLQLAAEFAAKAASEQQADASGGDSPKDESKPPYSYAQLIVQAISSAQDRQLTLS 315

Query: 315 GIYSFITKNYPYYRTADKGWQ 335
           GIY+ ITK+YPYYRTADKGWQ
Sbjct: 316 GIYAHITKHYPYYRTADKGWQ 336
Transcriptional regulator that binds to the upstream enhancer region (CCAC box) of myoglobin gene. Has a role in myogenic differentiation and in remodeling processes of adult muscles that occur in response to physiological stimuli.
Mus musculus (taxid: 10090)
>sp|P85037|FOXK1_HUMAN Forkhead box protein K1 OS=Homo sapiens GN=FOXK1 PE=1 SV=1 Back     alignment and function description
>sp|Q01167|FOXK2_HUMAN Forkhead box protein K2 OS=Homo sapiens GN=FOXK2 PE=1 SV=3 Back     alignment and function description
>sp|Q3UCQ1|FOXK2_MOUSE Forkhead box protein K2 OS=Mus musculus GN=Foxk2 PE=2 SV=3 Back     alignment and function description
>sp|Q7ZX03|FOXK2_XENLA Forkhead box protein K2 OS=Xenopus laevis GN=foxk2 PE=2 SV=2 Back     alignment and function description
>sp|O14270|FHL1_SCHPO Fork head transcription factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fhl1 PE=4 SV=2 Back     alignment and function description
>sp|Q92949|FOXJ1_HUMAN Forkhead box protein J1 OS=Homo sapiens GN=FOXJ1 PE=2 SV=3 Back     alignment and function description
>sp|Q63247|FOXJ1_RAT Forkhead box protein J1 OS=Rattus norvegicus GN=Foxj1 PE=2 SV=1 Back     alignment and function description
>sp|Q61660|FOXJ1_MOUSE Forkhead box protein J1 OS=Mus musculus GN=Foxj1 PE=2 SV=2 Back     alignment and function description
>sp|Q708W1|FXJ1B_XENLA Forkhead box protein J1-B OS=Xenopus laevis GN=foxj1-b PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query349
332020766 561 Forkhead box protein K1 [Acromyrmex echi 0.782 0.486 0.505 5e-89
189240413 560 PREDICTED: similar to forkhead box K1 [T 0.805 0.501 0.532 4e-88
383848334 556 PREDICTED: forkhead box protein K2-like 0.782 0.491 0.521 2e-87
328793785 556 PREDICTED: forkhead box protein K2-like 0.779 0.489 0.517 2e-87
340725157 540 PREDICTED: forkhead box protein K2-like 0.779 0.503 0.533 2e-87
307191174 562 Forkhead box protein K2 [Camponotus flor 0.782 0.485 0.509 5e-87
307205445 553 Forkhead box protein K2 [Harpegnathos sa 0.782 0.493 0.504 5e-86
242013698 563 Forkhead box protein N3, putative [Pedic 0.790 0.490 0.483 1e-82
427783313 665 Putative forkhead transcription factor k 0.813 0.427 0.491 1e-82
427783311 665 Putative forkhead transcription factor k 0.813 0.427 0.491 1e-82
>gi|332020766|gb|EGI61170.1| Forkhead box protein K1 [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  333 bits (855), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 192/380 (50%), Positives = 222/380 (58%), Gaps = 107/380 (28%)

Query: 1   MSVHSGSNESDAWALLALKSTSPSPSKIQWK---SGTAIAKLQGREFEYMVRQKRITIGR 57
           MS +S + ESDAWALLALKS   SPSK+QW    SG  IA+L+ REFEYMVRQ+RITIGR
Sbjct: 1   MSTYSRTQESDAWALLALKSAPASPSKMQWNPESSGAPIARLEAREFEYMVRQRRITIGR 60

Query: 58  NSSRGDVDVNMGLSSFISRRHIEIFFEHPNFFMTCNGKNGVFVDGNSIRHNLSLNRYFIK 117
           NSS+G+VDVNMG S+FISRRH+EIF+EHP F+M CNGKNGVFVDG               
Sbjct: 61  NSSKGEVDVNMGHSNFISRRHLEIFYEHPFFYMVCNGKNGVFVDG--------------- 105

Query: 118 VPRSQEEPGKGSFWRIDPGSEHKLIEQAFRRRRQRGVPCFRAPFGLSSRCTLRFPSTNIR 177
                                       F+R   +G P ++ P      CT RFPST I+
Sbjct: 106 ---------------------------VFQR---KGAPVYQLP----KTCTFRFPSTTIK 131

Query: 178 LQFQSLVNESDPAPTGQSVSSSGVGVMGNPATSSLLPPLRINIPDHPHTEISSSPFPSPT 237
           L FQSLV+E +          S + V   P   + LPPLRINIPD  +    SSPFPSPT
Sbjct: 132 LLFQSLVDEQE---------QSNIRVPSPPKQRAPLPPLRINIPDAGY----SSPFPSPT 178

Query: 238 GTISAANSCPTSPRGLHNRRNVSADLHMAAHYAAAHTNVVNHMSL--------------- 282
           GTISAANSCP SPR    RRN+SADL M A YAA+  N   + +L               
Sbjct: 179 GTISAANSCPASPRAGQGRRNISADLQMVAAYAASVANDSQNSTLDRHSLERHDGGQSSS 238

Query: 283 ---------------------------SISQDDSKPPYSYAQLIVQAVASAHDKQLTLSG 315
                                      S  +DDSKPPYSYAQLIVQA+ASAHDKQLTLSG
Sbjct: 239 RQISPEPGADARYRGNSSGPNGTAPHYSPPKDDSKPPYSYAQLIVQAIASAHDKQLTLSG 298

Query: 316 IYSFITKNYPYYRTADKGWQ 335
           IYS+ITK+YPYYRTADKGWQ
Sbjct: 299 IYSYITKHYPYYRTADKGWQ 318

Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|189240413|ref|XP_969795.2| PREDICTED: similar to forkhead box K1 [Tribolium castaneum] gi|270011459|gb|EFA07907.1| hypothetical protein TcasGA2_TC005482 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|383848334|ref|XP_003699806.1| PREDICTED: forkhead box protein K2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|328793785|ref|XP_623740.3| PREDICTED: forkhead box protein K2-like [Apis mellifera] Back     alignment and taxonomy information
>gi|340725157|ref|XP_003400940.1| PREDICTED: forkhead box protein K2-like [Bombus terrestris] gi|350417002|ref|XP_003491209.1| PREDICTED: forkhead box protein K2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307191174|gb|EFN74871.1| Forkhead box protein K2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307205445|gb|EFN83777.1| Forkhead box protein K2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|242013698|ref|XP_002427539.1| Forkhead box protein N3, putative [Pediculus humanus corporis] gi|212511941|gb|EEB14801.1| Forkhead box protein N3, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|427783313|gb|JAA57108.1| Putative forkhead transcription factor k strongylocentrotus purpuratus [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|427783311|gb|JAA57107.1| Putative forkhead transcription factor k strongylocentrotus purpuratus [Rhipicephalus pulchellus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query349
UNIPROTKB|F1MP14 707 F1MP14 "Uncharacterized protei 0.515 0.254 0.447 7.9e-61
MGI|MGI:1347488 719 Foxk1 "forkhead box K1" [Mus m 0.515 0.250 0.444 8.1e-61
UNIPROTKB|P85037 733 FOXK1 "Forkhead box protein K1 0.515 0.245 0.439 8.5e-59
UNIPROTKB|F1Q2J8 674 FOXK1 "Uncharacterized protein 0.515 0.267 0.444 3.1e-58
ZFIN|ZDB-GENE-030131-6402 639 foxk1 "forkhead box K1" [Danio 0.739 0.403 0.376 3.5e-36
UNIPROTKB|Q6Q2B1558 foxk1 "Forkhead box protein K1 0.252 0.157 0.616 6e-49
ZFIN|ZDB-GENE-030131-2861 585 foxk2 "forkhead box K2" [Danio 0.481 0.287 0.486 4.3e-56
RGD|1309643 719 Foxk1 "forkhead box K1" [Rattu 0.598 0.290 0.410 1.5e-35
UNIPROTKB|K7GKW1334 LOC100522272 "Uncharacterized 0.573 0.598 0.437 5.4e-53
UNIPROTKB|F1RI50 625 FOXK1 "Uncharacterized protein 0.515 0.288 0.449 2.3e-52
UNIPROTKB|F1MP14 F1MP14 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 376 (137.4 bits), Expect = 7.9e-61, Sum P(2) = 7.9e-61
 Identities = 93/208 (44%), Positives = 117/208 (56%)

Query:   136 GSEHKLIEQAFRRRRQRGVPCFRAPFGLSSRCTLRFPSTNIRLQFQSLVNESDPAPTXXX 195
             G     ++ AF+RR   G P  + P     +CTLRFPST I++QF SL ++ + AP    
Sbjct:   145 GKNGVFVDGAFQRR---GAPALQLP----KQCTLRFPSTAIKIQFTSLYHQEE-APASPL 196

Query:   196 XXXXXXXXXXNPATSSLLPPLRINIPDHPHTEISSSPFPSPTGTISAA-NSCPTSPRGLH 254
                        P  S    PL+I+IP+ P      SP PSPTGTIS+  NSCP SPRG  
Sbjct:   197 RPLY-------PQIS----PLKIHIPE-PDLRSLVSPIPSPTGTISSVPNSCPASPRGAG 244

Query:   255 NR--RNVSXXXXXXXXXXXXXTNVVNHMSLSIS-----QDDSKPPYSYAQLIVQAVASAH 307
             +   R+V                  +      S     +D+SKPPYSYAQLIVQA++SA 
Sbjct:   245 SSSYRSVQNVTSDLQLAAEFAARAASEQQADTSGGDSPKDESKPPYSYAQLIVQAISSAQ 304

Query:   308 DKQLTLSGIYSFITKNYPYYRTADKGWQ 335
             D+QLTLSGIY+ ITK+YPYYRTADKGWQ
Sbjct:   305 DRQLTLSGIYAHITKHYPYYRTADKGWQ 332
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=IEA
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0030308 "negative regulation of cell growth" evidence=IEA
GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=IEA
GO:0005730 "nucleolus" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
MGI|MGI:1347488 Foxk1 "forkhead box K1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P85037 FOXK1 "Forkhead box protein K1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q2J8 FOXK1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-6402 foxk1 "forkhead box K1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q6Q2B1 foxk1 "Forkhead box protein K1 isoform alpha" [Takifugu rubripes (taxid:31033)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-2861 foxk2 "forkhead box K2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1309643 Foxk1 "forkhead box K1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|K7GKW1 LOC100522272 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1RI50 FOXK1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query349
pfam0025096 pfam00250, Fork_head, Fork head domain 7e-24
pfam0025096 pfam00250, Fork_head, Fork head domain 3e-20
cd0005978 cd00059, FH, Forkhead (FH), also known as a "winge 9e-20
smart0033989 smart00339, FH, FORKHEAD 2e-18
cd0005978 cd00059, FH, Forkhead (FH), also known as a "winge 6e-15
smart0033989 smart00339, FH, FORKHEAD 2e-13
COG5025 610 COG5025, COG5025, Transcription factor of the Fork 5e-13
cd00060102 cd00060, FHA, Forkhead associated domain (FHA); fo 2e-09
COG5025610 COG5025, COG5025, Transcription factor of the Fork 4e-08
smart0024052 smart00240, FHA, Forkhead associated domain 3e-06
pfam0049867 pfam00498, FHA, FHA domain 6e-06
>gnl|CDD|189470 pfam00250, Fork_head, Fork head domain Back     alignment and domain information 
 Score = 93.5 bits (233), Expect = 7e-24
 Identities = 30/50 (60%), Positives = 39/50 (78%)

Query: 103 NSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPGSEHKLIEQAFRRRRQR 152
           NSIRHNLSLN+ FIKVPRS ++PGKGS+W +DP SE+      + +RR+R
Sbjct: 47  NSIRHNLSLNKCFIKVPRSPDKPGKGSYWTLDPESENMFENGKYLKRRKR 96

Length = 96
>gnl|CDD|189470 pfam00250, Fork_head, Fork head domain Back     alignment and domain information
>gnl|CDD|238016 cd00059, FH, Forkhead (FH), also known as a "winged helix" Back     alignment and domain information
>gnl|CDD|214627 smart00339, FH, FORKHEAD Back     alignment and domain information
>gnl|CDD|238016 cd00059, FH, Forkhead (FH), also known as a "winged helix" Back     alignment and domain information
>gnl|CDD|214627 smart00339, FH, FORKHEAD Back     alignment and domain information
>gnl|CDD|227358 COG5025, COG5025, Transcription factor of the Forkhead/HNF3 family [Transcription] Back     alignment and domain information
>gnl|CDD|238017 cd00060, FHA, Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins Back     alignment and domain information
>gnl|CDD|227358 COG5025, COG5025, Transcription factor of the Forkhead/HNF3 family [Transcription] Back     alignment and domain information
>gnl|CDD|214578 smart00240, FHA, Forkhead associated domain Back     alignment and domain information
>gnl|CDD|215951 pfam00498, FHA, FHA domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 349
cd0005978 FH Forkhead (FH), also known as a "winged helix". 99.94
COG5025 610 Transcription factor of the Forkhead/HNF3 family [ 99.93
smart0033989 FH FORKHEAD. FORKHEAD, also known as a "winged hel 99.93
PF0025096 Fork_head: Fork head domain; InterPro: IPR001766 T 99.92
KOG3563|consensus 454 99.84
KOG3562|consensus 277 99.79
KOG2294|consensus 454 99.79
KOG4385|consensus 581 99.75
KOG3562|consensus277 99.65
KOG3563|consensus454 99.58
KOG2294|consensus454 99.57
cd0005978 FH Forkhead (FH), also known as a "winged helix". 99.53
PF0025096 Fork_head: Fork head domain; InterPro: IPR001766 T 99.52
smart0033989 FH FORKHEAD. FORKHEAD, also known as a "winged hel 99.47
KOG2293|consensus547 99.15
COG5025 610 Transcription factor of the Forkhead/HNF3 family [ 98.67
PF0049868 FHA: FHA domain; InterPro: IPR000253 The forkhead- 98.19
smart0024052 FHA Forkhead associated domain. Found in eukaryoti 97.97
cd00060102 FHA Forkhead associated domain (FHA); found in euk 97.93
KOG4385|consensus581 97.69
TIGR03354396 VI_FHA type VI secretion system FHA domain protein 97.07
COG1716191 FOG: FHA domain [Signal transduction mechanisms] 96.83
COG3456 430 Predicted component of the type VI protein secreti 95.77
PLN02927668 antheraxanthin epoxidase/zeaxanthin epoxidase 95.68
PF0053877 Linker_histone: linker histone H1 and H5 family; I 92.17
smart0052666 H15 Domain in histone families 1 and 5. 91.57
cd0007388 H15 linker histone 1 and histone 5 domains; the ba 86.13
>cd00059 FH Forkhead (FH), also known as a "winged helix" Back     alignment and domain information 
Probab=99.94  E-value=3.3e-28  Score=189.70  Aligned_cols=59  Identities=44%  Similarity=0.774  Sum_probs=58.4

Q ss_pred             CCCCCHHHHHHHHHHcCCCCCcCHHHHHHHHhccCCCcccCCCCCcccchhhhccCccc
Q psy7734         290 KPPYSYAQLIVQAVASAHDKQLTLSGIYSFITKNYPYYRTADKGWQVNYTYLDTTSVVA  348 (349)
Q Consensus       290 kPp~sY~~lI~~Ai~~sp~~~ltl~~Iy~~i~~~~pyy~~~~~gWqnsiRhnLs~~~~~  348 (349)
                      ||||||++||++||+++|+++|||+|||+||+++|||||.++.|||||||||||...||
T Consensus         1 kP~~sY~~LI~~Ai~~sp~~~lTL~eIy~~I~~~~pyyr~~~~gWknSIRHnLS~n~~F   59 (78)
T cd00059           1 KPPYSYSALIAMAIQSSPEKRLTLSEIYKWISDNFPYFRDAPAGWQNSIRHNLSLNKCF   59 (78)
T ss_pred             CCCCCHHHHHHHHHHhCCCCCeeHHHHHHHHHHhCCccccCCCCCccceeEecccccce
Confidence            89999999999999999999999999999999999999999999999999999999998

FH is named for the Drosophila fork head protein, a transcription factor which promotes terminal rather than segmental development. This family of transcription factor domains, which bind to B-DNA as monomers, are also found in the Hepatocyte nuclear factor (HNF) proteins, which provide tissue-specific gene regulation. The structure contains 2 flexible loops or "wings" in the C-terminal region, hence the term winged helix.
>COG5025 Transcription factor of the Forkhead/HNF3 family [Transcription] Back     alignment and domain information
>smart00339 FH FORKHEAD Back     alignment and domain information
>PF00250 Fork_head: Fork head domain; InterPro: IPR001766 The fork head protein of Drosophila melanogaster, a transcription factor that promotes terminal rather than segmental development, contains neither homeodomains nor zinc-fingers characteristic of other transcription factors [] Back     alignment and domain information
>KOG3563|consensus Back     alignment and domain information
>KOG3562|consensus Back     alignment and domain information
>KOG2294|consensus Back     alignment and domain information
>KOG4385|consensus Back     alignment and domain information
>KOG3562|consensus Back     alignment and domain information
>KOG3563|consensus Back     alignment and domain information
>KOG2294|consensus Back     alignment and domain information
>cd00059 FH Forkhead (FH), also known as a "winged helix" Back     alignment and domain information
>PF00250 Fork_head: Fork head domain; InterPro: IPR001766 The fork head protein of Drosophila melanogaster, a transcription factor that promotes terminal rather than segmental development, contains neither homeodomains nor zinc-fingers characteristic of other transcription factors [] Back     alignment and domain information
>smart00339 FH FORKHEAD Back     alignment and domain information
>KOG2293|consensus Back     alignment and domain information
>COG5025 Transcription factor of the Forkhead/HNF3 family [Transcription] Back     alignment and domain information
>PF00498 FHA: FHA domain; InterPro: IPR000253 The forkhead-associated (FHA) domain [] is a phosphopeptide recognition domain found in many regulatory proteins Back     alignment and domain information
>smart00240 FHA Forkhead associated domain Back     alignment and domain information
>cd00060 FHA Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins Back     alignment and domain information
>KOG4385|consensus Back     alignment and domain information
>TIGR03354 VI_FHA type VI secretion system FHA domain protein Back     alignment and domain information
>COG1716 FOG: FHA domain [Signal transduction mechanisms] Back     alignment and domain information
>COG3456 Predicted component of the type VI protein secretion system, contains a FHA domain [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PF00538 Linker_histone: linker histone H1 and H5 family; InterPro: IPR005818 Histone proteins have central roles in both chromatin organisation (as structural units of the nucleosome) and gene regulation (as dynamic components that have a direct impact on DNA transcription and replication) Back     alignment and domain information
>smart00526 H15 Domain in histone families 1 and 5 Back     alignment and domain information
>cd00073 H15 linker histone 1 and histone 5 domains; the basic subunit of chromatin is the nucleosome, consisting of an octamer of core histones, two full turns of DNA, a linker histone (H1 or H5) and a variable length of linker DNA; H1/H5 are chromatin-associated proteins that bind to the exterior of nucleosomes and dramatically stabilize the highly condensed states of chromatin fibers; stabilization of higher order folding occurs through electrostatic neutralization of the linker DNA segments, through a highly positively charged carboxy- terminal domain known as the AKP helix (Ala, Lys, Pro); thought to be involved in specific protein-protein and protein-DNA interactions and play a role in suppressing core histone tail domain acetylation in the chromatin fiber Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query349
2a3s_A101 Solution Structure And Dynamics Of Dna-Binding Doma 3e-23
2a3s_A101 Solution Structure And Dynamics Of Dna-Binding Doma 1e-18
2c6y_A111 Crystal Structure Of Interleukin Enhancer-Binding F 3e-21
2c6y_A111 Crystal Structure Of Interleukin Enhancer-Binding F 1e-18
1jxs_A98 Solution Structure Of The Dna-Binding Domain Of Int 4e-21
1jxs_A98 Solution Structure Of The Dna-Binding Domain Of Int 2e-18
2hdc_A97 Structure Of Transcription Factor GenesisDNA COMPLE 4e-10
2hdc_A97 Structure Of Transcription Factor GenesisDNA COMPLE 1e-07
1d5v_A94 Solution Structure Of The Forkhead Domain Of The Ad 4e-09
1kq8_A100 Solution Structure Of Winged Helix Protein Hfh-1 Le 8e-08
1kq8_A100 Solution Structure Of Winged Helix Protein Hfh-1 Le 4e-04
2hfh_A109 The Nmr Structures Of A Winged Helix Protein: Genes 9e-08
2hfh_A109 The Nmr Structures Of A Winged Helix Protein: Genes 2e-07
1vtn_C102 Co-Crystal Structure Of The Hnf-3FORK HEAD DNA-Reco 3e-07
1vtn_C102 Co-Crystal Structure Of The Hnf-3FORK HEAD DNA-Reco 7e-07
2a07_F93 Crystal Structure Of Foxp2 Bound Specifically To Dn 1e-06
2kiu_A87 Solution Structure And Backbone Dynamics Of The Dna 3e-06
3g73_A142 Structure Of The Foxm1 Dna Binding Length = 142 8e-05
3co7_C117 Crystal Structure Of Foxo1 Dbd Bound To Dbe2 Dna Le 8e-05
1e17_A150 Solution Structure Of The Dna Binding Domain Of The 8e-05
3co6_C100 Crystal Structure Of Foxo1 Dbd Bound To Dbe1 Dna Le 1e-04
3l2c_A110 Crystal Structure Of The Dna Binding Domain Of Foxo 1e-04
2k86_A103 Solution Structure Of Foxo3a Forkhead Domain Length 3e-04
2uzk_A97 Crystal Structure Of The Human Foxo3a-Dbd Bound To 4e-04
3qrf_F82 Structure Of A Domain-Swapped Foxp3 Dimer Length = 9e-04
>pdb|2A3S|A Chain A, Solution Structure And Dynamics Of Dna-Binding Domain Of Myocyte Nuclear Factor Length = 101 Back     alignment and structure 
Iteration: 1

 Score =  105 bits (263), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 50/52 (96%)
Query: 103 NSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPGSEHKLIEQAFRRRRQRGV 154
           NSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDP SE KL+EQAFR+RRQRGV
Sbjct: 49  NSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGV 100
>pdb|2A3S|A Chain A, Solution Structure And Dynamics Of Dna-Binding Domain Of Myocyte Nuclear Factor Length = 101 Back     alignment and structure
>pdb|2C6Y|A Chain A, Crystal Structure Of Interleukin Enhancer-Binding Factor 1 Bound To Dna Length = 111 Back     alignment and structure
>pdb|2C6Y|A Chain A, Crystal Structure Of Interleukin Enhancer-Binding Factor 1 Bound To Dna Length = 111 Back     alignment and structure
>pdb|1JXS|A Chain A, Solution Structure Of The Dna-Binding Domain Of Interleukin Enhancer Binding Factor Length = 98 Back     alignment and structure
>pdb|1JXS|A Chain A, Solution Structure Of The Dna-Binding Domain Of Interleukin Enhancer Binding Factor Length = 98 Back     alignment and structure
>pdb|2HDC|A Chain A, Structure Of Transcription Factor GenesisDNA COMPLEX Length = 97 Back     alignment and structure
>pdb|2HDC|A Chain A, Structure Of Transcription Factor GenesisDNA COMPLEX Length = 97 Back     alignment and structure
>pdb|1D5V|A Chain A, Solution Structure Of The Forkhead Domain Of The Adipocyte- Transcription Factor Freac-11 (S12) Length = 94 Back     alignment and structure
>pdb|1KQ8|A Chain A, Solution Structure Of Winged Helix Protein Hfh-1 Length = 100 Back     alignment and structure
>pdb|1KQ8|A Chain A, Solution Structure Of Winged Helix Protein Hfh-1 Length = 100 Back     alignment and structure
>pdb|2HFH|A Chain A, The Nmr Structures Of A Winged Helix Protein: Genesis, 20 Structures Length = 109 Back     alignment and structure
>pdb|2HFH|A Chain A, The Nmr Structures Of A Winged Helix Protein: Genesis, 20 Structures Length = 109 Back     alignment and structure
>pdb|1VTN|C Chain C, Co-Crystal Structure Of The Hnf-3FORK HEAD DNA-Recognition Motif Resembles Histone H5 Length = 102 Back     alignment and structure
>pdb|1VTN|C Chain C, Co-Crystal Structure Of The Hnf-3FORK HEAD DNA-Recognition Motif Resembles Histone H5 Length = 102 Back     alignment and structure
>pdb|2A07|F Chain F, Crystal Structure Of Foxp2 Bound Specifically To Dna. Length = 93 Back     alignment and structure
>pdb|2KIU|A Chain A, Solution Structure And Backbone Dynamics Of The Dna-Binding Domain Of Foxp1: Insight Into Its Domain Swapping Length = 87 Back     alignment and structure
>pdb|3G73|A Chain A, Structure Of The Foxm1 Dna Binding Length = 142 Back     alignment and structure
>pdb|3CO7|C Chain C, Crystal Structure Of Foxo1 Dbd Bound To Dbe2 Dna Length = 117 Back     alignment and structure
>pdb|3CO6|C Chain C, Crystal Structure Of Foxo1 Dbd Bound To Dbe1 Dna Length = 100 Back     alignment and structure
>pdb|3L2C|A Chain A, Crystal Structure Of The Dna Binding Domain Of Foxo4 Bound To Dna Length = 110 Back     alignment and structure
>pdb|2K86|A Chain A, Solution Structure Of Foxo3a Forkhead Domain Length = 103 Back     alignment and structure
>pdb|2UZK|A Chain A, Crystal Structure Of The Human Foxo3a-Dbd Bound To Dna Length = 97 Back     alignment and structure
>pdb|3QRF|F Chain F, Structure Of A Domain-Swapped Foxp3 Dimer Length = 82 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query349
1vtn_C102 HNF-3/FORK head DNA-recognition motif; protein-DNA 4e-25
1vtn_C102 HNF-3/FORK head DNA-recognition motif; protein-DNA 1e-21
2hdc_A97 Protein (transcription factor); structure, dyanami 8e-25
2hdc_A97 Protein (transcription factor); structure, dyanami 4e-21
2c6y_A111 Forkhead box protein K2; transcription regulation, 1e-24
2c6y_A111 Forkhead box protein K2; transcription regulation, 1e-22
2hfh_A109 Genesis, HFH-2; HNF-3 homologues, winged helix pro 3e-24
2hfh_A109 Genesis, HFH-2; HNF-3 homologues, winged helix pro 9e-21
1kq8_A100 HFH-1, hepatocyte nuclear factor 3 forkhead homolo 7e-22
1kq8_A100 HFH-1, hepatocyte nuclear factor 3 forkhead homolo 4e-20
2a07_F93 Forkhead box protein P2; double-helix, swapping, h 1e-21
2a07_F93 Forkhead box protein P2; double-helix, swapping, h 2e-15
3g73_A142 Forkhead box protein M1; DNA-binding domain, forkh 9e-20
3g73_A142 Forkhead box protein M1; DNA-binding domain, forkh 8e-19
3l2c_A110 Forkhead box protein O4; winged helix, transcripti 6e-19
3l2c_A110 Forkhead box protein O4; winged helix, transcripti 1e-14
3bpy_A85 FORK head domain, forkhead transcription factor FO 6e-19
3bpy_A85 FORK head domain, forkhead transcription factor FO 6e-14
3coa_C117 Forkhead box protein O1; winged helix, forkhead do 1e-17
3coa_C117 Forkhead box protein O1; winged helix, forkhead do 3e-14
1e17_A150 AFX; DNA binding domain, winged helix; NMR {Homo s 2e-16
1e17_A150 AFX; DNA binding domain, winged helix; NMR {Homo s 4e-14
1g6g_A127 Protein kinase RAD53; beta-sandwich, phosphopeptid 2e-06
1lgp_A116 Cell cycle checkpoint protein CHFR; FHA, tungstate 9e-06
1g3g_A164 Protien kinase SPK1; FHA domain, RAD53, phosphopep 1e-05
1uht_A118 Expressed protein; FHA domain, beta-sandwich, anti 1e-05
1gxc_A149 CHK2, CDS1, serine/threonine-protein kinase CHK2; 3e-05
3gqs_A106 Adenylate cyclase-like protein; FHA domain, struct 6e-05
3po8_A100 RV0020C protein, putative uncharacterized protein 2e-04
2xt9_B115 Putative signal transduction protein GARA; lyase-s 2e-04
2kb3_A143 Oxoglutarate dehydrogenase inhibitor; forkhead-ass 5e-04
2kfu_A162 RV1827 PThr 22; FHA domain, phosphorylation, intra 5e-04
2pie_A138 E3 ubiquitin-protein ligase RNF8; FHA domain, comp 6e-04
1r21_A128 Antigen KI-67; beta sandwich, cell cycle; NMR {Hom 7e-04
2csw_A145 Ubiquitin ligase protein RNF8; 11-stranded beta sa 7e-04
>1vtn_C HNF-3/FORK head DNA-recognition motif; protein-DNA complex, double helix, transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} PDB: 1d5v_A Length = 102 Back     alignment and structure
 Score = 96.6 bits (241), Expect = 4e-25
 Identities = 24/50 (48%), Positives = 34/50 (68%)

Query: 103 NSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPGSEHKLIEQAFRRRRQR 152
           NSIRH+LS N  F+KV RS ++PGKGS+W + P S +      + RR++R
Sbjct: 49  NSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKR 98
>1vtn_C HNF-3/FORK head DNA-recognition motif; protein-DNA complex, double helix, transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} PDB: 1d5v_A Length = 102 Back     alignment and structure
>2hdc_A Protein (transcription factor); structure, dyanamics, genesis, winged helix protein, protein/DNA complex; HET: DNA; NMR {Rattus norvegicus} SCOP: a.4.5.14 Length = 97 Back     alignment and structure
>2hdc_A Protein (transcription factor); structure, dyanamics, genesis, winged helix protein, protein/DNA complex; HET: DNA; NMR {Rattus norvegicus} SCOP: a.4.5.14 Length = 97 Back     alignment and structure
>2c6y_A Forkhead box protein K2; transcription regulation, DNA-binding domain, forkhead transcription factors, interleukin enhancer binding factor; 2.4A {Homo sapiens} SCOP: a.4.5.14 PDB: 1jxs_A 2a3s_A 2d2w_A Length = 111 Back     alignment and structure
>2c6y_A Forkhead box protein K2; transcription regulation, DNA-binding domain, forkhead transcription factors, interleukin enhancer binding factor; 2.4A {Homo sapiens} SCOP: a.4.5.14 PDB: 1jxs_A 2a3s_A 2d2w_A Length = 111 Back     alignment and structure
>2hfh_A Genesis, HFH-2; HNF-3 homologues, winged helix protein; NMR {Rattus norvegicus} SCOP: a.4.5.14 Length = 109 Back     alignment and structure
>2hfh_A Genesis, HFH-2; HNF-3 homologues, winged helix protein; NMR {Rattus norvegicus} SCOP: a.4.5.14 Length = 109 Back     alignment and structure
>1kq8_A HFH-1, hepatocyte nuclear factor 3 forkhead homolog 1, winged; winged helix protein, structure, transcription; NMR {Rattus norvegicus} SCOP: a.4.5.14 Length = 100 Back     alignment and structure
>1kq8_A HFH-1, hepatocyte nuclear factor 3 forkhead homolog 1, winged; winged helix protein, structure, transcription; NMR {Rattus norvegicus} SCOP: a.4.5.14 Length = 100 Back     alignment and structure
>2a07_F Forkhead box protein P2; double-helix, swapping, homodimer, monomer, winged-helix, magnesium, transcription/DNA complex; 1.90A {Homo sapiens} SCOP: a.4.5.14 PDB: 2as5_F 2kiu_A 3qrf_F Length = 93 Back     alignment and structure
>2a07_F Forkhead box protein P2; double-helix, swapping, homodimer, monomer, winged-helix, magnesium, transcription/DNA complex; 1.90A {Homo sapiens} SCOP: a.4.5.14 PDB: 2as5_F 2kiu_A 3qrf_F Length = 93 Back     alignment and structure
>3g73_A Forkhead box protein M1; DNA-binding domain, forkhead transcription factors, FOXM1, W helix; HET: DNA; 2.21A {Homo sapiens} Length = 142 Back     alignment and structure
>3g73_A Forkhead box protein M1; DNA-binding domain, forkhead transcription factors, FOXM1, W helix; HET: DNA; 2.21A {Homo sapiens} Length = 142 Back     alignment and structure
>3l2c_A Forkhead box protein O4; winged helix, transcription-DNA COMP; 1.87A {Homo sapiens} PDB: 3co6_C* Length = 110 Back     alignment and structure
>3l2c_A Forkhead box protein O4; winged helix, transcription-DNA COMP; 1.87A {Homo sapiens} PDB: 3co6_C* Length = 110 Back     alignment and structure
>3bpy_A FORK head domain, forkhead transcription factor FOXO4, DNA binding domain; forkhead BOX, winged helix; 1.87A {Homo sapiens} SCOP: a.4.5.14 Length = 85 Back     alignment and structure
>3bpy_A FORK head domain, forkhead transcription factor FOXO4, DNA binding domain; forkhead BOX, winged helix; 1.87A {Homo sapiens} SCOP: a.4.5.14 Length = 85 Back     alignment and structure
>3coa_C Forkhead box protein O1; winged helix, forkhead domain, chromosomal rearrangement; HET: DNA; 2.20A {Homo sapiens} PDB: 3co7_C* 2k86_A 2uzk_A Length = 117 Back     alignment and structure
>3coa_C Forkhead box protein O1; winged helix, forkhead domain, chromosomal rearrangement; HET: DNA; 2.20A {Homo sapiens} PDB: 3co7_C* 2k86_A 2uzk_A Length = 117 Back     alignment and structure
>1g6g_A Protein kinase RAD53; beta-sandwich, phosphopeptide complex, cell cycle; HET: TPO; 1.60A {Saccharomyces cerevisiae} SCOP: b.26.1.2 Length = 127 Back     alignment and structure
>1lgp_A Cell cycle checkpoint protein CHFR; FHA, tungstate, domain swapping; 2.00A {Homo sapiens} SCOP: b.26.1.2 PDB: 1lgq_A Length = 116 Back     alignment and structure
>1g3g_A Protien kinase SPK1; FHA domain, RAD53, phosphopeptide, phosphoprotein, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1j4o_A 1j4p_A* 1j4q_A* 1k3j_A 1k3n_A* 1k3q_A* 2a0t_A* 2jqi_A* Length = 164 Back     alignment and structure
>1uht_A Expressed protein; FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.26.1.2 Length = 118 Back     alignment and structure
>1gxc_A CHK2, CDS1, serine/threonine-protein kinase CHK2; phosphoprotein-binding domain, checkpoint kinase, transferase; HET: TPO; 2.7A {Homo sapiens} SCOP: b.26.1.2 Length = 149 Back     alignment and structure
>3gqs_A Adenylate cyclase-like protein; FHA domain, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.20A {Chlamydia trachomatis} Length = 106 Back     alignment and structure
>3po8_A RV0020C protein, putative uncharacterized protein TB39.8; FHA domain, synthetic peptide, peptide binding protein; 1.50A {Mycobacterium tuberculosis} PDB: 3poa_A* 2lc1_A Length = 100 Back     alignment and structure
>2xt9_B Putative signal transduction protein GARA; lyase-signaling protein complex, KDH, KGD; HET: TPP; 2.20A {Mycobacterium smegmatis} Length = 115 Back     alignment and structure
>2kb3_A Oxoglutarate dehydrogenase inhibitor; forkhead-associated domain, kinase substrate, GARA, FHA, cytoplasm, phosphoprotein; HET: TPO; NMR {Corynebacterium glutamicum} PDB: 2kb4_A Length = 143 Back     alignment and structure
>2kfu_A RV1827 PThr 22; FHA domain, phosphorylation, intramolecular interaction, glutamate metabolism, phosphoprotein, protein binding; HET: TPO; NMR {Mycobacterium tuberculosis} PDB: 2kkl_A Length = 162 Back     alignment and structure
>2pie_A E3 ubiquitin-protein ligase RNF8; FHA domain, complex, ligase, signaling protein; HET: TPO; 1.35A {Homo sapiens} SCOP: b.26.1.2 Length = 138 Back     alignment and structure
>1r21_A Antigen KI-67; beta sandwich, cell cycle; NMR {Homo sapiens} SCOP: b.26.1.2 PDB: 2aff_A* Length = 128 Back     alignment and structure
>2csw_A Ubiquitin ligase protein RNF8; 11-stranded beta sandwich, ring finger protein 8, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.26.1.2 Length = 145 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query349
1vtn_C102 HNF-3/FORK head DNA-recognition motif; protein-DNA 99.94
2hdc_A97 Protein (transcription factor); structure, dyanami 99.94
1kq8_A100 HFH-1, hepatocyte nuclear factor 3 forkhead homolo 99.94
2c6y_A111 Forkhead box protein K2; transcription regulation, 99.94
2hfh_A109 Genesis, HFH-2; HNF-3 homologues, winged helix pro 99.94
2a07_F93 Forkhead box protein P2; double-helix, swapping, h 99.94
3bpy_A85 FORK head domain, forkhead transcription factor FO 99.94
3coa_C117 Forkhead box protein O1; winged helix, forkhead do 99.93
3l2c_A110 Forkhead box protein O4; winged helix, transcripti 99.93
3g73_A142 Forkhead box protein M1; DNA-binding domain, forkh 99.92
1e17_A150 AFX; DNA binding domain, winged helix; NMR {Homo s 99.92
2c6y_A111 Forkhead box protein K2; transcription regulation, 99.77
1kq8_A100 HFH-1, hepatocyte nuclear factor 3 forkhead homolo 99.77
2hdc_A97 Protein (transcription factor); structure, dyanami 99.77
2hfh_A109 Genesis, HFH-2; HNF-3 homologues, winged helix pro 99.76
1vtn_C102 HNF-3/FORK head DNA-recognition motif; protein-DNA 99.73
3coa_C117 Forkhead box protein O1; winged helix, forkhead do 99.56
3l2c_A110 Forkhead box protein O4; winged helix, transcripti 99.53
1e17_A150 AFX; DNA binding domain, winged helix; NMR {Homo s 99.53
3bpy_A85 FORK head domain, forkhead transcription factor FO 99.49
3g73_A142 Forkhead box protein M1; DNA-binding domain, forkh 99.42
2a07_F93 Forkhead box protein P2; double-helix, swapping, h 99.34
1lgp_A116 Cell cycle checkpoint protein CHFR; FHA, tungstate 98.41
1gxc_A149 CHK2, CDS1, serine/threonine-protein kinase CHK2; 98.38
1g6g_A127 Protein kinase RAD53; beta-sandwich, phosphopeptid 98.23
1r21_A128 Antigen KI-67; beta sandwich, cell cycle; NMR {Hom 98.19
3po8_A100 RV0020C protein, putative uncharacterized protein 98.16
1uht_A118 Expressed protein; FHA domain, beta-sandwich, anti 98.14
3gqs_A106 Adenylate cyclase-like protein; FHA domain, struct 98.12
2pie_A138 E3 ubiquitin-protein ligase RNF8; FHA domain, comp 98.11
3hx1_A131 SLR1951 protein; P74513_SYNY3, adenylate cyclase-l 98.05
1g3g_A164 Protien kinase SPK1; FHA domain, RAD53, phosphopep 98.05
3oun_A157 Putative uncharacterized protein TB39.8; peptidogl 98.04
2xt9_B115 Putative signal transduction protein GARA; lyase-s 98.02
2jpe_A140 Nuclear inhibitor of protein phosphatase 1; FHA do 98.0
2csw_A145 Ubiquitin ligase protein RNF8; 11-stranded beta sa 97.99
2jqj_A151 DNA damage response protein kinase DUN1; protein/p 97.98
2kb3_A143 Oxoglutarate dehydrogenase inhibitor; forkhead-ass 97.98
1wln_A120 Afadin; beta sandwich, FHA domain, structural geno 97.96
2kfu_A162 RV1827 PThr 22; FHA domain, phosphorylation, intra 97.94
3va4_A132 Mediator of DNA damage checkpoint protein 1; cell 97.91
1mzk_A139 Kinase associated protein phosphatase; beta sandwi 97.86
1dmz_A158 Protein (protein kinase SPK1); beta-sandwich, anti 97.81
3els_A158 PRE-mRNA leakage protein 1; intrinsically unstruct 97.8
4h87_A130 Kanadaptin; FHA domain of PF00498, mRNA processing 97.78
1qu5_A182 Protein kinase SPK1; FHA, RAD53, transferase; NMR 97.76
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 97.67
3fm8_A124 Kinesin-like protein KIF13B; kinesin, GAP, GTPase 97.64
3elv_A205 PRE-mRNA leakage protein 1; intrinsically unstruct 97.55
4ejq_A154 Kinesin-like protein KIF1A; homodimer, FHA domain, 97.46
3huf_A325 DNA repair and telomere maintenance protein NBS1; 97.19
3kt9_A102 Aprataxin; FHA domain, beta sandwich, beta sheet, 96.96
3uv0_A102 Mutator 2, isoform B; FHA, protein binding, dimeri 96.8
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 96.51
2brf_A110 Bifunctional polynucleotide phosphatase/kinase; hy 96.14
1ujx_A119 Polynucleotide kinase 3'-phosphatase; DNA repair, 96.03
1yj5_C143 5' polynucleotide kinase-3' phosphatase FHA domai; 95.87
4egx_A184 Kinesin-like protein KIF1A; FHA domain, transport 95.27
4a0e_A123 YSCD, type III secretion protein; transport protei 94.15
1uss_A88 Histone H1; DNA binding protein, linker histone, D 82.29
1uhm_A78 Histone H1, histone HHO1P; winged helix-turn-helix 80.61
>1vtn_C HNF-3/FORK head DNA-recognition motif; protein-DNA complex, double helix, transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} PDB: 1d5v_A Back     alignment and structure
Probab=99.94  E-value=1e-28  Score=200.47  Aligned_cols=61  Identities=39%  Similarity=0.640  Sum_probs=59.7

Q ss_pred             CCCCCCCHHHHHHHHHHcCCCCCcCHHHHHHHHhccCCCcccCCCCCcccchhhhccCccc
Q psy7734         288 DSKPPYSYAQLIVQAVASAHDKQLTLSGIYSFITKNYPYYRTADKGWQVNYTYLDTTSVVA  348 (349)
Q Consensus       288 ~~kPp~sY~~lI~~Ai~~sp~~~ltl~~Iy~~i~~~~pyy~~~~~gWqnsiRhnLs~~~~~  348 (349)
                      +.||||||++||+|||+++|+++|||+|||+||+++||||+.++.|||||||||||...||
T Consensus         1 h~KPp~SY~~LI~~AI~~sp~~~LtL~eIY~~I~~~fpyyr~~~~gWqNSIRHNLSln~~F   61 (102)
T 1vtn_C            1 HAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCF   61 (102)
T ss_dssp             CCCCSSCHHHHHHHHHHTSTTSCBCHHHHHHHHHHHCGGGGSCHHHHHHHHHHHHHHCTTE
T ss_pred             CcCcCCCHHHHHHHHHHhCCCCCCcHHHHHHHHHHcCCccccCCCchhhhhhhhhhhccce
Confidence            4799999999999999999999999999999999999999999999999999999999998
>2hdc_A Protein (transcription factor); structure, dyanamics, genesis, winged helix protein, protein/DNA complex; HET: DNA; NMR {Rattus norvegicus} SCOP: a.4.5.14 Back     alignment and structure
>1kq8_A HFH-1, hepatocyte nuclear factor 3 forkhead homolog 1, winged; winged helix protein, structure, transcription; NMR {Rattus norvegicus} SCOP: a.4.5.14 Back     alignment and structure
>2c6y_A Forkhead box protein K2; transcription regulation, DNA-binding domain, forkhead transcription factors, interleukin enhancer binding factor; 2.4A {Homo sapiens} SCOP: a.4.5.14 PDB: 1jxs_A 2a3s_A 2d2w_A Back     alignment and structure
>2hfh_A Genesis, HFH-2; HNF-3 homologues, winged helix protein; NMR {Rattus norvegicus} SCOP: a.4.5.14 Back     alignment and structure
>2a07_F Forkhead box protein P2; double-helix, swapping, homodimer, monomer, winged-helix, magnesium, transcription/DNA complex; 1.90A {Homo sapiens} SCOP: a.4.5.14 PDB: 2as5_F 2kiu_A 3qrf_F Back     alignment and structure
>3bpy_A FORK head domain, forkhead transcription factor FOXO4, DNA binding domain; forkhead BOX, winged helix; 1.87A {Homo sapiens} Back     alignment and structure
>3coa_C Forkhead box protein O1; winged helix, forkhead domain, chromosomal rearrangement; HET: DNA; 2.20A {Homo sapiens} PDB: 3co7_C* 2k86_A 2uzk_A Back     alignment and structure
>3l2c_A Forkhead box protein O4; winged helix, transcription-DNA COMP; 1.87A {Homo sapiens} SCOP: a.4.5.14 PDB: 3co6_C* Back     alignment and structure
>3g73_A Forkhead box protein M1; DNA-binding domain, forkhead transcription factors, FOXM1, W helix; HET: DNA; 2.21A {Homo sapiens} Back     alignment and structure
>2c6y_A Forkhead box protein K2; transcription regulation, DNA-binding domain, forkhead transcription factors, interleukin enhancer binding factor; 2.4A {Homo sapiens} SCOP: a.4.5.14 PDB: 1jxs_A 2a3s_A 2d2w_A Back     alignment and structure
>1kq8_A HFH-1, hepatocyte nuclear factor 3 forkhead homolog 1, winged; winged helix protein, structure, transcription; NMR {Rattus norvegicus} SCOP: a.4.5.14 Back     alignment and structure
>2hdc_A Protein (transcription factor); structure, dyanamics, genesis, winged helix protein, protein/DNA complex; HET: DNA; NMR {Rattus norvegicus} SCOP: a.4.5.14 Back     alignment and structure
>2hfh_A Genesis, HFH-2; HNF-3 homologues, winged helix protein; NMR {Rattus norvegicus} SCOP: a.4.5.14 Back     alignment and structure
>1vtn_C HNF-3/FORK head DNA-recognition motif; protein-DNA complex, double helix, transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} PDB: 1d5v_A Back     alignment and structure
>3coa_C Forkhead box protein O1; winged helix, forkhead domain, chromosomal rearrangement; HET: DNA; 2.20A {Homo sapiens} PDB: 3co7_C* 2k86_A 2uzk_A Back     alignment and structure
>3l2c_A Forkhead box protein O4; winged helix, transcription-DNA COMP; 1.87A {Homo sapiens} SCOP: a.4.5.14 PDB: 3co6_C* Back     alignment and structure
>3bpy_A FORK head domain, forkhead transcription factor FOXO4, DNA binding domain; forkhead BOX, winged helix; 1.87A {Homo sapiens} Back     alignment and structure
>3g73_A Forkhead box protein M1; DNA-binding domain, forkhead transcription factors, FOXM1, W helix; HET: DNA; 2.21A {Homo sapiens} Back     alignment and structure
>2a07_F Forkhead box protein P2; double-helix, swapping, homodimer, monomer, winged-helix, magnesium, transcription/DNA complex; 1.90A {Homo sapiens} SCOP: a.4.5.14 PDB: 2as5_F 2kiu_A 3qrf_F Back     alignment and structure
>1lgp_A Cell cycle checkpoint protein CHFR; FHA, tungstate, domain swapping; 2.00A {Homo sapiens} SCOP: b.26.1.2 PDB: 1lgq_A Back     alignment and structure
>1gxc_A CHK2, CDS1, serine/threonine-protein kinase CHK2; phosphoprotein-binding domain, checkpoint kinase, transferase; HET: TPO; 2.7A {Homo sapiens} SCOP: b.26.1.2 Back     alignment and structure
>1g6g_A Protein kinase RAD53; beta-sandwich, phosphopeptide complex, cell cycle; HET: TPO; 1.60A {Saccharomyces cerevisiae} SCOP: b.26.1.2 Back     alignment and structure
>1r21_A Antigen KI-67; beta sandwich, cell cycle; NMR {Homo sapiens} SCOP: b.26.1.2 PDB: 2aff_A* Back     alignment and structure
>3po8_A RV0020C protein, putative uncharacterized protein TB39.8; FHA domain, synthetic peptide, peptide binding protein; 1.50A {Mycobacterium tuberculosis} SCOP: b.26.1.0 PDB: 3poa_A* 2lc1_A Back     alignment and structure
>1uht_A Expressed protein; FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.26.1.2 Back     alignment and structure
>3gqs_A Adenylate cyclase-like protein; FHA domain, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.20A {Chlamydia trachomatis} Back     alignment and structure
>2pie_A E3 ubiquitin-protein ligase RNF8; FHA domain, complex, ligase, signaling protein; HET: TPO; 1.35A {Homo sapiens} SCOP: b.26.1.2 Back     alignment and structure
>3hx1_A SLR1951 protein; P74513_SYNY3, adenylate cyclase-like protein, NESG, structural genomics, PSI-2, protein structure initiative; 2.50A {Synechocystis SP} Back     alignment and structure
>1g3g_A Protien kinase SPK1; FHA domain, RAD53, phosphopeptide, phosphoprotein, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1j4o_A 1j4p_A* 1j4q_A* 1k3j_A 1k3n_A* 1k3q_A* 2a0t_A* 2jqi_A* Back     alignment and structure
>3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} Back     alignment and structure
>2xt9_B Putative signal transduction protein GARA; lyase-signaling protein complex, KDH, KGD; HET: TPP; 2.20A {Mycobacterium smegmatis} Back     alignment and structure
>2jpe_A Nuclear inhibitor of protein phosphatase 1; FHA domain, NIPP1, mRNA splicing, transcription; NMR {Mus musculus} Back     alignment and structure
>2csw_A Ubiquitin ligase protein RNF8; 11-stranded beta sandwich, ring finger protein 8, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.26.1.2 Back     alignment and structure
>2jqj_A DNA damage response protein kinase DUN1; protein/phosphopeptide, cell cycle; HET: DNA; NMR {Saccharomyces cerevisiae} PDB: 2jql_A* Back     alignment and structure
>2kb3_A Oxoglutarate dehydrogenase inhibitor; forkhead-associated domain, kinase substrate, GARA, FHA, cytoplasm, phosphoprotein; HET: TPO; NMR {Corynebacterium glutamicum} PDB: 2kb4_A Back     alignment and structure
>1wln_A Afadin; beta sandwich, FHA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.26.1.2 Back     alignment and structure
>2kfu_A RV1827 PThr 22; FHA domain, phosphorylation, intramolecular interaction, glutamate metabolism, phosphoprotein, protein binding; HET: TPO; NMR {Mycobacterium tuberculosis} PDB: 2kkl_A Back     alignment and structure
>3va4_A Mediator of DNA damage checkpoint protein 1; cell cycle, FHA domain, DNA-damage, CHK2 and MDC1 dimerizati; HET: TPO; 1.54A {Mus musculus} PDB: 3va1_A* 3umz_A 3unm_A 3unn_A* 3uot_A* 3un0_B Back     alignment and structure
>1dmz_A Protein (protein kinase SPK1); beta-sandwich, antiparallel beta-sheets, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1fhq_A 1fhr_A* 1j4k_A* 1j4l_A* 1k2m_A* 1k2n_A* Back     alignment and structure
>3els_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4h87_A Kanadaptin; FHA domain of PF00498, mRNA processing, nucleus, structural joint center for structural genomics, JCSG, protein structu initiative; HET: SO4; 1.55A {Homo sapiens} Back     alignment and structure
>1qu5_A Protein kinase SPK1; FHA, RAD53, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3fm8_A Kinesin-like protein KIF13B; kinesin, GAP, GTPase activation, structural genomics consort ATP-binding, cytoskeleton, microtubule, motor protein, NUCL binding; 2.30A {Homo sapiens} PDB: 3mdb_A* Back     alignment and structure
>3elv_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 2.40A {Saccharomyces cerevisiae} PDB: 2jkd_A Back     alignment and structure
>4ejq_A Kinesin-like protein KIF1A; homodimer, FHA domain, transport protein; 1.89A {Homo sapiens} PDB: 2eh0_A 2g1l_A Back     alignment and structure
>3huf_A DNA repair and telomere maintenance protein NBS1; NBS1, FHA domain, BRCT domain, phosphoprotein binding, phosp binding, DNA repair; HET: DNA TPO; 2.15A {Schizosaccharomyces pombe} PDB: 3hue_A* 3i0m_A* 3i0n_A* Back     alignment and structure
>3kt9_A Aprataxin; FHA domain, beta sandwich, beta sheet, AMP hydrolase, alternative splicing, disease mutation, DNA damage, DNA repair, DNA-binding; 1.65A {Homo sapiens} SCOP: b.26.1.0 Back     alignment and structure
>3uv0_A Mutator 2, isoform B; FHA, protein binding, dimerization; 1.90A {Drosophila melanogaster} Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>2brf_A Bifunctional polynucleotide phosphatase/kinase; hydrolase/transferase, FHA, forkhead-associated, PNKP, PNK, polynucleotide kinase 3' phosphatase; 1.40A {Homo sapiens} SCOP: b.26.1.2 PDB: 2w3o_A* 1yjm_A* Back     alignment and structure
>1ujx_A Polynucleotide kinase 3'-phosphatase; DNA repair, FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif; NMR {Mus musculus} SCOP: b.26.1.2 Back     alignment and structure
>1yj5_C 5' polynucleotide kinase-3' phosphatase FHA domai; beta sandwich, P-loop, transferase; 2.80A {Mus musculus} SCOP: b.26.1.2 Back     alignment and structure
>4egx_A Kinesin-like protein KIF1A; FHA domain, transport protein; 2.51A {Homo sapiens} Back     alignment and structure
>4a0e_A YSCD, type III secretion protein; transport protein, SAD phasing, type III secretion system; 2.04A {Yersinia pestis} PDB: 4d9v_A Back     alignment and structure
>1uss_A Histone H1; DNA binding protein, linker histone, DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: a.4.5.13 PDB: 1yqa_A Back     alignment and structure
>1uhm_A Histone H1, histone HHO1P; winged helix-turn-helix, linker histone, riken structural genomics/proteomics initiative, RSGI; NMR {Saccharomyces cerevisiae} SCOP: a.4.5.13 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 349
d2c6ya198 a.4.5.14 (A:1-98) Interleukin enhancer binding fac 1e-19
d2c6ya198 a.4.5.14 (A:1-98) Interleukin enhancer binding fac 4e-18
d2hdca_97 a.4.5.14 (A:) Genesis {Rat (Rattus norvegicus) [Ta 2e-18
d2hdca_97 a.4.5.14 (A:) Genesis {Rat (Rattus norvegicus) [Ta 4e-17
d1d5va_94 a.4.5.14 (A:) Adipocyte-transcription factor FREAC 5e-17
d1d5va_94 a.4.5.14 (A:) Adipocyte-transcription factor FREAC 2e-13
d2a07f182 a.4.5.14 (F:503-584) Forkhead box protein P2, FOXP 3e-16
d2a07f182 a.4.5.14 (F:503-584) Forkhead box protein P2, FOXP 5e-09
d1kq8a_75 a.4.5.14 (A:) HFH-1 (HNF-3 forkhead homolog-1) {Ra 1e-13
d1kq8a_75 a.4.5.14 (A:) HFH-1 (HNF-3 forkhead homolog-1) {Ra 4e-10
d3bpya185 a.4.5.14 (A:93-177) Afx (Foxo4) {Human (Homo sapie 1e-13
d3bpya185 a.4.5.14 (A:93-177) Afx (Foxo4) {Human (Homo sapie 6e-09
d1uhta_118 b.26.1.2 (A:) FHA domain containing protein At4G14 2e-05
d2ff4a399 b.26.1.2 (A:284-382) Probable regulatory protein E 0.003
>d2c6ya1 a.4.5.14 (A:1-98) Interleukin enhancer binding factor {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: Forkhead DNA-binding domain
domain: Interleukin enhancer binding factor
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 80.3 bits (198), Expect = 1e-19
 Identities = 46/51 (90%), Positives = 47/51 (92%)

Query: 102 GNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPGSEHKLIEQAFRRRRQR 152
            NSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDP SE KLIEQAFR+RR R
Sbjct: 48  QNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASESKLIEQAFRKRRPR 98
>d2c6ya1 a.4.5.14 (A:1-98) Interleukin enhancer binding factor {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2hdca_ a.4.5.14 (A:) Genesis {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 97 Back     information, alignment and structure
>d2hdca_ a.4.5.14 (A:) Genesis {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 97 Back     information, alignment and structure
>d1d5va_ a.4.5.14 (A:) Adipocyte-transcription factor FREAC-11 (s12, fkh-14) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1d5va_ a.4.5.14 (A:) Adipocyte-transcription factor FREAC-11 (s12, fkh-14) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2a07f1 a.4.5.14 (F:503-584) Forkhead box protein P2, FOXP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2a07f1 a.4.5.14 (F:503-584) Forkhead box protein P2, FOXP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1kq8a_ a.4.5.14 (A:) HFH-1 (HNF-3 forkhead homolog-1) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 75 Back     information, alignment and structure
>d1kq8a_ a.4.5.14 (A:) HFH-1 (HNF-3 forkhead homolog-1) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 75 Back     information, alignment and structure
>d3bpya1 a.4.5.14 (A:93-177) Afx (Foxo4) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d3bpya1 a.4.5.14 (A:93-177) Afx (Foxo4) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1uhta_ b.26.1.2 (A:) FHA domain containing protein At4G14490 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 118 Back     information, alignment and structure
>d2ff4a3 b.26.1.2 (A:284-382) Probable regulatory protein EmbR, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 99 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query349
d2c6ya198 Interleukin enhancer binding factor {Human (Homo s 99.94
d1d5va_94 Adipocyte-transcription factor FREAC-11 (s12, fkh- 99.94
d2a07f182 Forkhead box protein P2, FOXP2 {Human (Homo sapien 99.94
d2hdca_97 Genesis {Rat (Rattus norvegicus) [TaxId: 10116]} 99.93
d3bpya185 Afx (Foxo4) {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1kq8a_75 HFH-1 (HNF-3 forkhead homolog-1) {Rat (Rattus norv 99.91
d2c6ya198 Interleukin enhancer binding factor {Human (Homo s 99.68
d2hdca_97 Genesis {Rat (Rattus norvegicus) [TaxId: 10116]} 99.65
d1kq8a_75 HFH-1 (HNF-3 forkhead homolog-1) {Rat (Rattus norv 99.56
d1d5va_94 Adipocyte-transcription factor FREAC-11 (s12, fkh- 99.55
d3bpya185 Afx (Foxo4) {Human (Homo sapiens) [TaxId: 9606]} 99.33
d2a07f182 Forkhead box protein P2, FOXP2 {Human (Homo sapien 99.14
d1lgpa_113 Cell cycle checkpoint protein Chfr {Human (Homo sa 98.28
d2ff4a399 Probable regulatory protein EmbR, C-terminal domai 98.17
d1gxca_116 Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} 98.13
d1uhta_118 FHA domain containing protein At4G14490 {Thale cre 98.12
d2brfa1101 Polynucleotide kinase 3'-phosphatase {Human (Homo 98.07
d2piea1127 Ubiquitin ligase protein RNF8 {Human (Homo sapiens 98.04
d1g6ga_127 Phosphotyrosine binding domain of Rad53 {Baker's y 97.93
d2affa198 Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} 97.86
d1wlna1107 Afadin {Mouse (Mus musculus) [TaxId: 10090]} 97.71
d1mzka_122 Kinase associated protein phosphatase {Thale cress 97.67
d1dmza_158 Phosphotyrosine binding domain of Rad53 {Baker's y 97.42
d2g1la1102 Kinesin-like protein kif1c {Human (Homo sapiens) [ 97.15
d1ussa_88 Histone H1 homologue Hho1p {Baker's yeast (Sacchar 92.33
d1usta_92 Histone H1 homologue Hho1p {Baker's yeast (Sacchar 88.96
d1hsta_74 Histone H5, globular domain {Chicken (Gallus gallu 87.94
>d2c6ya1 a.4.5.14 (A:1-98) Interleukin enhancer binding factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: Forkhead DNA-binding domain
domain: Interleukin enhancer binding factor
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.94  E-value=7.4e-29  Score=198.09  Aligned_cols=61  Identities=67%  Similarity=0.982  Sum_probs=59.7

Q ss_pred             CCCCCCCHHHHHHHHHHcCCCCCcCHHHHHHHHhccCCCcccCCCCCcccchhhhccCccc
Q psy7734         288 DSKPPYSYAQLIVQAVASAHDKQLTLSGIYSFITKNYPYYRTADKGWQVNYTYLDTTSVVA  348 (349)
Q Consensus       288 ~~kPp~sY~~lI~~Ai~~sp~~~ltl~~Iy~~i~~~~pyy~~~~~gWqnsiRhnLs~~~~~  348 (349)
                      +.||||||++||+|||+++|+++|||+|||+||+++|||||.+..|||||||||||...||
T Consensus         1 ~~KP~~sY~~LI~~Ai~~sp~~~ltL~eIy~~i~~~fpyfr~~~~gWkNSIRHnLS~n~~F   61 (98)
T d2c6ya1           1 DSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYF   61 (98)
T ss_dssp             CCCCSSCHHHHHHHHHHTSTTSCEEHHHHHHHHHHHCTTSCTTCHHHHHHHHHHHHHSTTE
T ss_pred             CCCCCccHHHHHHHHHHhCCCCCccHHHHHHHHHHhCcccccCCCCcchhhchhcccccce
Confidence            5799999999999999999999999999999999999999999999999999999999998
>d1d5va_ a.4.5.14 (A:) Adipocyte-transcription factor FREAC-11 (s12, fkh-14) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a07f1 a.4.5.14 (F:503-584) Forkhead box protein P2, FOXP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hdca_ a.4.5.14 (A:) Genesis {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3bpya1 a.4.5.14 (A:93-177) Afx (Foxo4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kq8a_ a.4.5.14 (A:) HFH-1 (HNF-3 forkhead homolog-1) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c6ya1 a.4.5.14 (A:1-98) Interleukin enhancer binding factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hdca_ a.4.5.14 (A:) Genesis {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kq8a_ a.4.5.14 (A:) HFH-1 (HNF-3 forkhead homolog-1) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1d5va_ a.4.5.14 (A:) Adipocyte-transcription factor FREAC-11 (s12, fkh-14) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpya1 a.4.5.14 (A:93-177) Afx (Foxo4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a07f1 a.4.5.14 (F:503-584) Forkhead box protein P2, FOXP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lgpa_ b.26.1.2 (A:) Cell cycle checkpoint protein Chfr {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a3 b.26.1.2 (A:284-382) Probable regulatory protein EmbR, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gxca_ b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhta_ b.26.1.2 (A:) FHA domain containing protein At4G14490 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2brfa1 b.26.1.2 (A:8-108) Polynucleotide kinase 3'-phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2piea1 b.26.1.2 (A:13-139) Ubiquitin ligase protein RNF8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6ga_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2affa1 b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlna1 b.26.1.2 (A:8-114) Afadin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mzka_ b.26.1.2 (A:) Kinase associated protein phosphatase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1dmza_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g1la1 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ussa_ a.4.5.13 (A:) Histone H1 homologue Hho1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1usta_ a.4.5.13 (A:) Histone H1 homologue Hho1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hsta_ a.4.5.13 (A:) Histone H5, globular domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure