Psyllid ID: psy7748
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 232 | ||||||
| 328715060 | 452 | PREDICTED: hypothetical protein LOC10016 | 0.913 | 0.469 | 0.532 | 1e-61 | |
| 239790368 | 220 | ACYPI007678 [Acyrthosiphon pisum] | 0.918 | 0.968 | 0.529 | 1e-61 | |
| 405977108 | 223 | U8 snoRNA-decapping enzyme [Crassostrea | 0.905 | 0.941 | 0.483 | 7e-50 | |
| 242004576 | 211 | Nucleoside diphosphate-linked moiety X m | 0.806 | 0.886 | 0.484 | 7e-45 | |
| 340368437 | 208 | PREDICTED: u8 snoRNA-decapping enzyme-li | 0.745 | 0.831 | 0.457 | 5e-35 | |
| 443707650 | 167 | hypothetical protein CAPTEDRAFT_112241, | 0.607 | 0.844 | 0.506 | 3e-34 | |
| 403265863 | 195 | PREDICTED: U8 snoRNA-decapping enzyme-li | 0.711 | 0.846 | 0.455 | 1e-33 | |
| 291399629 | 223 | PREDICTED: nudix-type motif 16 [Oryctola | 0.685 | 0.713 | 0.465 | 1e-33 | |
| 291399631 | 195 | PREDICTED: syndesmos-like [Oryctolagus c | 0.685 | 0.815 | 0.465 | 1e-33 | |
| 443711243 | 146 | hypothetical protein CAPTEDRAFT_51452, p | 0.599 | 0.952 | 0.507 | 1e-33 |
| >gi|328715060|ref|XP_001951778.2| PREDICTED: hypothetical protein LOC100166838 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 242 bits (617), Expect = 1e-61, Method: Compositional matrix adjust.
Identities = 116/218 (53%), Positives = 158/218 (72%), Gaps = 6/218 (2%)
Query: 5 NTGDRTWGSSAWNLAATEVYGRPSTNLNDFIELTQSDLKDDKYKSGYHASHCMIFAYNDD 64
+TGDRTWG W L +TE +GRP N+FI + +S++ +KY HA+HC I+A N++
Sbjct: 235 STGDRTWG---W-LGSTEEFGRPPEP-NEFIVIPKSEIHCEKYAGSNHAAHCFIYAENNE 289
Query: 65 KIFATYTARANVLMQMRFDGYIGFPGGLVDAGESPLEALNRELNEEINLNPK-YKVKDSD 123
++F Y RA++LMQ+R+DGY GFPGGL+DAGE + A+NRE+ EEINLN + V D
Sbjct: 290 RVFDIYNPRASILMQLRYDGYFGFPGGLIDAGEDFVSAVNREMVEEINLNTTIHSVNHDD 349
Query: 124 LVCIHYSQSKKIILHFYALQVEKTDVLEIEKGALTSHDYGVEVLGTVRVPLYTMGDGFRG 183
+ H+S+ K ++LHFY L+V TD++EIE+ A + DYG EVLGT+RVPLYT+GD +RG
Sbjct: 350 HIISHWSEKKNLVLHFYKLKVNMTDLIEIERQASLARDYGTEVLGTIRVPLYTLGDHYRG 409
Query: 184 LPCFLTHSFIGNAKHQLLAALLKLKILSPEEINQALNA 221
P FL H+FIG ++ QL+AAL L IL+PEEI ALNA
Sbjct: 410 FPVFLNHNFIGCSRDQLIAALTSLNILTPEEIQLALNA 447
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|239790368|dbj|BAH71749.1| ACYPI007678 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|405977108|gb|EKC41574.1| U8 snoRNA-decapping enzyme [Crassostrea gigas] | Back alignment and taxonomy information |
|---|
| >gi|242004576|ref|XP_002423158.1| Nucleoside diphosphate-linked moiety X motif, putative [Pediculus humanus corporis] gi|212506115|gb|EEB10420.1| Nucleoside diphosphate-linked moiety X motif, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|340368437|ref|XP_003382758.1| PREDICTED: u8 snoRNA-decapping enzyme-like [Amphimedon queenslandica] | Back alignment and taxonomy information |
|---|
| >gi|443707650|gb|ELU03163.1| hypothetical protein CAPTEDRAFT_112241, partial [Capitella teleta] | Back alignment and taxonomy information |
|---|
| >gi|403265863|ref|XP_003925131.1| PREDICTED: U8 snoRNA-decapping enzyme-like [Saimiri boliviensis boliviensis] | Back alignment and taxonomy information |
|---|
| >gi|291399629|ref|XP_002716216.1| PREDICTED: nudix-type motif 16 [Oryctolagus cuniculus] | Back alignment and taxonomy information |
|---|
| >gi|291399631|ref|XP_002716217.1| PREDICTED: syndesmos-like [Oryctolagus cuniculus] | Back alignment and taxonomy information |
|---|
| >gi|443711243|gb|ELU05085.1| hypothetical protein CAPTEDRAFT_51452, partial [Capitella teleta] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 232 | ||||||
| UNIPROTKB|Q96DE0 | 195 | NUDT16 "U8 snoRNA-decapping en | 0.633 | 0.753 | 0.386 | 2e-24 | |
| MGI|MGI:1922936 | 195 | Nudt16 "nudix (nucleoside diph | 0.616 | 0.733 | 0.4 | 3.8e-23 | |
| UNIPROTKB|A1A4Q9 | 195 | NUDT16 "U8 snoRNA-decapping en | 0.620 | 0.738 | 0.383 | 6.1e-23 | |
| RGD|1311387 | 195 | Nudt16 "nudix (nucleoside diph | 0.616 | 0.733 | 0.4 | 1.3e-22 | |
| UNIPROTKB|Q2V8X7 | 195 | NUDT16 "U8 snoRNA-decapping en | 0.620 | 0.738 | 0.383 | 1.6e-22 | |
| UNIPROTKB|Q9IAY5 | 314 | SDOS "Protein syndesmos" [Gall | 0.75 | 0.554 | 0.338 | 3.4e-22 | |
| ZFIN|ZDB-GENE-041010-100 | 208 | zgc:103759 "zgc:103759" [Danio | 0.732 | 0.817 | 0.36 | 9e-22 | |
| UNIPROTKB|Q3MHX9 | 211 | NUDT16L1 "Uncharacterized prot | 0.724 | 0.796 | 0.327 | 3.5e-20 | |
| UNIPROTKB|F1Q0M6 | 149 | NUDT16 "Uncharacterized protei | 0.504 | 0.785 | 0.428 | 3.5e-20 | |
| UNIPROTKB|F1RK69 | 211 | NUDT16L1 "Uncharacterized prot | 0.724 | 0.796 | 0.327 | 3.5e-20 |
| UNIPROTKB|Q96DE0 NUDT16 "U8 snoRNA-decapping enzyme" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 279 (103.3 bits), Expect = 2.0e-24, P = 2.0e-24
Identities = 58/150 (38%), Positives = 85/150 (56%)
Query: 49 SGY-HASHCMIFAYNDDKIFATYTARANVLMQMRFDGYIGFPGGLVDAGESPXXXXXXXX 107
SG+ HA H +++A + +F R +LMQMRFDG +GFPGG VD +
Sbjct: 17 SGWRHACHALLYAPDPGMLFGRIPLRYAILMQMRFDGRLGFPGGFVDTQDRSLEDGLNRE 76
Query: 108 XXXXX--XXPKYKVKDSDLVCIHYSQSKKIILHFYALQVEKTDVLEIEKGALTSHDYGVE 165
++V+ +D H +++ HFYA ++ ++L +E GA + D+G+E
Sbjct: 77 LREELGEAAAAFRVERTDYRSSHVGSGPRVVAHFYAKRLTLEELLAVEAGATRAKDHGLE 136
Query: 166 VLGTVRVPLYTMGDGFRGLPCFLTHSFIGN 195
VLG VRVPLYT+ DG GLP FL +SFIG+
Sbjct: 137 VLGLVRVPLYTLRDGVGGLPTFLENSFIGS 166
|
|
| MGI|MGI:1922936 Nudt16 "nudix (nucleoside diphosphate linked moiety X)-type motif 16" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A1A4Q9 NUDT16 "U8 snoRNA-decapping enzyme" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|1311387 Nudt16 "nudix (nucleoside diphosphate linked moiety X)-type motif 16" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2V8X7 NUDT16 "U8 snoRNA-decapping enzyme" [Ovis aries (taxid:9940)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9IAY5 SDOS "Protein syndesmos" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-041010-100 zgc:103759 "zgc:103759" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3MHX9 NUDT16L1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1Q0M6 NUDT16 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RK69 NUDT16L1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 232 | |||
| pfam00293 | 133 | pfam00293, NUDIX, NUDIX domain | 3e-11 | |
| cd02883 | 123 | cd02883, Nudix_Hydrolase, Nudix hydrolase is a sup | 4e-09 | |
| cd03425 | 124 | cd03425, MutT_pyrophosphohydrolase, The MutT pyrop | 1e-08 | |
| cd04682 | 122 | cd04682, Nudix_Hydrolase_23, Members of the Nudix | 1e-08 | |
| cd03424 | 137 | cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase | 1e-08 | |
| PRK11762 | 185 | PRK11762, nudE, adenosine nucleotide hydrolase Nud | 5e-08 | |
| PRK00714 | 156 | PRK00714, PRK00714, RNA pyrophosphohydrolase; Revi | 2e-07 | |
| COG1051 | 145 | COG1051, COG1051, ADP-ribose pyrophosphatase [Nucl | 3e-07 | |
| cd04690 | 118 | cd04690, Nudix_Hydrolase_31, Members of the Nudix | 3e-07 | |
| cd03671 | 147 | cd03671, Ap4A_hydrolase_plant_like, Diadenosine te | 3e-07 | |
| COG0494 | 161 | COG0494, MutT, NTP pyrophosphohydrolases including | 6e-07 | |
| cd03427 | 137 | cd03427, MTH1, MutT homolog-1 (MTH1) is a member o | 2e-06 | |
| PRK10776 | 129 | PRK10776, PRK10776, nucleoside triphosphate pyroph | 2e-06 | |
| cd04691 | 117 | cd04691, Nudix_Hydrolase_32, Members of the Nudix | 8e-06 | |
| PRK08999 | 312 | PRK08999, PRK08999, hypothetical protein; Provisio | 8e-06 | |
| cd04677 | 132 | cd04677, Nudix_Hydrolase_18, Members of the Nudix | 2e-05 | |
| cd04686 | 131 | cd04686, Nudix_Hydrolase_27, Members of the Nudix | 2e-05 | |
| PRK10546 | 135 | PRK10546, PRK10546, pyrimidine (deoxy)nucleoside t | 2e-05 | |
| cd04676 | 129 | cd04676, Nudix_Hydrolase_17, Members of the Nudix | 4e-05 | |
| cd04673 | 122 | cd04673, Nudix_Hydrolase_15, Members of the Nudix | 5e-05 | |
| cd04667 | 112 | cd04667, Nudix_Hydrolase_10, Members of the Nudix | 9e-05 | |
| cd03428 | 130 | cd03428, Ap4A_hydrolase_human_like, Diadenosine te | 1e-04 | |
| cd04681 | 130 | cd04681, Nudix_Hydrolase_22, Members of the Nudix | 1e-04 | |
| cd03426 | 157 | cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse) | 1e-04 | |
| cd04664 | 129 | cd04664, Nudix_Hydrolase_7, Members of the Nudix h | 3e-04 | |
| TIGR00586 | 128 | TIGR00586, mutt, mutator mutT protein | 3e-04 | |
| cd04665 | 118 | cd04665, Nudix_Hydrolase_8, Members of the Nudix h | 4e-04 | |
| cd04684 | 128 | cd04684, Nudix_Hydrolase_25, Contains a crystal st | 5e-04 | |
| cd04669 | 121 | cd04669, Nudix_Hydrolase_11, Members of the Nudix | 5e-04 | |
| cd04683 | 120 | cd04683, Nudix_Hydrolase_24, Members of the Nudix | 6e-04 | |
| TIGR02705 | 156 | TIGR02705, nudix_YtkD, nucleoside triphosphatase Y | 7e-04 | |
| cd04692 | 144 | cd04692, Nudix_Hydrolase_33, Members of the Nudix | 0.001 | |
| cd04685 | 133 | cd04685, Nudix_Hydrolase_26, Members of the Nudix | 0.001 | |
| cd04680 | 120 | cd04680, Nudix_Hydrolase_21, Members of the Nudix | 0.002 | |
| cd04696 | 125 | cd04696, Nudix_Hydrolase_37, Members of the Nudix | 0.003 |
| >gnl|CDD|215841 pfam00293, NUDIX, NUDIX domain | Back alignment and domain information |
|---|
Score = 59.0 bits (143), Expect = 3e-11
Identities = 22/91 (24%), Positives = 31/91 (34%), Gaps = 5/91 (5%)
Query: 70 YTARANVLMQMRFD-----GYIGFPGGLVDAGESPLEALNRELNEEINLNPKYKVKDSDL 124
VL+ R G PGG V+ GESP EA REL EE L + L
Sbjct: 10 LNEDGEVLLVRRSRPPVFPGLWELPGGKVEPGESPEEAAVRELEEETGLRVLLLLLLGVL 69
Query: 125 VCIHYSQSKKIILHFYALQVEKTDVLEIEKG 155
+ +H + ++ +
Sbjct: 70 EYPAPGRDGGEHVHVFLAELLGGEPEPQPNE 100
|
Length = 133 |
| >gnl|CDD|239217 cd02883, Nudix_Hydrolase, Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|239517 cd03425, MutT_pyrophosphohydrolase, The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) | Back alignment and domain information |
|---|
| >gnl|CDD|240038 cd04682, Nudix_Hydrolase_23, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|239516 cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate | Back alignment and domain information |
|---|
| >gnl|CDD|183303 PRK11762, nudE, adenosine nucleotide hydrolase NudE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234820 PRK00714, PRK00714, RNA pyrophosphohydrolase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223979 COG1051, COG1051, ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|240046 cd04690, Nudix_Hydrolase_31, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|239643 cd03671, Ap4A_hydrolase_plant_like, Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|223568 COG0494, MutT, NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|239519 cd03427, MTH1, MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|182721 PRK10776, PRK10776, nucleoside triphosphate pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240047 cd04691, Nudix_Hydrolase_32, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|236361 PRK08999, PRK08999, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240033 cd04677, Nudix_Hydrolase_18, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240042 cd04686, Nudix_Hydrolase_27, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|182536 PRK10546, PRK10546, pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240032 cd04676, Nudix_Hydrolase_17, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240030 cd04673, Nudix_Hydrolase_15, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240025 cd04667, Nudix_Hydrolase_10, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|239520 cd03428, Ap4A_hydrolase_human_like, Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|240037 cd04681, Nudix_Hydrolase_22, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|239518 cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|240022 cd04664, Nudix_Hydrolase_7, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|200031 TIGR00586, mutt, mutator mutT protein | Back alignment and domain information |
|---|
| >gnl|CDD|240023 cd04665, Nudix_Hydrolase_8, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240040 cd04684, Nudix_Hydrolase_25, Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|240026 cd04669, Nudix_Hydrolase_11, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240039 cd04683, Nudix_Hydrolase_24, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|131752 TIGR02705, nudix_YtkD, nucleoside triphosphatase YtkD | Back alignment and domain information |
|---|
| >gnl|CDD|240048 cd04692, Nudix_Hydrolase_33, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240041 cd04685, Nudix_Hydrolase_26, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240036 cd04680, Nudix_Hydrolase_21, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240052 cd04696, Nudix_Hydrolase_37, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 232 | |||
| PRK11762 | 185 | nudE adenosine nucleotide hydrolase NudE; Provisio | 99.89 | |
| PRK15009 | 191 | GDP-mannose pyrophosphatase NudK; Provisional | 99.86 | |
| PRK10729 | 202 | nudF ADP-ribose pyrophosphatase NudF; Provisional | 99.85 | |
| TIGR00052 | 185 | nudix-type nucleoside diphosphatase, YffH/AdpP fam | 99.85 | |
| cd04679 | 125 | Nudix_Hydrolase_20 Members of the Nudix hydrolase | 99.82 | |
| cd04683 | 120 | Nudix_Hydrolase_24 Members of the Nudix hydrolase | 99.79 | |
| cd03430 | 144 | GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mann | 99.78 | |
| cd04696 | 125 | Nudix_Hydrolase_37 Members of the Nudix hydrolase | 99.78 | |
| cd04700 | 142 | DR1025_like DR1025 from Deinococcus radiodurans, a | 99.78 | |
| cd03673 | 131 | Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hy | 99.77 | |
| PRK09438 | 148 | nudB dihydroneopterin triphosphate pyrophosphatase | 99.77 | |
| cd03671 | 147 | Ap4A_hydrolase_plant_like Diadenosine tetraphospha | 99.77 | |
| cd04681 | 130 | Nudix_Hydrolase_22 Members of the Nudix hydrolase | 99.76 | |
| cd04691 | 117 | Nudix_Hydrolase_32 Members of the Nudix hydrolase | 99.76 | |
| PRK15434 | 159 | GDP-mannose mannosyl hydrolase NudD; Provisional | 99.76 | |
| cd04684 | 128 | Nudix_Hydrolase_25 Contains a crystal structure of | 99.76 | |
| cd03674 | 138 | Nudix_Hydrolase_1 Members of the Nudix hydrolase s | 99.76 | |
| cd04669 | 121 | Nudix_Hydrolase_11 Members of the Nudix hydrolase | 99.76 | |
| cd04678 | 129 | Nudix_Hydrolase_19 Members of the Nudix hydrolase | 99.76 | |
| cd04680 | 120 | Nudix_Hydrolase_21 Members of the Nudix hydrolase | 99.75 | |
| cd04687 | 128 | Nudix_Hydrolase_28 Members of the Nudix hydrolase | 99.75 | |
| cd04688 | 126 | Nudix_Hydrolase_29 Members of the Nudix hydrolase | 99.75 | |
| PLN02325 | 144 | nudix hydrolase | 99.75 | |
| cd04673 | 122 | Nudix_Hydrolase_15 Members of the Nudix hydrolase | 99.75 | |
| cd04692 | 144 | Nudix_Hydrolase_33 Members of the Nudix hydrolase | 99.75 | |
| cd04677 | 132 | Nudix_Hydrolase_18 Members of the Nudix hydrolase | 99.75 | |
| cd03428 | 130 | Ap4A_hydrolase_human_like Diadenosine tetraphospha | 99.75 | |
| cd04672 | 123 | Nudix_Hydrolase_14 Members of the Nudix hydrolase | 99.74 | |
| PRK15472 | 141 | nucleoside triphosphatase NudI; Provisional | 99.74 | |
| cd04671 | 123 | Nudix_Hydrolase_13 Members of the Nudix hydrolase | 99.74 | |
| cd04695 | 131 | Nudix_Hydrolase_36 Members of the Nudix hydrolase | 99.74 | |
| cd03672 | 145 | Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalyt | 99.74 | |
| cd03675 | 134 | Nudix_Hydrolase_2 Contains a crystal structure of | 99.73 | |
| PRK00714 | 156 | RNA pyrophosphohydrolase; Reviewed | 99.73 | |
| cd02885 | 165 | IPP_Isomerase Isopentenyl diphosphate (IPP) isomer | 99.73 | |
| cd04697 | 126 | Nudix_Hydrolase_38 Members of the Nudix hydrolase | 99.73 | |
| cd03427 | 137 | MTH1 MutT homolog-1 (MTH1) is a member of the Nudi | 99.72 | |
| cd04682 | 122 | Nudix_Hydrolase_23 Members of the Nudix hydrolase | 99.72 | |
| cd04664 | 129 | Nudix_Hydrolase_7 Members of the Nudix hydrolase s | 99.72 | |
| cd04666 | 122 | Nudix_Hydrolase_9 Members of the Nudix hydrolase s | 99.72 | |
| cd04689 | 125 | Nudix_Hydrolase_30 Members of the Nudix hydrolase | 99.72 | |
| COG1051 | 145 | ADP-ribose pyrophosphatase [Nucleotide transport a | 99.72 | |
| cd03426 | 157 | CoAse Coenzyme A pyrophosphatase (CoAse), a member | 99.72 | |
| PF00293 | 134 | NUDIX: NUDIX domain; InterPro: IPR000086 The gener | 99.71 | |
| cd04693 | 127 | Nudix_Hydrolase_34 Members of the Nudix hydrolase | 99.71 | |
| cd03424 | 137 | ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) | 99.71 | |
| cd04670 | 127 | Nudix_Hydrolase_12 Members of the Nudix hydrolase | 99.71 | |
| cd04511 | 130 | Nudix_Hydrolase_4 Members of the Nudix hydrolase s | 99.71 | |
| cd04667 | 112 | Nudix_Hydrolase_10 Members of the Nudix hydrolase | 99.71 | |
| cd04676 | 129 | Nudix_Hydrolase_17 Members of the Nudix hydrolase | 99.7 | |
| cd04690 | 118 | Nudix_Hydrolase_31 Members of the Nudix hydrolase | 99.7 | |
| cd03429 | 131 | NADH_pyrophosphatase NADH pyrophosphatase, a membe | 99.7 | |
| PRK00241 | 256 | nudC NADH pyrophosphatase; Reviewed | 99.69 | |
| cd04686 | 131 | Nudix_Hydrolase_27 Members of the Nudix hydrolase | 99.69 | |
| cd04661 | 132 | MRP_L46 Mitochondrial ribosomal protein L46 (MRP L | 99.68 | |
| PRK15393 | 180 | NUDIX hydrolase YfcD; Provisional | 99.68 | |
| TIGR02150 | 158 | IPP_isom_1 isopentenyl-diphosphate delta-isomerase | 99.68 | |
| PRK03759 | 184 | isopentenyl-diphosphate delta-isomerase; Provision | 99.66 | |
| cd04685 | 133 | Nudix_Hydrolase_26 Members of the Nudix hydrolase | 99.66 | |
| cd03676 | 180 | Nudix_hydrolase_3 Members of the Nudix hydrolase s | 99.65 | |
| cd04699 | 129 | Nudix_Hydrolase_39 Members of the Nudix hydrolase | 99.65 | |
| TIGR02705 | 156 | nudix_YtkD nucleoside triphosphatase YtkD. The fun | 99.65 | |
| PRK10707 | 190 | putative NUDIX hydrolase; Provisional | 99.65 | |
| cd04662 | 126 | Nudix_Hydrolase_5 Members of the Nudix hydrolase s | 99.64 | |
| PRK10546 | 135 | pyrimidine (deoxy)nucleoside triphosphate pyrophos | 99.64 | |
| PLN03143 | 291 | nudix hydrolase; Provisional | 99.63 | |
| PRK10776 | 129 | nucleoside triphosphate pyrophosphohydrolase; Prov | 99.61 | |
| cd04694 | 143 | Nudix_Hydrolase_35 Members of the Nudix hydrolase | 99.61 | |
| PRK05379 | 340 | bifunctional nicotinamide mononucleotide adenylylt | 99.6 | |
| cd04663 | 126 | Nudix_Hydrolase_6 Members of the Nudix hydrolase s | 99.59 | |
| TIGR00586 | 128 | mutt mutator mutT protein. All proteins in this fa | 99.59 | |
| KOG3041|consensus | 225 | 99.58 | ||
| cd02883 | 123 | Nudix_Hydrolase Nudix hydrolase is a superfamily o | 99.58 | |
| cd04665 | 118 | Nudix_Hydrolase_8 Members of the Nudix hydrolase s | 99.58 | |
| cd04674 | 118 | Nudix_Hydrolase_16 Members of the Nudix hydrolase | 99.54 | |
| PLN02709 | 222 | nudix hydrolase | 99.53 | |
| cd03425 | 124 | MutT_pyrophosphohydrolase The MutT pyrophosphohydr | 99.52 | |
| COG2816 | 279 | NPY1 NTP pyrophosphohydrolases containing a Zn-fin | 99.49 | |
| cd03670 | 186 | ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) | 99.46 | |
| PLN02791 | 770 | Nudix hydrolase homolog | 99.46 | |
| PLN02552 | 247 | isopentenyl-diphosphate delta-isomerase | 99.44 | |
| PRK08999 | 312 | hypothetical protein; Provisional | 99.38 | |
| KOG2839|consensus | 145 | 99.26 | ||
| COG0494 | 161 | MutT NTP pyrophosphohydrolases including oxidative | 99.2 | |
| KOG3084|consensus | 345 | 99.19 | ||
| KOG3069|consensus | 246 | 99.13 | ||
| COG1443 | 185 | Idi Isopentenyldiphosphate isomerase [Lipid metabo | 98.92 | |
| PLN02839 | 372 | nudix hydrolase | 98.79 | |
| COG4119 | 161 | Predicted NTP pyrophosphohydrolase [DNA replicatio | 98.77 | |
| cd03431 | 118 | DNA_Glycosylase_C DNA glycosylase (MutY in bacteri | 98.71 | |
| KOG0648|consensus | 295 | 98.66 | ||
| PF14815 | 114 | NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3 | 97.97 | |
| KOG4195|consensus | 275 | 97.76 | ||
| KOG0142|consensus | 225 | 97.72 | ||
| KOG4432|consensus | 405 | 97.64 | ||
| PF13869 | 188 | NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B | 97.04 | |
| COG4112 | 203 | Predicted phosphoesterase (MutT family) [General f | 96.47 | |
| KOG2937|consensus | 348 | 96.14 | ||
| KOG4432|consensus | 405 | 95.85 | ||
| KOG1689|consensus | 221 | 95.32 | ||
| KOG4313|consensus | 306 | 94.96 | ||
| PRK10880 | 350 | adenine DNA glycosylase; Provisional | 90.71 | |
| KOG4548|consensus | 263 | 88.46 |
| >PRK11762 nudE adenosine nucleotide hydrolase NudE; Provisional | Back alignment and domain information |
|---|
Probab=99.89 E-value=2.1e-22 Score=160.44 Aligned_cols=147 Identities=22% Similarity=0.242 Sum_probs=100.1
Q ss_pred CCCcccccceeeeeecCCccCcc-ccccccCCcccccccCC--ccceEEEEEEecCCceEEEEeccCcEEEEEEee---C
Q psy7748 10 TWGSSAWNLAATEVYGRPSTNLN-DFIELTQSDLKDDKYKS--GYHASHCMIFAYNDDKIFATYTARANVLMQMRF---D 83 (232)
Q Consensus 10 ~w~~~~~~~~~~~vy~~~~~~~~-~~~~~~~~~~~~~~~~~--~~~a~~~vi~~~~~~~v~~~~~~~~~vLl~~R~---~ 83 (232)
+|+. ++++++|+++|++++ +.+++|+|....+.... ...+++++++..++.++ ++.|+|+ .
T Consensus 7 ~~~~----~~~~~v~~~~~~~v~~~~~~~~~G~~~~~~~v~~~~~~~v~v~~~~~~~~vl---------Lvrq~r~~~~~ 73 (185)
T PRK11762 7 KPEI----LNRETVAKSRLFRVESVDLEFSNGVERVYERMRPSGRGAVMIVPILDDDTLL---------LIREYAAGTER 73 (185)
T ss_pred CCEE----eeEEEEEeCCEEEEEEEEEEcCCCCEEEEEEEecCCCCEEEEEEEeCCCEEE---------EEEeecCCCCC
Confidence 6777 999999999999999 89999999876655422 23345555565443221 2233343 3
Q ss_pred CeeecceeecCCCCCHHHHHhHHHHHhhCCCCc-ceeeeceeeeeeecCCcEEEEEEEEEEeecCcccccccccccccCC
Q psy7748 84 GYIGFPGGLVDAGESPLEALNRELNEEINLNPK-YKVKDSDLVCIHYSQSKKIILHFYALQVEKTDVLEIEKGALTSHDY 162 (232)
Q Consensus 84 g~w~lPgG~ve~gEs~~~aa~REl~EEtGl~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 162 (232)
+.|+||||.+|+||++++||+||++||||+.+. +..+...+..... ....+++|.+........ ..+
T Consensus 74 ~~~elPaG~ve~gE~~~~aA~REl~EEtG~~~~~l~~l~~~~~~~~~---~~~~~~~f~a~~~~~~~~--------~~~- 141 (185)
T PRK11762 74 YELGFPKGLIDPGETPLEAANRELKEEVGFGARQLTFLKELSLAPSY---FSSKMNIVLAEDLYPERL--------EGD- 141 (185)
T ss_pred cEEEccceeCCCCCCHHHHHHHHHHHHHCCCCcceEEEEEEecCCCc---cCcEEEEEEEEccccccC--------CCC-
Confidence 579999999999999999999999999999998 6555444433222 223444444432211110 112
Q ss_pred CccceeeEeeeCccccccc
Q psy7748 163 GVEVLGTVRVPLYTMGDGF 181 (232)
Q Consensus 163 ~~E~~~~~wvpl~el~~~i 181 (232)
+.|.+++.|+|++++.+++
T Consensus 142 e~E~i~~~~~~~~e~~~~~ 160 (185)
T PRK11762 142 EPEPLEVVRWPLADLDELL 160 (185)
T ss_pred CCceeEEEEEcHHHHHHHH
Confidence 2578899999999999886
|
|
| >PRK15009 GDP-mannose pyrophosphatase NudK; Provisional | Back alignment and domain information |
|---|
| >PRK10729 nudF ADP-ribose pyrophosphatase NudF; Provisional | Back alignment and domain information |
|---|
| >TIGR00052 nudix-type nucleoside diphosphatase, YffH/AdpP family | Back alignment and domain information |
|---|
| >cd04679 Nudix_Hydrolase_20 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04683 Nudix_Hydrolase_24 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities | Back alignment and domain information |
|---|
| >cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >PRK09438 nudB dihydroneopterin triphosphate pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd03671 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK15434 GDP-mannose mannosyl hydrolase NudD; Provisional | Back alignment and domain information |
|---|
| >cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function | Back alignment and domain information |
|---|
| >cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04669 Nudix_Hydrolase_11 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04687 Nudix_Hydrolase_28 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04688 Nudix_Hydrolase_29 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PLN02325 nudix hydrolase | Back alignment and domain information |
|---|
| >cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04692 Nudix_Hydrolase_33 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03428 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd04672 Nudix_Hydrolase_14 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK15472 nucleoside triphosphatase NudI; Provisional | Back alignment and domain information |
|---|
| >cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04695 Nudix_Hydrolase_36 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex | Back alignment and domain information |
|---|
| >cd03675 Nudix_Hydrolase_2 Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function | Back alignment and domain information |
|---|
| >PRK00714 RNA pyrophosphohydrolase; Reviewed | Back alignment and domain information |
|---|
| >cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway | Back alignment and domain information |
|---|
| >cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04666 Nudix_Hydrolase_9 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >COG1051 ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd03426 CoAse Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes | Back alignment and domain information |
|---|
| >PF00293 NUDIX: NUDIX domain; InterPro: IPR000086 The generic name 'NUDIX hydrolases' (NUcleoside DIphosphate linked to some other moiety X) has been coined for this domain family [] | Back alignment and domain information |
|---|
| >cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate | Back alignment and domain information |
|---|
| >cd04670 Nudix_Hydrolase_12 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP | Back alignment and domain information |
|---|
| >PRK00241 nudC NADH pyrophosphatase; Reviewed | Back alignment and domain information |
|---|
| >cd04686 Nudix_Hydrolase_27 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >PRK15393 NUDIX hydrolase YfcD; Provisional | Back alignment and domain information |
|---|
| >TIGR02150 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, type 1 | Back alignment and domain information |
|---|
| >PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04685 Nudix_Hydrolase_26 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03676 Nudix_hydrolase_3 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04699 Nudix_Hydrolase_39 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >TIGR02705 nudix_YtkD nucleoside triphosphatase YtkD | Back alignment and domain information |
|---|
| >PRK10707 putative NUDIX hydrolase; Provisional | Back alignment and domain information |
|---|
| >cd04662 Nudix_Hydrolase_5 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN03143 nudix hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK10776 nucleoside triphosphate pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd04694 Nudix_Hydrolase_35 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04663 Nudix_Hydrolase_6 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >TIGR00586 mutt mutator mutT protein | Back alignment and domain information |
|---|
| >KOG3041|consensus | Back alignment and domain information |
|---|
| >cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04665 Nudix_Hydrolase_8 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04674 Nudix_Hydrolase_16 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PLN02709 nudix hydrolase | Back alignment and domain information |
|---|
| >cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) | Back alignment and domain information |
|---|
| >COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd03670 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P | Back alignment and domain information |
|---|
| >PLN02791 Nudix hydrolase homolog | Back alignment and domain information |
|---|
| >PLN02552 isopentenyl-diphosphate delta-isomerase | Back alignment and domain information |
|---|
| >PRK08999 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2839|consensus | Back alignment and domain information |
|---|
| >COG0494 MutT NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] | Back alignment and domain information |
|---|
| >KOG3084|consensus | Back alignment and domain information |
|---|
| >KOG3069|consensus | Back alignment and domain information |
|---|
| >COG1443 Idi Isopentenyldiphosphate isomerase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PLN02839 nudix hydrolase | Back alignment and domain information |
|---|
| >COG4119 Predicted NTP pyrophosphohydrolase [DNA replication, recombination, and repair / General function prediction only] | Back alignment and domain information |
|---|
| >cd03431 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone | Back alignment and domain information |
|---|
| >KOG0648|consensus | Back alignment and domain information |
|---|
| >PF14815 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3FSQ_A 1RRS_A 3FSP_A | Back alignment and domain information |
|---|
| >KOG4195|consensus | Back alignment and domain information |
|---|
| >KOG0142|consensus | Back alignment and domain information |
|---|
| >KOG4432|consensus | Back alignment and domain information |
|---|
| >PF13869 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 3Q2S_A 3P5T_D 3BAP_A 2CL3_A 3P6Y_A 3Q2T_B 3BHO_A 3N9U_A | Back alignment and domain information |
|---|
| >COG4112 Predicted phosphoesterase (MutT family) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2937|consensus | Back alignment and domain information |
|---|
| >KOG4432|consensus | Back alignment and domain information |
|---|
| >KOG1689|consensus | Back alignment and domain information |
|---|
| >KOG4313|consensus | Back alignment and domain information |
|---|
| >PRK10880 adenine DNA glycosylase; Provisional | Back alignment and domain information |
|---|
| >KOG4548|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 232 | ||||
| 3mgm_A | 200 | Crystal Structure Of Human Nudt16 Length = 200 | 5e-26 | ||
| 3cou_A | 217 | Crystal Structure Of Human Nudix Motif 16 (Nudt16) | 2e-25 | ||
| 3kvh_A | 214 | Crystal Structure Of Human Protein Syndesmos (Nudt1 | 9e-21 | ||
| 2a8r_A | 212 | 2.45 Angstrom Crystal Structure Of The Complex Betw | 5e-18 | ||
| 2a8p_A | 212 | 2.7 Angstrom Crystal Structure Of The Complex Betwe | 5e-18 | ||
| 1u20_A | 212 | Crystal Structure Of Xenopus Laevis Nudix Hydrolase | 5e-18 |
| >pdb|3MGM|A Chain A, Crystal Structure Of Human Nudt16 Length = 200 | Back alignment and structure |
|
| >pdb|3COU|A Chain A, Crystal Structure Of Human Nudix Motif 16 (Nudt16) Length = 217 | Back alignment and structure |
| >pdb|3KVH|A Chain A, Crystal Structure Of Human Protein Syndesmos (Nudt16-Like Protein) Length = 214 | Back alignment and structure |
| >pdb|2A8R|A Chain A, 2.45 Angstrom Crystal Structure Of The Complex Between The Nuclear Snorna Decapping Nudix Hydrolase X29 And Manganese In The Presence Of 7-Methyl-Gtp Length = 212 | Back alignment and structure |
| >pdb|2A8P|A Chain A, 2.7 Angstrom Crystal Structure Of The Complex Between The Nuclear Snorna Decapping Nudix Hydrolase X29 And Manganese Length = 212 | Back alignment and structure |
| >pdb|1U20|A Chain A, Crystal Structure Of Xenopus Laevis Nudix Hydrolase Nuclear Snorna Decapping Protein X29 Length = 212 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 232 | |||
| 3kvh_A | 214 | Protein syndesmos; NUDT16-like, NUDT16L1, nudix, R | 9e-61 | |
| 1u20_A | 212 | U8 snoRNA-binding protein X29; modified nudix hydr | 5e-56 | |
| 2xsq_A | 217 | U8 snoRNA-decapping enzyme; hydrolase, mRNA decapp | 6e-55 | |
| 2azw_A | 148 | MUTT/nudix family protein; MUTT/nudix ,enterococcu | 3e-10 | |
| 3r03_A | 144 | Nudix hydrolase; structural genomics, PSI2, protei | 3e-10 | |
| 4dyw_A | 157 | MUTT/nudix family protein; structural genomics, ni | 4e-10 | |
| 3q93_A | 176 | 7,8-dihydro-8-oxoguanine triphosphatase; structura | 4e-10 | |
| 1mut_A | 129 | MUTT, nucleoside triphosphate pyrophosphohydrolase | 7e-10 | |
| 3exq_A | 161 | Nudix family hydrolase; protein structure initiati | 9e-10 | |
| 3gwy_A | 140 | Putative CTP pyrophosphohydrolase; structural geno | 1e-09 | |
| 3ees_A | 153 | Probable pyrophosphohydrolase; nudix, RNA pyrophos | 1e-09 | |
| 3grn_A | 153 | MUTT related protein; structural genomics, hydrola | 1e-09 | |
| 2rrk_A | 140 | ORF135, CTP pyrophosphohydrolase; NMR {Escherichia | 1e-09 | |
| 3fk9_A | 188 | Mutator MUTT protein; structural genomics, hydrola | 2e-09 | |
| 3hhj_A | 158 | Mutator MUTT protein; niaid, ssgcid, decode, UW, S | 2e-09 | |
| 2b06_A | 155 | MUTT/nudix family protein; structural genomics, P | 4e-09 | |
| 3son_A | 149 | Hypothetical nudix hydrolase; structural genomics, | 2e-08 | |
| 3f13_A | 163 | Putative nudix hydrolase family member; structural | 3e-08 | |
| 2jvb_A | 146 | Protein PSU1, mRNA-decapping enzyme subunit 2; DCP | 3e-08 | |
| 3id9_A | 171 | MUTT/nudix family protein; hydrolase, protein stru | 3e-08 | |
| 2pqv_A | 154 | MUTT/nudix family protein; structu genomics, PSI-2 | 3e-08 | |
| 3oga_A | 165 | Nucleoside triphosphatase NUDI; salmonella enteric | 3e-08 | |
| 2dsc_A | 212 | ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP | 4e-08 | |
| 3gg6_A | 156 | Nudix motif 18, nucleoside diphosphate-linked moie | 6e-08 | |
| 3eds_A | 153 | MUTT/nudix family protein; MUT/nudix protein, prot | 1e-07 | |
| 1vhz_A | 198 | ADP compounds hydrolase NUDE; structural genomics; | 2e-07 | |
| 1k2e_A | 156 | Nudix homolog; nudix/MUTT-like fold, mixed alpha/b | 5e-07 | |
| 1sjy_A | 159 | MUTT/nudix family protein; nudix fold, alpha-beta- | 7e-07 | |
| 1rya_A | 160 | GDP-mannose mannosyl hydrolase; GDP-glucose, nudix | 1e-06 | |
| 3shd_A | 153 | Phosphatase NUDJ; nudix fold, nudix motif, hydrola | 1e-06 | |
| 2kdv_A | 164 | RNA pyrophosphohydrolase; nudix family, magnesium, | 1e-06 | |
| 3q1p_A | 205 | Phosphohydrolase (MUTT/nudix family protein); asym | 1e-06 | |
| 1nqz_A | 194 | COA pyrophosphatase (MUTT/nudix family protein); D | 2e-06 | |
| 2yyh_A | 139 | MUTT domain, 8-OXO-DGTPase domain; nudix family pr | 2e-06 | |
| 2yvp_A | 182 | NDX2, MUTT/nudix family protein; nudix protein, AD | 2e-06 | |
| 2a6t_A | 271 | SPAC19A8.12; alpha/beta/alpha, RNA binding protein | 3e-06 | |
| 1vcd_A | 126 | NDX1; nudix protein, diadenosine polyphosphate, AP | 3e-06 | |
| 3o8s_A | 206 | Nudix hydrolase, ADP-ribose pyrophosphatase; struc | 4e-06 | |
| 2qjt_B | 352 | Nicotinamide-nucleotide adenylyltransferase; two i | 4e-06 | |
| 3i9x_A | 187 | MUTT/nudix family protein; structural genomics, hy | 5e-06 | |
| 1ktg_A | 138 | Diadenosine tetraphosphate hydrolase; nudix, AMP, | 6e-06 | |
| 2pbt_A | 134 | AP4A hydrolase; nudix protein, diadenosine polypho | 7e-06 | |
| 1v8y_A | 170 | ADP-ribose pyrophosphatase; nudix motif, loop-heli | 8e-06 | |
| 2w4e_A | 145 | MUTT/nudix family protein; ADP-ribose pyrophosphat | 8e-06 | |
| 1xsa_A | 153 | BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, | 9e-06 | |
| 2fml_A | 273 | MUTT/nudix family protein; structural genomics, PS | 9e-06 | |
| 2fkb_A | 180 | Putative nudix hydrolase YFCD; putative protein, M | 1e-05 | |
| 1f3y_A | 165 | Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase | 1e-05 | |
| 2qjo_A | 341 | Bifunctional NMN adenylyltransferase/nudix hydrol; | 1e-05 | |
| 1q27_A | 171 | Putative nudix hydrolase DR0079; radiation resista | 1e-05 | |
| 3f6a_A | 159 | Hydrolase, nudix family; protein structure initiat | 2e-05 | |
| 2fb1_A | 226 | Conserved hypothetical protein; structural genomic | 2e-05 | |
| 2b0v_A | 153 | Nudix hydrolase; structural genomics, PSI, protein | 3e-05 | |
| 3cng_A | 189 | Nudix hydrolase; structural genomics, APC7497, PSI | 4e-05 | |
| 2o1c_A | 150 | DATP pyrophosphohydrolase; nudix NTP hydrolase NTP | 6e-05 | |
| 1q33_A | 292 | Pyrophosphatase, ADP-ribose pyrophosphatase; nudix | 7e-05 | |
| 2fvv_A | 194 | Diphosphoinositol polyphosphate phosphohydrolase 1 | 7e-05 | |
| 3h95_A | 199 | Nucleoside diphosphate-linked moiety X motif 6; NU | 7e-05 | |
| 3gz5_A | 240 | MUTT/nudix family protein; DNA binding protein, nu | 1e-04 | |
| 3fcm_A | 197 | Hydrolase, nudix family; protein structure initiat | 2e-04 | |
| 1hzt_A | 190 | Isopentenyl diphosphate delta-isomerase; dimethyla | 5e-04 | |
| 1g0s_A | 209 | Hypothetical 23.7 kDa protein in ICC-TOLC intergen | 8e-04 | |
| 3dup_A | 300 | MUTT/nudix family protein; nudix superfamily hydro | 8e-04 |
| >3kvh_A Protein syndesmos; NUDT16-like, NUDT16L1, nudix, RNA regulation, RNA structural genomics consortium, SGC, RNA degradation, RNA B protein; 1.70A {Homo sapiens} Length = 214 | Back alignment and structure |
|---|
Score = 189 bits (480), Expect = 9e-61
Identities = 70/178 (39%), Positives = 102/178 (57%), Gaps = 5/178 (2%)
Query: 52 HASHCMIFAYNDDKIFATYTARANVLMQMRFDGYIGFPGGLVDAGESPLE-ALNRELNEE 110
H+ H M++A N ++F R +VLMQMRFDG +GFPGG VD LE LNR L
Sbjct: 22 HSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLLGFPGGFVDRRFWSLEDGLNRVLGLG 81
Query: 111 INLNPKYKVKDSDLVCIHYSQSK-KIILHFYALQVEKTDVLEIEKGALTSHDYGVEVLGT 169
+ + ++D + H ++ +++ H YA Q+ + +E A+ S D+G+EVLG
Sbjct: 82 LGCLR---LTEADYLSSHLTEGPHRVVAHLYARQLTLEQLHAVEISAVHSRDHGLEVLGL 138
Query: 170 VRVPLYTMGDGFRGLPCFLTHSFIGNAKHQLLAALLKLKILSPEEINQALNAKPVPVK 227
VRVPLYT D G P FL+++F+ AK QLL AL L ++ E++ +AL A K
Sbjct: 139 VRVPLYTQKDRVGGFPNFLSNAFVSTAKCQLLFALKVLNMMPEEKLVEALAAATEKQK 196
|
| >1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A* Length = 212 | Back alignment and structure |
|---|
| >2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A 3mgm_A Length = 217 | Back alignment and structure |
|---|
| >2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 Length = 148 | Back alignment and structure |
|---|
| >3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} Length = 144 | Back alignment and structure |
|---|
| >4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} Length = 157 | Back alignment and structure |
|---|
| >3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A Length = 176 | Back alignment and structure |
|---|
| >1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* Length = 129 | Back alignment and structure |
|---|
| >3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} Length = 161 | Back alignment and structure |
|---|
| >3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} Length = 140 | Back alignment and structure |
|---|
| >3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* Length = 153 | Back alignment and structure |
|---|
| >3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} Length = 153 | Back alignment and structure |
|---|
| >2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} Length = 140 | Back alignment and structure |
|---|
| >3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} Length = 188 | Back alignment and structure |
|---|
| >3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} Length = 158 | Back alignment and structure |
|---|
| >2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 Length = 155 | Back alignment and structure |
|---|
| >3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} Length = 149 | Back alignment and structure |
|---|
| >3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} Length = 163 | Back alignment and structure |
|---|
| >2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} Length = 146 | Back alignment and structure |
|---|
| >3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} Length = 171 | Back alignment and structure |
|---|
| >2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} Length = 154 | Back alignment and structure |
|---|
| >3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A Length = 165 | Back alignment and structure |
|---|
| >2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* Length = 212 | Back alignment and structure |
|---|
| >3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} Length = 156 | Back alignment and structure |
|---|
| >1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* Length = 198 | Back alignment and structure |
|---|
| >1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A Length = 156 | Back alignment and structure |
|---|
| >1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* Length = 159 | Back alignment and structure |
|---|
| >1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* Length = 160 | Back alignment and structure |
|---|
| >3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A Length = 153 | Back alignment and structure |
|---|
| >2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A Length = 164 | Back alignment and structure |
|---|
| >3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A Length = 205 | Back alignment and structure |
|---|
| >1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A Length = 194 | Back alignment and structure |
|---|
| >2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} Length = 139 | Back alignment and structure |
|---|
| >2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* Length = 182 | Back alignment and structure |
|---|
| >2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* Length = 271 | Back alignment and structure |
|---|
| >1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Length = 126 | Back alignment and structure |
|---|
| >3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} Length = 206 | Back alignment and structure |
|---|
| >2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Length = 352 | Back alignment and structure |
|---|
| >3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} Length = 187 | Back alignment and structure |
|---|
| >1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* Length = 138 | Back alignment and structure |
|---|
| >1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A Length = 170 | Back alignment and structure |
|---|
| >2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} Length = 145 | Back alignment and structure |
|---|
| >1xsa_A BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, human AP4A hydrolase, alpha-beta; NMR {Homo sapiens} SCOP: d.113.1.1 PDB: 1xsb_A 1xsc_A* Length = 153 | Back alignment and structure |
|---|
| >2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 Length = 273 | Back alignment and structure |
|---|
| >2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 Length = 180 | Back alignment and structure |
|---|
| >1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* Length = 165 | Back alignment and structure |
|---|
| >2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} Length = 341 | Back alignment and structure |
|---|
| >1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A Length = 171 | Back alignment and structure |
|---|
| >3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} Length = 159 | Back alignment and structure |
|---|
| >2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 Length = 226 | Back alignment and structure |
|---|
| >2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 Length = 153 | Back alignment and structure |
|---|
| >3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} Length = 189 | Back alignment and structure |
|---|
| >2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A Length = 150 | Back alignment and structure |
|---|
| >1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A* Length = 292 | Back alignment and structure |
|---|
| >2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* Length = 194 | Back alignment and structure |
|---|
| >3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} Length = 199 | Back alignment and structure |
|---|
| >3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* Length = 240 | Back alignment and structure |
|---|
| >3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} Length = 197 | Back alignment and structure |
|---|
| >1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* Length = 190 | Back alignment and structure |
|---|
| >1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A Length = 209 | Back alignment and structure |
|---|
| >3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} Length = 300 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 232 | |||
| 3kvh_A | 214 | Protein syndesmos; NUDT16-like, NUDT16L1, nudix, R | 99.97 | |
| 1u20_A | 212 | U8 snoRNA-binding protein X29; modified nudix hydr | 99.95 | |
| 2xsq_A | 217 | U8 snoRNA-decapping enzyme; hydrolase, mRNA decapp | 99.92 | |
| 1vhz_A | 198 | ADP compounds hydrolase NUDE; structural genomics; | 99.89 | |
| 2yvp_A | 182 | NDX2, MUTT/nudix family protein; nudix protein, AD | 99.88 | |
| 3i7u_A | 134 | AP4A hydrolase; nudix protein, diadenosine polypho | 99.88 | |
| 2dsc_A | 212 | ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP | 99.88 | |
| 1mk1_A | 207 | ADPR pyrophosphatase; nudix hydrolase, adprase, ad | 99.88 | |
| 1g0s_A | 209 | Hypothetical 23.7 kDa protein in ICC-TOLC intergen | 99.87 | |
| 3o6z_A | 191 | GDP-mannose pyrophosphatase NUDK; nudix, hydrolase | 99.86 | |
| 1v8y_A | 170 | ADP-ribose pyrophosphatase; nudix motif, loop-heli | 99.85 | |
| 3u53_A | 155 | BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; | 99.84 | |
| 3eds_A | 153 | MUTT/nudix family protein; MUT/nudix protein, prot | 99.81 | |
| 1ktg_A | 138 | Diadenosine tetraphosphate hydrolase; nudix, AMP, | 99.8 | |
| 4dyw_A | 157 | MUTT/nudix family protein; structural genomics, ni | 99.8 | |
| 2pbt_A | 134 | AP4A hydrolase; nudix protein, diadenosine polypho | 99.8 | |
| 3q91_A | 218 | Uridine diphosphate glucose pyrophosphatase; struc | 99.79 | |
| 3son_A | 149 | Hypothetical nudix hydrolase; structural genomics, | 99.79 | |
| 1vcd_A | 126 | NDX1; nudix protein, diadenosine polyphosphate, AP | 99.78 | |
| 2yyh_A | 139 | MUTT domain, 8-OXO-DGTPase domain; nudix family pr | 99.78 | |
| 3q1p_A | 205 | Phosphohydrolase (MUTT/nudix family protein); asym | 99.77 | |
| 3f6a_A | 159 | Hydrolase, nudix family; protein structure initiat | 99.77 | |
| 3gg6_A | 156 | Nudix motif 18, nucleoside diphosphate-linked moie | 99.77 | |
| 1sjy_A | 159 | MUTT/nudix family protein; nudix fold, alpha-beta- | 99.77 | |
| 3grn_A | 153 | MUTT related protein; structural genomics, hydrola | 99.77 | |
| 2w4e_A | 145 | MUTT/nudix family protein; ADP-ribose pyrophosphat | 99.76 | |
| 3o8s_A | 206 | Nudix hydrolase, ADP-ribose pyrophosphatase; struc | 99.76 | |
| 3cng_A | 189 | Nudix hydrolase; structural genomics, APC7497, PSI | 99.76 | |
| 2azw_A | 148 | MUTT/nudix family protein; MUTT/nudix ,enterococcu | 99.75 | |
| 2fb1_A | 226 | Conserved hypothetical protein; structural genomic | 99.75 | |
| 3shd_A | 153 | Phosphatase NUDJ; nudix fold, nudix motif, hydrola | 99.75 | |
| 2pqv_A | 154 | MUTT/nudix family protein; structu genomics, PSI-2 | 99.75 | |
| 3gwy_A | 140 | Putative CTP pyrophosphohydrolase; structural geno | 99.75 | |
| 2kdv_A | 164 | RNA pyrophosphohydrolase; nudix family, magnesium, | 99.75 | |
| 2fkb_A | 180 | Putative nudix hydrolase YFCD; putative protein, M | 99.74 | |
| 1rya_A | 160 | GDP-mannose mannosyl hydrolase; GDP-glucose, nudix | 99.74 | |
| 3r03_A | 144 | Nudix hydrolase; structural genomics, PSI2, protei | 99.74 | |
| 3hhj_A | 158 | Mutator MUTT protein; niaid, ssgcid, decode, UW, S | 99.74 | |
| 3q93_A | 176 | 7,8-dihydro-8-oxoguanine triphosphatase; structura | 99.74 | |
| 3oga_A | 165 | Nucleoside triphosphatase NUDI; salmonella enteric | 99.73 | |
| 3fcm_A | 197 | Hydrolase, nudix family; protein structure initiat | 99.73 | |
| 3id9_A | 171 | MUTT/nudix family protein; hydrolase, protein stru | 99.73 | |
| 3i9x_A | 187 | MUTT/nudix family protein; structural genomics, hy | 99.73 | |
| 2o1c_A | 150 | DATP pyrophosphohydrolase; nudix NTP hydrolase NTP | 99.73 | |
| 1f3y_A | 165 | Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase | 99.72 | |
| 3h95_A | 199 | Nucleoside diphosphate-linked moiety X motif 6; NU | 99.72 | |
| 1hzt_A | 190 | Isopentenyl diphosphate delta-isomerase; dimethyla | 99.72 | |
| 3gz5_A | 240 | MUTT/nudix family protein; DNA binding protein, nu | 99.72 | |
| 3fk9_A | 188 | Mutator MUTT protein; structural genomics, hydrola | 99.72 | |
| 3exq_A | 161 | Nudix family hydrolase; protein structure initiati | 99.71 | |
| 3ees_A | 153 | Probable pyrophosphohydrolase; nudix, RNA pyrophos | 99.71 | |
| 3f13_A | 163 | Putative nudix hydrolase family member; structural | 99.71 | |
| 2b0v_A | 153 | Nudix hydrolase; structural genomics, PSI, protein | 99.71 | |
| 2jvb_A | 146 | Protein PSU1, mRNA-decapping enzyme subunit 2; DCP | 99.71 | |
| 2b06_A | 155 | MUTT/nudix family protein; structural genomics, P | 99.7 | |
| 1nqz_A | 194 | COA pyrophosphatase (MUTT/nudix family protein); D | 99.7 | |
| 1vk6_A | 269 | NADH pyrophosphatase; 1790429, structural genomics | 99.7 | |
| 2fvv_A | 194 | Diphosphoinositol polyphosphate phosphohydrolase 1 | 99.7 | |
| 2fml_A | 273 | MUTT/nudix family protein; structural genomics, PS | 99.69 | |
| 1k2e_A | 156 | Nudix homolog; nudix/MUTT-like fold, mixed alpha/b | 99.69 | |
| 1q27_A | 171 | Putative nudix hydrolase DR0079; radiation resista | 99.69 | |
| 2rrk_A | 140 | ORF135, CTP pyrophosphohydrolase; NMR {Escherichia | 99.68 | |
| 1mut_A | 129 | MUTT, nucleoside triphosphate pyrophosphohydrolase | 99.67 | |
| 2qjo_A | 341 | Bifunctional NMN adenylyltransferase/nudix hydrol; | 99.64 | |
| 2qjt_B | 352 | Nicotinamide-nucleotide adenylyltransferase; two i | 99.63 | |
| 2a6t_A | 271 | SPAC19A8.12; alpha/beta/alpha, RNA binding protein | 99.63 | |
| 3dup_A | 300 | MUTT/nudix family protein; nudix superfamily hydro | 99.6 | |
| 3fjy_A | 364 | Probable MUTT1 protein; dimer, protein structure i | 99.59 | |
| 1q33_A | 292 | Pyrophosphatase, ADP-ribose pyrophosphatase; nudix | 99.59 | |
| 1x51_A | 155 | A/G-specific adenine DNA glycosylase; nudix domain | 99.59 | |
| 2dho_A | 235 | Isopentenyl-diphosphate delta-isomerase 1; alpha/b | 99.59 | |
| 2pny_A | 246 | Isopentenyl-diphosphate delta-isomerase 2; caroten | 99.57 | |
| 3e57_A | 211 | Uncharacterized protein TM1382; structural genomic | 99.57 | |
| 3fsp_A | 369 | A/G-specific adenine glycosylase; protein-DNA comp | 99.43 | |
| 3qsj_A | 232 | Nudix hydrolase; structural genomics, PSI-biology, | 99.39 | |
| 3bho_A | 208 | Cleavage and polyadenylation specificity factor su | 99.14 | |
| 3rh7_A | 321 | Hypothetical oxidoreductase; FMN-binding split bar | 99.03 |
| >3kvh_A Protein syndesmos; NUDT16-like, NUDT16L1, nudix, RNA regulation, RNA structural genomics consortium, SGC, RNA degradation, RNA B protein; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.97 E-value=1.7e-33 Score=218.43 Aligned_cols=182 Identities=37% Similarity=0.579 Sum_probs=158.6
Q ss_pred cccccc-CCccceEEEEEEecCCceEEEEeccCcEEEEEEeeCCeeecceeecCCCC-CHHHHHhHHHHHhhCC-CCc-c
Q psy7748 42 LKDDKY-KSGYHASHCMIFAYNDDKIFATYTARANVLMQMRFDGYIGFPGGLVDAGE-SPLEALNRELNEEINL-NPK-Y 117 (232)
Q Consensus 42 ~~~~~~-~~~~~a~~~vi~~~~~~~v~~~~~~~~~vLl~~R~~g~w~lPgG~ve~gE-s~~~aa~REl~EEtGl-~~~-~ 117 (232)
.+.+.+ ++++++|.++++.++...+|+.++-+..+|+|.|++|.|+||||+||+|| |+++|+.||+.||+|+ .+. .
T Consensus 11 ~eal~~~~~~~hach~mlya~~~~~lfg~~p~r~~iLmQ~R~~G~weFPGGkVe~gE~t~e~aL~REl~EElg~~~V~~~ 90 (214)
T 3kvh_A 11 VEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLLGFPGGFVDRRFWSLEDGLNRVLGLGLGCLRLTEA 90 (214)
T ss_dssp HHHTTSCTTCEEEEEEEEEEEEEEEETTTEEEEEEEEEEEETTSCEECSEEEECTTTCCHHHHHHHSCCSCC---CCCGG
T ss_pred HHHHhhccCccEeeEEEEEcCCccccccccchhheEEEeeeeCCEEeCCCccCCCCCCCHHHHHHHHHHHhhCCeeeeee
Confidence 344555 78999999999999999999888888899999999999999999999999 9999999999999997 455 2
Q ss_pred eeeeceeeeeeecCC-cEEEEEEEEEEeecCcccccccccccccCCCccceeeEeeeCcccccccCCchHHHHHHHHHHH
Q psy7748 118 KVKDSDLVCIHYSQS-KKIILHFYALQVEKTDVLEIEKGALTSHDYGVEVLGTVRVPLYTMGDGFRGLPCFLTHSFIGNA 196 (232)
Q Consensus 118 ~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E~~~~~wvpl~el~~~i~~~~~~l~~~~i~~~ 196 (232)
... ....... ..+..+||.|.+..+++...+.++....|.+.|++....||+..+.+.+.++|+|+.|.|++++
T Consensus 91 ~y~-----~s~~~~yp~~V~LHfY~crl~~Ge~~~lE~~A~~A~d~G~EvlGlvRVPlytl~D~~gGlP~FL~nsFig~a 165 (214)
T 3kvh_A 91 DYL-----SSHLTEGPHRVVAHLYARQLTLEQLHAVEISAVHSRDHGLEVLGLVRVPLYTQKDRVGGFPNFLSNAFVSTA 165 (214)
T ss_dssp GEE-----EEEEC----CEEEEEEEEECCHHHHHHHHHHHHTSTTBTTTEEEEEEECCCBCTTSSTBHHHHHTSCBCTTH
T ss_pred eeE-----EEEeccCCCEEEEEEEEEEeeCCccchhhhcccCCcccCceecceEEeeeEEeccCCCchhHHHHhhhHHHH
Confidence 221 1111111 3688999999999999988888888899999999999999999999999999999999999999
Q ss_pred HHHHHHHHHhCCCCCHHHHHHHHhcCCCCccc
Q psy7748 197 KHQLLAALLKLKILSPEEINQALNAKPVPVKV 228 (232)
Q Consensus 197 ~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~ 228 (232)
|+||+.+|+..++++++++.+|..++.++||.
T Consensus 166 r~qLl~aL~~l~ll~~~~~~~a~~~~~~~~~~ 197 (214)
T 3kvh_A 166 KCQLLFALKVLNMMPEEKLVEALAAATEKQKK 197 (214)
T ss_dssp HHHHHHHHHHTTSSCHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHcCCCCHHHHHHHHHhccCcchh
Confidence 99999999999999999999999999998874
|
| >1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A* | Back alignment and structure |
|---|
| >2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A 3mgm_A | Back alignment and structure |
|---|
| >1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* | Back alignment and structure |
|---|
| >2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* | Back alignment and structure |
|---|
| >3i7u_A AP4A hydrolase; nudix protein, diadenosine polyphosphate, S genomics, NPPSFA, national project on protein structural AN functional analyses; HET: PGE PG4; 1.80A {Aquifex aeolicus} PDB: 3i7v_A* | Back alignment and structure |
|---|
| >2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* | Back alignment and structure |
|---|
| >1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* | Back alignment and structure |
|---|
| >1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A | Back alignment and structure |
|---|
| >3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} SCOP: d.113.1.1 PDB: 3o52_A* 1viu_A 3o69_A 3o61_A | Back alignment and structure |
|---|
| >1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A | Back alignment and structure |
|---|
| >3u53_A BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; hydrolase; 2.71A {Homo sapiens} PDB: 1xsa_A 1xsb_A 1xsc_A* | Back alignment and structure |
|---|
| >1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* | Back alignment and structure |
|---|
| >4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* | Back alignment and structure |
|---|
| >2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A | Back alignment and structure |
|---|
| >3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* | Back alignment and structure |
|---|
| >3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} | Back alignment and structure |
|---|
| >3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} | Back alignment and structure |
|---|
| >2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 | Back alignment and structure |
|---|
| >3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A | Back alignment and structure |
|---|
| >2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} SCOP: d.113.1.0 | Back alignment and structure |
|---|
| >2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A | Back alignment and structure |
|---|
| >2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 | Back alignment and structure |
|---|
| >1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* | Back alignment and structure |
|---|
| >3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} SCOP: d.113.1.0 | Back alignment and structure |
|---|
| >3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} | Back alignment and structure |
|---|
| >3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A | Back alignment and structure |
|---|
| >3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A | Back alignment and structure |
|---|
| >3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} | Back alignment and structure |
|---|
| >3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} | Back alignment and structure |
|---|
| >2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A | Back alignment and structure |
|---|
| >1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* | Back alignment and structure |
|---|
| >3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* | Back alignment and structure |
|---|
| >3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* | Back alignment and structure |
|---|
| >3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} | Back alignment and structure |
|---|
| >3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* | Back alignment and structure |
|---|
| >3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A | Back alignment and structure |
|---|
| >1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A | Back alignment and structure |
|---|
| >2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* | Back alignment and structure |
|---|
| >2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 | Back alignment and structure |
|---|
| >1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A | Back alignment and structure |
|---|
| >1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A | Back alignment and structure |
|---|
| >2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* | Back alignment and structure |
|---|
| >2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} | Back alignment and structure |
|---|
| >2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B | Back alignment and structure |
|---|
| >2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* | Back alignment and structure |
|---|
| >3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} | Back alignment and structure |
|---|
| >3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} | Back alignment and structure |
|---|
| >1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A* | Back alignment and structure |
|---|
| >1x51_A A/G-specific adenine DNA glycosylase; nudix domain, DNA repair, alpha-3 isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.113.1.3 | Back alignment and structure |
|---|
| >2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A* | Back alignment and structure |
|---|
| >2pny_A Isopentenyl-diphosphate delta-isomerase 2; carotenoid biosynthesis, cholesterol biosynthesis, isomerase isoprene biosynthesis, lipid synthesis; HET: GOL; 1.81A {Homo sapiens} | Back alignment and structure |
|---|
| >3e57_A Uncharacterized protein TM1382; structural genomics, nudix hydrolase, PSI-2, protein structure initiative; 1.89A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* | Back alignment and structure |
|---|
| >3qsj_A Nudix hydrolase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3bho_A Cleavage and polyadenylation specificity factor subunit 5; CPSF5, RNA processing, cleavage factor, diadenosine tetraphosphate, mRNA processing; HET: B4P; 1.80A {Homo sapiens} PDB: 3bap_A 3mdg_A 3mdi_A 2cl3_A 3n9u_A 3q2s_A 3q2t_A 2j8q_A 3p5t_A 3p6y_A | Back alignment and structure |
|---|
| >3rh7_A Hypothetical oxidoreductase; FMN-binding split barrel, nudix, structural genomics, joint for structural genomics, JCSG; HET: FMN; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 232 | ||||
| d1u20a1 | 196 | d.113.1.1 (A:14-209) U8 snorna-binding protein x29 | 1e-53 | |
| d1vcda1 | 126 | d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus t | 3e-09 | |
| d1irya_ | 156 | d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphospha | 1e-07 | |
| d2fmla2 | 202 | d.113.1.6 (A:3-204) Hypothetical protein EF2700, N | 2e-07 | |
| d1sjya_ | 158 | d.113.1.1 (A:) Hypothetical protein DR1025 {Deinoc | 5e-07 | |
| d1xsba_ | 153 | d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas | 5e-07 | |
| d2azwa1 | 147 | d.113.1.1 (A:2-148) Hypothetical protein EF1141 {E | 6e-07 | |
| d2a6ta2 | 151 | d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p c | 1e-06 | |
| d2fvva1 | 135 | d.113.1.1 (A:8-142) Diphosphoinositol polyphosphat | 3e-06 | |
| d1q33a_ | 292 | d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyr | 8e-06 | |
| d1k2ea_ | 152 | d.113.1.1 (A:) Hypothetical protein PAE3301 {Archa | 1e-05 | |
| d2b0va1 | 146 | d.113.1.1 (A:4-149) Hypothetical protein NE0184 {N | 2e-05 | |
| d1nqza_ | 187 | d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinoco | 9e-05 | |
| d2fb1a2 | 147 | d.113.1.6 (A:3-149) Hypothetical protein BT0354, N | 6e-04 | |
| d1jkna_ | 165 | d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas | 8e-04 | |
| d1vk6a2 | 131 | d.113.1.4 (A:126-256) NADH pyrophosphatase {Escher | 0.002 | |
| d1v8ya_ | 158 | d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus | 0.004 | |
| d1ryaa_ | 160 | d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD | 0.004 |
| >d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 196 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Nudix superfamily: Nudix family: MutT-like domain: U8 snorna-binding protein x29 species: African clawed frog (Xenopus laevis) [TaxId: 8355]
Score = 169 bits (428), Expect = 1e-53
Identities = 73/178 (41%), Positives = 104/178 (58%), Gaps = 4/178 (2%)
Query: 49 SGY-HASHCMIFAYNDDKIFATYTARANVLMQMRFDGYIGFPGGLVDAGESPLE-ALNRE 106
GY HA H ++ A + K+F R +LM MRFDG +GFPGG VD + LE L RE
Sbjct: 17 EGYKHACHALLHAPSQAKLFDRVPIRRVLLMMMRFDGRLGFPGGFVDTRDISLEEGLKRE 76
Query: 107 LNEEINLNPKY-KVKDSDLVCIH-YSQSKKIILHFYALQVEKTDVLEIEKGALTSHDYGV 164
L EE+ +V + D +K + HFY +++ ++ IE A+ + D+G+
Sbjct: 77 LEEELGPALATVEVTEDDYRSSQVREHPQKCVTHFYIKELKLEEIERIEAEAVNAKDHGL 136
Query: 165 EVLGTVRVPLYTMGDGFRGLPCFLTHSFIGNAKHQLLAALLKLKILSPEEINQALNAK 222
EV+G +RVPLYT+ D GLP FL ++FIGN+K QLL AL LK+L ++I + L A
Sbjct: 137 EVMGLIRVPLYTLRDRVGGLPAFLCNNFIGNSKSQLLYALRSLKLLREDQIQEVLKAS 194
|
| >d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} Length = 126 | Back information, alignment and structure |
|---|
| >d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} Length = 202 | Back information, alignment and structure |
|---|
| >d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Length = 158 | Back information, alignment and structure |
|---|
| >d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Length = 153 | Back information, alignment and structure |
|---|
| >d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} Length = 147 | Back information, alignment and structure |
|---|
| >d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} Length = 151 | Back information, alignment and structure |
|---|
| >d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 135 | Back information, alignment and structure |
|---|
| >d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} Length = 292 | Back information, alignment and structure |
|---|
| >d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 152 | Back information, alignment and structure |
|---|
| >d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} Length = 146 | Back information, alignment and structure |
|---|
| >d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} Length = 187 | Back information, alignment and structure |
|---|
| >d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 147 | Back information, alignment and structure |
|---|
| >d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} Length = 165 | Back information, alignment and structure |
|---|
| >d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} Length = 131 | Back information, alignment and structure |
|---|
| >d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} Length = 158 | Back information, alignment and structure |
|---|
| >d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} Length = 160 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 232 | |||
| d1u20a1 | 196 | U8 snorna-binding protein x29 {African clawed frog | 99.96 | |
| d1vhza_ | 186 | ADP compounds hydrolase NudE {Escherichia coli [Ta | 99.92 | |
| d1mqea_ | 202 | ADP-ribose pyrophosphatase {Mycobacterium tubercul | 99.91 | |
| d1g0sa_ | 209 | ADP-ribose pyrophosphatase {Escherichia coli [TaxI | 99.86 | |
| d1vcda1 | 126 | AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: | 99.85 | |
| d2fb1a2 | 147 | Hypothetical protein BT0354, N-terminal domain {Ba | 99.84 | |
| d1vk6a2 | 131 | NADH pyrophosphatase {Escherichia coli [TaxId: 562 | 99.84 | |
| d1v8ya_ | 158 | ADP-ribose pyrophosphatase {Thermus thermophilus [ | 99.84 | |
| d1viua_ | 189 | ADP-ribose pyrophosphatase homologue YffH {Escheri | 99.82 | |
| d1ktga_ | 137 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 99.81 | |
| d1hzta_ | 153 | Isopentenyl diphosphate isomerase {Escherichia col | 99.8 | |
| d2fvva1 | 135 | Diphosphoinositol polyphosphate phosphohydrolase { | 99.8 | |
| d1jkna_ | 165 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 99.79 | |
| d1sjya_ | 158 | Hypothetical protein DR1025 {Deinococcus radiodura | 99.79 | |
| d2a6ta2 | 151 | mRNA decapping enzyme Dcp2p catalytic domain {Schi | 99.79 | |
| d2b0va1 | 146 | Hypothetical protein NE0184 {Nitrosomonas europaea | 99.78 | |
| d2azwa1 | 147 | Hypothetical protein EF1141 {Enterococcus faecalis | 99.78 | |
| d1xsba_ | 153 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 99.78 | |
| d2fmla2 | 202 | Hypothetical protein EF2700, N-terminal domain {En | 99.78 | |
| d1irya_ | 156 | 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Hum | 99.78 | |
| d1nqza_ | 187 | Coenzyme A pyrophosphatase {Deinococcus radioduran | 99.77 | |
| d1ryaa_ | 160 | GDP-mannose mannosyl hydrolase NudD {Escherichia c | 99.77 | |
| d2b06a1 | 155 | Hypothetical protein SP1235 (spr1115) {Streptococc | 99.77 | |
| d1puna_ | 129 | Nucleoside triphosphate pyrophosphorylase (MutT) { | 99.75 | |
| d2fkba1 | 161 | Hypothetical protein YfcD {Escherichia coli [TaxId | 99.75 | |
| d2o5fa1 | 162 | Hypothetical protein DR0079 {Deinococcus radiodura | 99.73 | |
| d1k2ea_ | 152 | Hypothetical protein PAE3301 {Archaeon Pyrobaculum | 99.73 | |
| d1q33a_ | 292 | NUDT9 (mitochondrial ADP-ribose pyrophosphatase) { | 99.49 | |
| d1rrqa2 | 127 | Adenine glycosylase MutY, C-terminal domain {Bacil | 99.48 | |
| d1x51a1 | 142 | A/G-specific adenine DNA glycosylase {Human (Homo | 99.04 |
| >d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Nudix superfamily: Nudix family: MutT-like domain: U8 snorna-binding protein x29 species: African clawed frog (Xenopus laevis) [TaxId: 8355]
Probab=99.96 E-value=2.9e-30 Score=203.16 Aligned_cols=180 Identities=39% Similarity=0.644 Sum_probs=152.4
Q ss_pred ccccCCccceEEEEEEecCCceEEEEeccCcEEEEEEeeCCeeecceeecCCCCC-HHHHHhHHHHHhhCCCCc-ceeee
Q psy7748 44 DDKYKSGYHASHCMIFAYNDDKIFATYTARANVLMQMRFDGYIGFPGGLVDAGES-PLEALNRELNEEINLNPK-YKVKD 121 (232)
Q Consensus 44 ~~~~~~~~~a~~~vi~~~~~~~v~~~~~~~~~vLl~~R~~g~w~lPgG~ve~gEs-~~~aa~REl~EEtGl~~~-~~~~~ 121 (232)
.....+++++|.++++.++..++++....+..+|+|+|++|.|+||||++++||+ +++||.||++||||+.+. ..+..
T Consensus 13 ~~~~~g~r~a~~~~~~~~~~~~~~~~~~~~~~vl~~~r~~g~~~~pgg~~~~~e~~~~~~~~re~~ee~g~~~~~~~l~~ 92 (196)
T d1u20a1 13 SLQLEGYKHACHALLHAPSQAKLFDRVPIRRVLLMMMRFDGRLGFPGGFVDTRDISLEEGLKRELEEELGPALATVEVTE 92 (196)
T ss_dssp HHSCSSCEEEEEEEEEEECCCEETTTEECCEEEEEEEETTSCEECSEEEECTTTSCHHHHHHHHHHHHHCGGGGGCCCCG
T ss_pred hhccCCcceEEEEEEEcCCCceEEEEecCCcEEEEEEecCCcEECCccccCCCCCcHHHHHHHHHHHHhCccceeEEEEe
Confidence 4444789999999999999999988777788999999999999999999999995 688999999999999988 55555
Q ss_pred ceeeeeeecC-CcEEEEEEEEEEeecCcccccccccccccCCCccceeeEeeeCcccccccCCchHHHHHHHHHHHHHHH
Q psy7748 122 SDLVCIHYSQ-SKKIILHFYALQVEKTDVLEIEKGALTSHDYGVEVLGTVRVPLYTMGDGFRGLPCFLTHSFIGNAKHQL 200 (232)
Q Consensus 122 ~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E~~~~~wvpl~el~~~i~~~~~~l~~~~i~~~~~~l 200 (232)
..+.+..... ....+.+||.+.+...++...+.....+.+.+.|+.++.|+|+.++.+...++|+|+.+.|+.+++.++
T Consensus 93 ~~~~~~~~~~~~~~~v~~fy~~~~~~~~l~~~e~~~~~a~~~~~E~~~~~wVPl~~L~d~~~~lP~Fl~~~fi~~a~~ql 172 (196)
T d1u20a1 93 DDYRSSQVREHPQKCVTHFYIKELKLEEIERIEAEAVNAKDHGLEVMGLIRVPLYTLRDRVGGLPAFLCNNFIGNSKSQL 172 (196)
T ss_dssp GGEEEEEEECTTSCEEEEEEEEECCHHHHHHHHHHHTTSTTBTTTEEEEEECCCSBCTTSSTBHHHHTTSCBCTTHHHHH
T ss_pred eEEEEeccCCCCCEEEEEEEEEEcchHHhhhhhhcccccCcCCccccceeEEeHHHhcccccCcchhHHhhHHHHHHHHH
Confidence 5555444333 346778888888776666555555566677778999999999999999999999999999999999999
Q ss_pred HHHHHhCCCCCHHHHHHHHhcCC
Q psy7748 201 LAALLKLKILSPEEINQALNAKP 223 (232)
Q Consensus 201 ~~~l~~~~~~~~~~~~~~~~~~~ 223 (232)
+.+|++.+++++++|.+|+.++.
T Consensus 173 l~aL~~~~lL~~e~L~~~l~~~~ 195 (196)
T d1u20a1 173 LYALRSLKLLREDQIQEVLKASH 195 (196)
T ss_dssp HHHHHHTTSSCHHHHHHHHHHHH
T ss_pred HHHHHHhcCCCHHHHHHHHHHhc
Confidence 99999999999999999987653
|
| >d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} | Back information, alignment and structure |
|---|
| >d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} | Back information, alignment and structure |
|---|
| >d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|