Psyllid ID: psy7814
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 460 | 2.2.26 [Sep-21-2011] | |||||||
| B5DF45 | 530 | TNF receptor-associated f | yes | N/A | 0.869 | 0.754 | 0.263 | 2e-38 | |
| P70196 | 530 | TNF receptor-associated f | yes | N/A | 0.871 | 0.756 | 0.262 | 7e-37 | |
| A7XUJ6 | 541 | TNF receptor-associated f | yes | N/A | 0.939 | 0.798 | 0.274 | 2e-36 | |
| Q3ZCC3 | 542 | TNF receptor-associated f | yes | N/A | 0.936 | 0.795 | 0.268 | 8e-36 | |
| Q6DJN2 | 556 | TNF receptor-associated f | N/A | N/A | 0.9 | 0.744 | 0.260 | 1e-34 | |
| Q28DL4 | 558 | TNF receptor-associated f | yes | N/A | 0.902 | 0.743 | 0.246 | 1e-33 | |
| B6CJY4 | 522 | TNF receptor-associated f | N/A | N/A | 0.863 | 0.760 | 0.258 | 3e-33 | |
| B6CJY5 | 522 | TNF receptor-associated f | yes | N/A | 0.863 | 0.760 | 0.258 | 3e-33 | |
| Q9Y4K3 | 522 | TNF receptor-associated f | yes | N/A | 0.863 | 0.760 | 0.256 | 4e-33 | |
| Q6IWL4 | 542 | TNF receptor-associated f | yes | N/A | 0.893 | 0.758 | 0.246 | 5e-33 |
| >sp|B5DF45|TRAF6_RAT TNF receptor-associated factor 6 OS=Rattus norvegicus GN=Traf6 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 160 bits (405), Expect = 2e-38, Method: Compositional matrix adjust.
Identities = 129/489 (26%), Positives = 207/489 (42%), Gaps = 89/489 (18%)
Query: 13 LDPRFECSICLEYLKDAILTSCGHKFCAACIDSWIDVKGKNYCPIDEKVLTKDDIFIDNY 72
L+ ++EC ICL L++A+ T CGH+FC ACI I G + CP+D ++L ++ +F DN+
Sbjct: 64 LESKYECPICLMALREAVQTPCGHRFCKACITKSIRDAG-HKCPVDNEILLENQLFPDNF 122
Query: 73 TRREILENNLTCPYKQCSSQLSIPEYESHVNTC------------YLKYSQPSVEDITDS 120
+REIL + CP K C ++ + E H C + + Q + I D
Sbjct: 123 AKREILSLTVKCPNKGCVQKMELRHLEDHQVHCEFALVICPQCQRFFQKCQINKHIIEDC 182
Query: 121 P---TSSFRNTSGIPTNKRN----------------SKILTVTVFPEHLNMQGSSNENFP 161
P S +P ++ IL P H ++ + P
Sbjct: 183 PRRQVSCVNCAVPMPYEEKEIHDQSCPLANIICEYCGTILIREQMPNHYDLDCPTAP-VP 241
Query: 162 CKFYQVGCREVFKSQALLEKHYDLKTSFHLELL----FNKYCSDGSQSTNTPSHGRQDTS 217
C F GC E + L +H T H+ LL N S ++PS G
Sbjct: 242 CTFSVFGCHEKMQRNHL-ARHLQENTQLHMRLLAQAVHNVNLSLRPCDASSPSRG----- 295
Query: 218 NQKEIEAYLMKNKEHESKLWDPNKNQAGDDKSSEGDCSCKTCGDNSHLLKLVYE--RMVL 275
+ DPN + K EG +LV + ++
Sbjct: 296 ----------------CRPEDPNYEETV--KQLEG--------------RLVRQDHQIRE 323
Query: 276 LEQSMLEQKIKVNNFELNLKQTEEIEDNVVLKLCNGVYFWKMYNFPAKLKEMKEINRY-F 334
L M Q + V+ + ++ E+ + + CNG+Y WK+ NF LK +E
Sbjct: 324 LTAKMETQSMHVSELKRTIRSLEDKVAEMEAQQCNGIYIWKIGNFGMHLKSQEEERPVVI 383
Query: 335 YSACFYSSCFGYRFCTRVNISREDAQ----YLSLFIHLVQGENDDILDWPFVGRIRFTAL 390
+S FY+ GY+ C R+++ AQ Y+SLF+H +QGE D L WPF G IR T L
Sbjct: 384 HSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTIL 443
Query: 391 NTSSEFSITDE---IQSDKNFDSFKRPVNFFLNKKAFGFNNFIRVADVLDPGRGFLMEDD 447
+ S + + + +F+RP N K FG+ F+ + + +G ++DD
Sbjct: 444 DQSEAVIRQNHEEVMDAKPELLAFQRP-TIPRNPKGFGYVTFMHLEAL---RQGTFIKDD 499
Query: 448 TFVIKTQVT 456
T +++ +V+
Sbjct: 500 TLLVRCEVS 508
|
E3 ubiquitin ligase that, together with UBE2N and UBE2V1, mediates the synthesis of 'Lys-63'-linked-polyubiquitin chains conjugated to proteins, such as IKBKG, AKT1 and AKT2. Also mediates ubiquitination of free/unanchored polyubiquitin chain that leads to MAP3K7 activation. Mediates activation of NF-kappa-B and JUN. May be essential for the formation of functional osteoclasts. Seems to also play a role in dendritic cells (DCs) maturation and/or activation. Represses c-Myb-mediated transactivation, in B-lymphocytes. Adapter protein that seems to play a role in signal transduction initiated via TNF receptor, IL-1 receptor and IL-17 receptor. Regulates osteoclast differentiation by mediating the activation of adapter protein complex 1 (AP-1) and NF-kappa-B, in response to RANK-L stimulation. Rattus norvegicus (taxid: 10116) EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: - |
| >sp|P70196|TRAF6_MOUSE TNF receptor-associated factor 6 OS=Mus musculus GN=Traf6 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|A7XUJ6|TRAF6_PIG TNF receptor-associated factor 6 OS=Sus scrofa GN=TRAF6 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q3ZCC3|TRAF6_BOVIN TNF receptor-associated factor 6 OS=Bos taurus GN=TRAF6 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q6DJN2|TRF6B_XENLA TNF receptor-associated factor 6-B OS=Xenopus laevis GN=traf6-b PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q28DL4|TRAF6_XENTR TNF receptor-associated factor 6 OS=Xenopus tropicalis GN=traf6 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|B6CJY4|TRAF6_CERAT TNF receptor-associated factor 6 OS=Cercocebus atys GN=TRAF6 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|B6CJY5|TRAF6_MACMU TNF receptor-associated factor 6 OS=Macaca mulatta GN=TRAF6 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9Y4K3|TRAF6_HUMAN TNF receptor-associated factor 6 OS=Homo sapiens GN=TRAF6 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q6IWL4|TRAF6_DANRE TNF receptor-associated factor 6 OS=Danio rerio GN=traf6 PE=2 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 460 | ||||||
| 383862215 | 416 | PREDICTED: TNF receptor-associated facto | 0.8 | 0.884 | 0.327 | 3e-60 | |
| 328782285 | 422 | PREDICTED: TNF receptor-associated facto | 0.806 | 0.879 | 0.329 | 1e-58 | |
| 380013177 | 399 | PREDICTED: TNF receptor-associated facto | 0.797 | 0.919 | 0.333 | 3e-58 | |
| 357611198 | 416 | hypothetical protein KGM_19213 [Danaus p | 0.808 | 0.894 | 0.314 | 6e-57 | |
| 350418145 | 414 | PREDICTED: TNF receptor-associated facto | 0.8 | 0.888 | 0.318 | 4e-56 | |
| 340712675 | 413 | PREDICTED: TNF receptor-associated facto | 0.797 | 0.888 | 0.325 | 9e-56 | |
| 91080239 | 398 | PREDICTED: similar to AGAP003004-PA [Tri | 0.793 | 0.917 | 0.316 | 2e-54 | |
| 242007226 | 411 | conserved hypothetical protein [Pediculu | 0.836 | 0.936 | 0.306 | 4e-51 | |
| 312372715 | 381 | hypothetical protein AND_19795 [Anophele | 0.754 | 0.910 | 0.301 | 7e-46 | |
| 290463015 | 453 | TNF receptor-associated factor 6 [Lepeop | 0.891 | 0.905 | 0.311 | 1e-44 |
| >gi|383862215|ref|XP_003706579.1| PREDICTED: TNF receptor-associated factor 6-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Score = 239 bits (609), Expect = 3e-60, Method: Compositional matrix adjust.
Identities = 148/452 (32%), Positives = 231/452 (51%), Gaps = 84/452 (18%)
Query: 13 LDPRFECSICLEYLKDAILTSCGHKFCAACIDSWIDVKGKNYCPIDEKVL-TKDDIFIDN 71
L+PRFEC ICL +L+D +LTSCGHKFC+ CI +W+ +G CP+D K L ++ D+F D
Sbjct: 28 LEPRFECPICLTWLRDPVLTSCGHKFCSQCIYTWLQKEGA-CCPVDSKPLKSESDLFRDL 86
Query: 72 YTRREILENNLTCPYKQ--CSSQLSIPEYESHVNTCYLKYSQPSVEDITDSPTSSFRNTS 129
YT REI + + CPY+Q C LS + ESH++ C K
Sbjct: 87 YTSREISQQRMHCPYQQFGCEVNLSPVDMESHISQCMFK--------------------- 125
Query: 130 GIPTNKRNSKILTVTVFPEHLNMQGSSNENFPCKFYQVGCREVFKSQALLEKHYDLKTSF 189
Q S++E C F VGC E F ++ L H + +
Sbjct: 126 ----------------------GQLSNSETMHCHFKNVGCTETFCTEEDLHTHLERNINQ 163
Query: 190 HLELLFNKYCSDGSQSTNTPSHGRQDTSNQKEIEAYLMKNKEHESKLWDPNKNQAGDDKS 249
HL ++ Q+++++ + A + ESKLWDP A +
Sbjct: 164 HLTMVVKAL--------------PQESASRNNVSALVA-----ESKLWDPPSKNASSLEK 204
Query: 250 SEGDCSCKTCGDNSHLLKLVYERMVLLEQSMLEQKIKVNNFELNLKQTEEI----EDNVV 305
+E + LLK +YER+VLLEQ E I V+N + L + ++ V
Sbjct: 205 TEPSLEWQ------QLLKNLYERIVLLEQQNRELSITVSNQKTQLTTLQTSLRFNQEEVF 258
Query: 306 LKLCNGVYFWKMYNFPAKLKEM-KEINRYFYSACFYSSCFGYRFCTRVNISREDAQYLSL 364
L+ CNGVY W++++F KL M + + FYS FY+S GY+ C R+N+S +D ++LSL
Sbjct: 259 LRSCNGVYIWRLHSFQEKLHSMMSDPLKMFYSPGFYTSLHGYKICARINVSSKDPEFLSL 318
Query: 365 FIHLVQGENDDILDWPFVGRIRFTALNTSS-EFSITDEIQSDKNFDSFKRPVNFFLNKKA 423
+H+++ ENDD LDWPF G + F ++ + E I + S N ++F++PV LNK++
Sbjct: 319 LLHIMKSENDDGLDWPFNGTMCFILVHPHNCEKDIREVTSSRPNLEAFRKPV-CELNKRS 377
Query: 424 FGFNNFIRVADVLDPGRGFLMEDDTFVIKTQV 455
FG+ F+R+ D+ D +++D+ + + +V
Sbjct: 378 FGYTEFVRIRDLPD-----FVQNDSLIFRIEV 404
|
Source: Megachile rotundata Species: Megachile rotundata Genus: Megachile Family: Megachilidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328782285|ref|XP_624207.3| PREDICTED: TNF receptor-associated factor 6 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380013177|ref|XP_003690643.1| PREDICTED: TNF receptor-associated factor 6-B-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|357611198|gb|EHJ67361.1| hypothetical protein KGM_19213 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|350418145|ref|XP_003491757.1| PREDICTED: TNF receptor-associated factor 6-A-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340712675|ref|XP_003394881.1| PREDICTED: TNF receptor-associated factor 6-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|91080239|ref|XP_972955.1| PREDICTED: similar to AGAP003004-PA [Tribolium castaneum] gi|270006403|gb|EFA02851.1| TNF-receptor-associated factor 2 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|242007226|ref|XP_002424443.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212507843|gb|EEB11705.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|312372715|gb|EFR20613.1| hypothetical protein AND_19795 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|290463015|gb|ADD24555.1| TNF receptor-associated factor 6 [Lepeophtheirus salmonis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 460 | ||||||
| UNIPROTKB|A7XUJ6 | 541 | TRAF6 "TNF receptor-associated | 0.939 | 0.798 | 0.280 | 2.6e-40 | |
| RGD|1306853 | 530 | Traf6 "TNF receptor-associated | 0.919 | 0.798 | 0.276 | 6.1e-39 | |
| MGI|MGI:108072 | 530 | Traf6 "TNF receptor-associated | 0.932 | 0.809 | 0.267 | 7.8e-39 | |
| UNIPROTKB|Q3ZCC3 | 542 | TRAF6 "TNF receptor-associated | 0.936 | 0.795 | 0.268 | 4.3e-38 | |
| UNIPROTKB|B6CJY4 | 522 | TRAF6 "TNF receptor-associated | 0.919 | 0.810 | 0.262 | 1e-36 | |
| UNIPROTKB|B6CJY5 | 522 | TRAF6 "TNF receptor-associated | 0.919 | 0.810 | 0.262 | 1e-36 | |
| UNIPROTKB|Q9Y4K3 | 522 | TRAF6 "TNF receptor-associated | 0.919 | 0.810 | 0.259 | 4.4e-36 | |
| UNIPROTKB|Q6DJN2 | 556 | traf6-b "TNF receptor-associat | 0.634 | 0.525 | 0.269 | 1.9e-34 | |
| UNIPROTKB|Q28DL4 | 558 | traf6 "TNF receptor-associated | 0.647 | 0.534 | 0.261 | 2e-34 | |
| UNIPROTKB|Q3MV19 | 556 | traf6-a "TNF receptor-associat | 0.628 | 0.519 | 0.268 | 7.3e-32 |
| UNIPROTKB|A7XUJ6 TRAF6 "TNF receptor-associated factor 6" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Score = 429 (156.1 bits), Expect = 2.6e-40, P = 2.6e-40
Identities = 131/467 (28%), Positives = 219/467 (46%)
Query: 13 LDPRFECSICLEYLKDAILTSCGHKFCAACIDSWIDVKGKNYCPIDEKVLTKDDIFIDNY 72
L+ ++EC ICL L++A+ T CGH+FC ACI I G CP+D ++L ++ +F DN+
Sbjct: 65 LESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHK-CPVDNEILLENQLFPDNF 123
Query: 73 TRREILENNLTCPYKQCSSQLSIPEYESHVNTC-YLKYSQPSVEDITDSPTSSFRNTSGI 131
+REIL + CP C ++ + E H C + + P + +
Sbjct: 124 AKREILSLTVKCPNVGCLHKMELRHLEDHQAHCEFALMNCPQCQRPFQKCQLNIHILKEC 183
Query: 132 PTNKRNSKILTVTV-FPE-HLNMQGSSNENFPCKFYQVGCREVFKSQALLEKHYDLKT-S 188
P + + V++ F + ++ Q N C++ C V + + HYDL +
Sbjct: 184 PRRQVSCVNCAVSMAFEDKEIHDQNCPLANVICEY----CNTVLIREQM-PNHYDLDCPT 238
Query: 189 FHLELLFNKY-CSDGSQSTNTPSHGRQDTSNQKEIEAYLMKNKEHESKLWDPNKNQAGDD 247
+ F+ + C + Q + H +++T + + A ++ + P ++ D
Sbjct: 239 APVPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMMAQALQGLSL-AVAPVPQRDMLPYD 297
Query: 248 KSSEGDCSCKTCGDNS--HLLKLVYERMVLLEQSMLEQKIKVNNFEL---NLKQT-EEIE 301
S S C D + ++ + R+V + + E K+ + LK+T +E
Sbjct: 298 SSPLSRISSGCCSDQNFQETIQQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRSLE 357
Query: 302 DNVV---LKLCNGVYFWKMYNFPAKLKEMKEINRY-FYSACFYSSCFGYRFCTRVNISRE 357
D V + CNG+Y WK+ NF LK +E +S FY+ GY+ C R+++
Sbjct: 358 DKVAEIEAQQCNGIYIWKIGNFGMHLKSQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLP 417
Query: 358 DAQ----YLSLFIHLVQGENDDILDWPFVGRIRFTALNTSSEFSIT---DEIQSDK-NFD 409
AQ Y+SLF+H +QGE D L WPF G IR T L+ SE I +EI K
Sbjct: 418 TAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILD-QSEAPIRQNHEEIMDAKPELL 476
Query: 410 SFKRPVNFFLNKKAFGFNNFIRVADVLDPGRGFLMEDDTFVIKTQVT 456
+F+RP N K FG+ F+ + D L R F+ +DDT +++ +V+
Sbjct: 477 AFQRPT-IPRNPKGFGYVTFMHL-DALRQ-RTFI-KDDTLLVRCEVS 519
|
|
| RGD|1306853 Traf6 "TNF receptor-associated factor 6, E3 ubiquitin protein ligase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:108072 Traf6 "TNF receptor-associated factor 6" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3ZCC3 TRAF6 "TNF receptor-associated factor 6" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B6CJY4 TRAF6 "TNF receptor-associated factor 6" [Cercocebus atys (taxid:9531)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B6CJY5 TRAF6 "TNF receptor-associated factor 6" [Macaca mulatta (taxid:9544)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9Y4K3 TRAF6 "TNF receptor-associated factor 6" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6DJN2 traf6-b "TNF receptor-associated factor 6-B" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q28DL4 traf6 "TNF receptor-associated factor 6" [Xenopus (Silurana) tropicalis (taxid:8364)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3MV19 traf6-a "TNF receptor-associated factor 6-A" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 6.3.2 | 0.691 |
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 460 | |||
| cd03776 | 147 | cd03776, MATH_TRAF6, Tumor Necrosis Factor Recepto | 9e-38 | |
| cd00270 | 149 | cd00270, MATH_TRAF_C, Tumor Necrosis Factor Recept | 5e-30 | |
| cd03778 | 164 | cd03778, MATH_TRAF2, Tumor Necrosis Factor Recepto | 1e-14 | |
| cd03781 | 154 | cd03781, MATH_TRAF4, Tumor Necrosis Factor Recepto | 2e-13 | |
| cd03779 | 147 | cd03779, MATH_TRAF1, Tumor Necrosis Factor Recepto | 3e-13 | |
| cd03780 | 148 | cd03780, MATH_TRAF5, Tumor Necrosis Factor Recepto | 2e-11 | |
| cd03777 | 186 | cd03777, MATH_TRAF3, Tumor Necrosis Factor Recepto | 2e-11 | |
| cd00121 | 126 | cd00121, MATH, MATH (meprin and TRAF-C homology) d | 1e-10 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 4e-09 | |
| cd03771 | 167 | cd03771, MATH_Meprin, Meprin family, MATH domain; | 2e-08 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 7e-08 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 9e-08 | |
| pfam00097 | 40 | pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING | 2e-07 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 3e-07 | |
| pfam00917 | 116 | pfam00917, MATH, MATH domain | 2e-06 | |
| cd03774 | 139 | cd03774, MATH_SPOP, Speckle-type POZ protein (SPOP | 4e-06 | |
| cd03783 | 167 | cd03783, MATH_Meprin_Alpha, Meprin family, Alpha s | 6e-06 | |
| TIGR00599 | 397 | TIGR00599, rad18, DNA repair protein rad18 | 7e-06 | |
| cd03782 | 167 | cd03782, MATH_Meprin_Beta, Meprin family, Beta sub | 1e-05 | |
| PLN03208 | 193 | PLN03208, PLN03208, E3 ubiquitin-protein ligase RM | 3e-05 | |
| pfam13920 | 49 | pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI | 5e-04 | |
| PHA02929 | 238 | PHA02929, PHA02929, N1R/p28-like protein; Provisio | 7e-04 | |
| COG5432 | 391 | COG5432, RAD18, RING-finger-containing E3 ubiquiti | 0.001 | |
| pfam13445 | 55 | pfam13445, zf-RING_LisH, RING-type zinc-finger, Li | 0.001 | |
| COG5574 | 271 | COG5574, PEX10, RING-finger-containing E3 ubiquiti | 0.001 |
| >gnl|CDD|239745 cd03776, MATH_TRAF6, Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF6 subfamily, TRAF domain, C-terminal MATH subdomain; composed of proteins with similarity to human TRAF6, including the Drosophila protein DTRAF2 | Back alignment and domain information |
|---|
Score = 134 bits (339), Expect = 9e-38
Identities = 58/151 (38%), Positives = 84/151 (55%), Gaps = 9/151 (5%)
Query: 311 GVYFWKMYNFPAKLKEMK-EINRYFYSACFYSSCFGYRFCTRVNISR---EDAQYLSLFI 366
G+Y WK+ NF + M+ +S FY+S GY+ C R+N+S Y+SLF+
Sbjct: 1 GIYVWKIKNFSNLRRSMEAGSPVVIHSPGFYTSPPGYKLCARLNLSLPEARCPNYISLFV 60
Query: 367 HLVQGENDDILDWPFVGRIRFTALNTSSEF-SITDEIQSDKNFDSFKRPVNFFLNKKAFG 425
HL+QGEND LDWPF G I T L+ S +I + + S +F+RP N K FG
Sbjct: 61 HLMQGENDSHLDWPFQGTITLTLLDQSEPRQNIHETMMSKPELLAFQRPTT-DRNPKGFG 119
Query: 426 FNNFIRVADVLDPGRGFLMEDDTFVIKTQVT 456
+ F + D+L RGF+ ++DT +IK +V
Sbjct: 120 YVEFAHIEDLLQ--RGFV-KNDTLLIKIEVN 147
|
TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses. TRAF6 is the most divergent in its TRAF domain among the mammalian TRAFs. In addition to mediating TNFR family signaling, it is also an essential signaling molecule of the interleukin-1/Toll-like receptor superfamily. Whereas other TRAF molecules display similar and overlapping TNFR-binding specificities, TRAF6 binds completely different sites on receptors such as CD40 and RANK. TRAF6 serves as a molecular bridge between innate and adaptive immunity and plays a central role in osteoimmunology. DTRAF2, as an activator of nuclear factor-kappaB, plays a pivotal role in Drosophila development and innate immunity. TRAF6 contains a RING finger domain, five zinc finger domains, and a TRAF domain. The TRAF domain can be divided into a more divergent N-terminal alpha helical region (TRAF-N), and a highly conserved C-terminal MATH subdomain (TRAF-C) with an eight-stranded beta-sandwich structure. TRAF-N mediates trimerization while TRAF-C interacts with receptors. Length = 147 |
| >gnl|CDD|238168 cd00270, MATH_TRAF_C, Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF domain, C-terminal MATH subdomain; TRAF molecules serve as adapter proteins that link cell surface TNFRs and receptors of the interleukin-1/Toll-like family to downstream kinase signaling cascades which results in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses in the immune and inflammatory systems | Back alignment and domain information |
|---|
| >gnl|CDD|239747 cd03778, MATH_TRAF2, Tumor Necrosis Factor Receptor (TNFR) Associated Factor (TRAF) family, TRAF2 subfamily, TRAF domain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses | Back alignment and domain information |
|---|
| >gnl|CDD|239750 cd03781, MATH_TRAF4, Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF4 subfamily, TRAF domain, C-terminal MATH subdomain; composed of proteins with similarity to human TRAF4, including the Drosophila protein DTRAF1 | Back alignment and domain information |
|---|
| >gnl|CDD|239748 cd03779, MATH_TRAF1, Tumor Necrosis Factor Receptor (TNFR) Associated Factor (TRAF) family, TRAF1 subfamily, TRAF domain, C-terminal MATH subdomain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses | Back alignment and domain information |
|---|
| >gnl|CDD|239749 cd03780, MATH_TRAF5, Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF5 subfamily, TRAF domain, C-terminal MATH subdomain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses | Back alignment and domain information |
|---|
| >gnl|CDD|239746 cd03777, MATH_TRAF3, Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF3 subfamily, TRAF domain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses | Back alignment and domain information |
|---|
| >gnl|CDD|238068 cd00121, MATH, MATH (meprin and TRAF-C homology) domain; an independent folding unit with an eight-stranded beta-sandwich structure found in meprins, TRAFs and other proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|239740 cd03771, MATH_Meprin, Meprin family, MATH domain; Meprins are multidomain, highly glycosylated extracellular metalloproteases, which are either anchored to the membrane or secreted into extracellular spaces | Back alignment and domain information |
|---|
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|216189 pfam00917, MATH, MATH domain | Back alignment and domain information |
|---|
| >gnl|CDD|239743 cd03774, MATH_SPOP, Speckle-type POZ protein (SPOP) family, MATH domain; composed of proteins with similarity to human SPOP | Back alignment and domain information |
|---|
| >gnl|CDD|239752 cd03783, MATH_Meprin_Alpha, Meprin family, Alpha subunit, MATH domain; Meprins are multidomain extracellular metalloproteases capable of cleaving growth factors, cytokines, extracellular matrix proteins, and biologically active peptides | Back alignment and domain information |
|---|
| >gnl|CDD|233043 TIGR00599, rad18, DNA repair protein rad18 | Back alignment and domain information |
|---|
| >gnl|CDD|239751 cd03782, MATH_Meprin_Beta, Meprin family, Beta subunit, MATH domain; Meprins are multidomain extracellular metalloproteases capable of cleaving growth factors, cytokines, extracellular matrix proteins, and biologically active peptides | Back alignment and domain information |
|---|
| >gnl|CDD|178747 PLN03208, PLN03208, E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227719 COG5432, RAD18, RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif | Back alignment and domain information |
|---|
| >gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 460 | |||
| cd03778 | 164 | MATH_TRAF2 Tumor Necrosis Factor Receptor (TNFR) A | 100.0 | |
| cd03777 | 186 | MATH_TRAF3 Tumor Necrosis Factor Receptor (TNFR)-A | 100.0 | |
| cd03779 | 147 | MATH_TRAF1 Tumor Necrosis Factor Receptor (TNFR) A | 100.0 | |
| cd03780 | 148 | MATH_TRAF5 Tumor Necrosis Factor Receptor (TNFR)-A | 100.0 | |
| KOG0297|consensus | 391 | 100.0 | ||
| cd03783 | 167 | MATH_Meprin_Alpha Meprin family, Alpha subunit, MA | 100.0 | |
| cd03782 | 167 | MATH_Meprin_Beta Meprin family, Beta subunit, MATH | 100.0 | |
| cd03771 | 167 | MATH_Meprin Meprin family, MATH domain; Meprins ar | 100.0 | |
| cd03776 | 147 | MATH_TRAF6 Tumor Necrosis Factor Receptor (TNFR)-A | 100.0 | |
| cd03781 | 154 | MATH_TRAF4 Tumor Necrosis Factor Receptor (TNFR)-A | 100.0 | |
| cd00270 | 149 | MATH_TRAF_C Tumor Necrosis Factor Receptor (TNFR)- | 99.97 | |
| cd03773 | 132 | MATH_TRIM37 Tripartite motif containing protein 37 | 99.88 | |
| cd03774 | 139 | MATH_SPOP Speckle-type POZ protein (SPOP) family, | 99.87 | |
| cd03775 | 134 | MATH_Ubp21p Ubiquitin-specific protease 21 (Ubp21p | 99.85 | |
| cd03772 | 137 | MATH_HAUSP Herpesvirus-associated ubiquitin-specif | 99.83 | |
| cd00121 | 126 | MATH MATH (meprin and TRAF-C homology) domain; an | 99.8 | |
| PF00917 | 119 | MATH: MATH domain; InterPro: IPR002083 Although ap | 99.75 | |
| smart00061 | 95 | MATH meprin and TRAF homology. | 99.53 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 99.08 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 99.06 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.97 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 98.94 | |
| PF02176 | 60 | zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A | 98.94 | |
| COG5077 | 1089 | Ubiquitin carboxyl-terminal hydrolase [Posttransla | 98.89 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.78 | |
| KOG0823|consensus | 230 | 98.74 | ||
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 98.74 | |
| KOG3002|consensus | 299 | 98.69 | ||
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 98.67 | |
| KOG0320|consensus | 187 | 98.66 | ||
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.64 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.64 | |
| KOG0287|consensus | 442 | 98.62 | ||
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 98.58 | |
| KOG0317|consensus | 293 | 98.58 | ||
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.5 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.47 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.42 | |
| KOG0311|consensus | 381 | 98.35 | ||
| PLN03086 | 567 | PRLI-interacting factor K; Provisional | 98.26 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 98.26 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.25 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.24 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.15 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.13 | |
| KOG2164|consensus | 513 | 98.06 | ||
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 98.0 | |
| KOG0978|consensus | 698 | 97.91 | ||
| KOG2177|consensus | 386 | 97.71 | ||
| KOG1987|consensus | 297 | 97.66 | ||
| KOG2879|consensus | 298 | 97.62 | ||
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 97.58 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 97.56 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 97.52 | |
| KOG2660|consensus | 331 | 97.5 | ||
| KOG4159|consensus | 398 | 97.5 | ||
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 97.48 | |
| PF03145 | 198 | Sina: Seven in absentia protein family; InterPro: | 97.07 | |
| PF02176 | 60 | zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A | 97.04 | |
| PLN03086 | 567 | PRLI-interacting factor K; Provisional | 96.96 | |
| KOG0824|consensus | 324 | 96.93 | ||
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 96.88 | |
| KOG0802|consensus | 543 | 96.83 | ||
| KOG1813|consensus | 313 | 96.81 | ||
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 96.72 | |
| KOG4172|consensus | 62 | 96.71 | ||
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 96.46 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 96.46 | |
| KOG4628|consensus | 348 | 96.37 | ||
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 96.24 | |
| KOG3039|consensus | 303 | 96.07 | ||
| KOG1002|consensus | 791 | 95.8 | ||
| KOG1785|consensus | 563 | 95.49 | ||
| KOG4265|consensus | 349 | 95.38 | ||
| KOG0804|consensus | 493 | 95.27 | ||
| KOG1863|consensus | 1093 | 95.21 | ||
| KOG1734|consensus | 328 | 95.11 | ||
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 95.01 | |
| KOG4692|consensus | 489 | 95.0 | ||
| KOG1039|consensus | 344 | 94.9 | ||
| KOG4367|consensus | 699 | 94.71 | ||
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 94.54 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 94.29 | |
| KOG1814|consensus | 445 | 94.2 | ||
| KOG1645|consensus | 463 | 94.19 | ||
| KOG4275|consensus | 350 | 94.16 | ||
| KOG3800|consensus | 300 | 93.91 | ||
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 93.8 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 93.45 | |
| KOG1001|consensus | 674 | 93.08 | ||
| KOG0825|consensus | 1134 | 92.96 | ||
| KOG0826|consensus | 357 | 92.72 | ||
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 92.67 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 92.09 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 91.75 | |
| KOG1812|consensus | 384 | 91.3 | ||
| KOG3161|consensus | 861 | 90.66 | ||
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 90.47 | |
| KOG1571|consensus | 355 | 90.31 | ||
| KOG2817|consensus | 394 | 89.84 | ||
| KOG1941|consensus | 518 | 89.48 | ||
| KOG4185|consensus | 296 | 88.8 | ||
| KOG4739|consensus | 233 | 88.34 | ||
| PF08746 | 43 | zf-RING-like: RING-like domain; InterPro: IPR01485 | 86.24 | |
| PF02891 | 50 | zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 | 86.15 | |
| KOG3579|consensus | 352 | 85.86 | ||
| KOG1493|consensus | 84 | 85.7 | ||
| KOG0827|consensus | 465 | 85.67 | ||
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 85.63 | |
| KOG0828|consensus | 636 | 85.19 | ||
| KOG3039|consensus | 303 | 82.56 | ||
| KOG2930|consensus | 114 | 80.39 | ||
| KOG2932|consensus | 389 | 80.38 |
| >cd03778 MATH_TRAF2 Tumor Necrosis Factor Receptor (TNFR) Associated Factor (TRAF) family, TRAF2 subfamily, TRAF domain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses | Back alignment and domain information |
|---|
Probab=100.00 E-value=1e-43 Score=309.10 Aligned_cols=156 Identities=29% Similarity=0.541 Sum_probs=141.8
Q ss_pred HHHHHhhhhhccccCcEEEEEECChHHHHHHhhh-cCCeEeccCceeCCCccEEEEEEEeCCCC---CCeEEEEEEEecC
Q psy7814 296 QTEEIEDNVVLKLCNGVYFWKMYNFPAKLKEMKE-INRYFYSACFYSSCFGYRFCTRVNISRED---AQYLSLFIHLVQG 371 (460)
Q Consensus 296 ~l~~~~~~~~~~~~~g~~~w~I~~fs~~~~~~~~-~~~~~~S~~F~~~~~Gyk~~l~~yp~G~~---~~~lS~~l~l~~g 371 (460)
++++.+++++.+.++|+|+|+|.|||+++++++. ....++||+|||+++||+|+|++||||++ ++||||||+||+|
T Consensus 4 ~~~~~~~~l~~~~~~g~fiWkI~~fs~~~~~a~~~~~~~i~Sp~Fyt~~~GYk~~l~~ylnG~g~~~g~~LSly~~l~~G 83 (164)
T cd03778 4 DLEQKVLEXEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKG 83 (164)
T ss_pred HHHHHhhhccccccCCEEEEEECcHHHHHHHHhcCCCceEECCCcccCCCCeEEEEEEEeCCCCCCCCCEEEEEEEEecC
Confidence 3444455667889999999999999999998877 66789999999999999999999999975 7899999999999
Q ss_pred CCCCCCCCCCCceeEEEEEcCCCCCeeeEEEecCCCCCCCCCCcccCCCccCCCccceeecccccC-CCCcccccCCeEE
Q psy7814 372 ENDDILDWPFVGRIRFTALNTSSEFSITDEIQSDKNFDSFKRPVNFFLNKKAFGFNNFIRVADVLD-PGRGFLMEDDTFV 450 (460)
Q Consensus 372 ~~D~~l~Wp~~~~~~l~lldq~~~~~~~~~~~~~~~~~~f~~p~~~~~~~~~~G~~~fi~~~~l~~-~~~~~yl~dD~l~ 450 (460)
++|+.|+|||..++||+|+||++++|+..++.++++..+|+||.. ++|. +|||+.|+++++|.. ++ ||+||+|+
T Consensus 84 e~D~~L~WPf~~~itl~llDQ~~r~hi~~~~~pd~~~~~f~RP~~-~~n~-~~G~~~Fv~l~~l~~~~~---Yv~dDtlf 158 (164)
T cd03778 84 PNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVN-DMNI-ASGCPLFCPVSKXEAKNS---YVRDDAIF 158 (164)
T ss_pred CcCcccCCceeeEEEEEEECCCCCCcceeEEEcCcchHhcCCCCc-cccc-CcCcceEEEhhHccccCC---cccCCeEE
Confidence 999999999999999999999988899999999999999999987 7776 799999999999976 45 99999999
Q ss_pred EEEEEe
Q psy7814 451 IKTQVT 456 (460)
Q Consensus 451 i~~~v~ 456 (460)
|+|+|+
T Consensus 159 Ik~~Vd 164 (164)
T cd03778 159 IKAIVD 164 (164)
T ss_pred EEEEEC
Confidence 999884
|
TRAF2 associates with the receptors TNFR-1, TNFR-2, RANK (which mediates differentiation and maturation of osteoclasts) and CD40 (which is important for the proliferation and activation of B cells), among others. It regulates distinct pathways that lead to the activation of nuclear factor-kappaB and Jun NH2-terminal kinases. TRAF2 also indirectly associates with death receptors through its interaction with TRADD (TNFR-associated death domain protein). It is involved in regulating oxidative stress or ROS-induced cell death and in the preconditioning of cells by sublethal stress for protection from subsequent injury. TRAF2 contains a RING finger domain, five z |
| >cd03777 MATH_TRAF3 Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF3 subfamily, TRAF domain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses | Back alignment and domain information |
|---|
| >cd03779 MATH_TRAF1 Tumor Necrosis Factor Receptor (TNFR) Associated Factor (TRAF) family, TRAF1 subfamily, TRAF domain, C-terminal MATH subdomain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses | Back alignment and domain information |
|---|
| >cd03780 MATH_TRAF5 Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF5 subfamily, TRAF domain, C-terminal MATH subdomain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses | Back alignment and domain information |
|---|
| >KOG0297|consensus | Back alignment and domain information |
|---|
| >cd03783 MATH_Meprin_Alpha Meprin family, Alpha subunit, MATH domain; Meprins are multidomain extracellular metalloproteases capable of cleaving growth factors, cytokines, extracellular matrix proteins, and biologically active peptides | Back alignment and domain information |
|---|
| >cd03782 MATH_Meprin_Beta Meprin family, Beta subunit, MATH domain; Meprins are multidomain extracellular metalloproteases capable of cleaving growth factors, cytokines, extracellular matrix proteins, and biologically active peptides | Back alignment and domain information |
|---|
| >cd03771 MATH_Meprin Meprin family, MATH domain; Meprins are multidomain, highly glycosylated extracellular metalloproteases, which are either anchored to the membrane or secreted into extracellular spaces | Back alignment and domain information |
|---|
| >cd03776 MATH_TRAF6 Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF6 subfamily, TRAF domain, C-terminal MATH subdomain; composed of proteins with similarity to human TRAF6, including the Drosophila protein DTRAF2 | Back alignment and domain information |
|---|
| >cd03781 MATH_TRAF4 Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF4 subfamily, TRAF domain, C-terminal MATH subdomain; composed of proteins with similarity to human TRAF4, including the Drosophila protein DTRAF1 | Back alignment and domain information |
|---|
| >cd00270 MATH_TRAF_C Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF domain, C-terminal MATH subdomain; TRAF molecules serve as adapter proteins that link cell surface TNFRs and receptors of the interleukin-1/Toll-like family to downstream kinase signaling cascades which results in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses in the immune and inflammatory systems | Back alignment and domain information |
|---|
| >cd03773 MATH_TRIM37 Tripartite motif containing protein 37 (TRIM37) family, MATH domain; TRIM37 is a peroxisomal protein and is a member of the tripartite motif (TRIM) protein subfamily, also known as the RING-B-box-coiled-coil (RBCC) subfamily of zinc-finger proteins | Back alignment and domain information |
|---|
| >cd03774 MATH_SPOP Speckle-type POZ protein (SPOP) family, MATH domain; composed of proteins with similarity to human SPOP | Back alignment and domain information |
|---|
| >cd03775 MATH_Ubp21p Ubiquitin-specific protease 21 (Ubp21p) family, MATH domain; composed of fungal proteins with similarity to Ubp21p of fission yeast | Back alignment and domain information |
|---|
| >cd03772 MATH_HAUSP Herpesvirus-associated ubiquitin-specific protease (HAUSP, also known as USP7) family, N-terminal MATH (TRAF-like) domain; composed of proteins similar to human HAUSP, an enzyme that specifically catalyzes the deubiquitylation of p53 and MDM2, hence playing an important role in the p53-MDM2 pathway | Back alignment and domain information |
|---|
| >cd00121 MATH MATH (meprin and TRAF-C homology) domain; an independent folding unit with an eight-stranded beta-sandwich structure found in meprins, TRAFs and other proteins | Back alignment and domain information |
|---|
| >PF00917 MATH: MATH domain; InterPro: IPR002083 Although apparently functionally unrelated, intracellular TRAFs and extracellular meprins share a conserved region of about 180 residues, the meprin and TRAF homology (MATH) domain [] | Back alignment and domain information |
|---|
| >smart00061 MATH meprin and TRAF homology | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >PF02176 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A | Back alignment and domain information |
|---|
| >COG5077 Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >KOG0823|consensus | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >KOG3002|consensus | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0320|consensus | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >KOG0287|consensus | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >KOG0317|consensus | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0311|consensus | Back alignment and domain information |
|---|
| >PLN03086 PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG2164|consensus | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0978|consensus | Back alignment and domain information |
|---|
| >KOG2177|consensus | Back alignment and domain information |
|---|
| >KOG1987|consensus | Back alignment and domain information |
|---|
| >KOG2879|consensus | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2660|consensus | Back alignment and domain information |
|---|
| >KOG4159|consensus | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >PF03145 Sina: Seven in absentia protein family; InterPro: IPR018121 The seven in absentia (sina) gene was first identified in Drosophila | Back alignment and domain information |
|---|
| >PF02176 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A | Back alignment and domain information |
|---|
| >PLN03086 PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
| >KOG0824|consensus | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG0802|consensus | Back alignment and domain information |
|---|
| >KOG1813|consensus | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4172|consensus | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >KOG4628|consensus | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3039|consensus | Back alignment and domain information |
|---|
| >KOG1002|consensus | Back alignment and domain information |
|---|
| >KOG1785|consensus | Back alignment and domain information |
|---|
| >KOG4265|consensus | Back alignment and domain information |
|---|
| >KOG0804|consensus | Back alignment and domain information |
|---|
| >KOG1863|consensus | Back alignment and domain information |
|---|
| >KOG1734|consensus | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG4692|consensus | Back alignment and domain information |
|---|
| >KOG1039|consensus | Back alignment and domain information |
|---|
| >KOG4367|consensus | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >KOG1814|consensus | Back alignment and domain information |
|---|
| >KOG1645|consensus | Back alignment and domain information |
|---|
| >KOG4275|consensus | Back alignment and domain information |
|---|
| >KOG3800|consensus | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1001|consensus | Back alignment and domain information |
|---|
| >KOG0825|consensus | Back alignment and domain information |
|---|
| >KOG0826|consensus | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG1812|consensus | Back alignment and domain information |
|---|
| >KOG3161|consensus | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1571|consensus | Back alignment and domain information |
|---|
| >KOG2817|consensus | Back alignment and domain information |
|---|
| >KOG1941|consensus | Back alignment and domain information |
|---|
| >KOG4185|consensus | Back alignment and domain information |
|---|
| >KOG4739|consensus | Back alignment and domain information |
|---|
| >PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) | Back alignment and domain information |
|---|
| >PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG3579|consensus | Back alignment and domain information |
|---|
| >KOG1493|consensus | Back alignment and domain information |
|---|
| >KOG0827|consensus | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0828|consensus | Back alignment and domain information |
|---|
| >KOG3039|consensus | Back alignment and domain information |
|---|
| >KOG2930|consensus | Back alignment and domain information |
|---|
| >KOG2932|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 460 | ||||
| 1lb4_A | 159 | Traf6 Apo Structure Length = 159 | 4e-18 | ||
| 1lb5_A | 160 | Traf6-Rank Complex Length = 160 | 4e-18 | ||
| 3hct_A | 118 | Crystal Structure Of Traf6 In Complex With Ubc13 In | 3e-15 | ||
| 3hcs_A | 170 | Crystal Structure Of The N-Terminal Domain Of Traf6 | 9e-15 | ||
| 1czz_A | 187 | Structure Of Tnf Receptor Associated Factor 2 In Co | 3e-13 | ||
| 1czy_A | 168 | Crystal Structure Of The Complex Between The Traf D | 5e-13 | ||
| 1f3v_B | 171 | Crystal Structure Of The Complex Between The N-Term | 1e-12 | ||
| 1ca9_A | 192 | Structure Of Tnf Receptor Associated Factor 2 In Co | 3e-12 | ||
| 2eci_A | 86 | Solution Structure Of The Ring Domain Of The Human | 4e-12 | ||
| 1ca4_A | 168 | Structure Of Tnf Receptor Associated Factor 2 (Traf | 5e-12 | ||
| 1qsc_A | 191 | Crystal Structure Of The Traf Domain Of Traf2 In A | 1e-11 | ||
| 1flk_A | 228 | Molecular Basis For Cd40 Signaling Mediated By Traf | 1e-11 | ||
| 1rf3_A | 200 | Structurally Distinct Recognition Motifs In Lymphot | 2e-11 | ||
| 4ghu_A | 198 | Crystal Structure Of Traf3CARDIF Length = 198 | 2e-11 | ||
| 1kzz_A | 192 | Downstream Regulator Tank Binds To The Cd40 Recogni | 2e-11 | ||
| 4gjh_A | 178 | Crystal Structure Of The Traf Domain Of Traf5 Lengt | 2e-10 | ||
| 2jmd_A | 63 | Solution Structure Of The Ring Domain Of Human Traf | 1e-09 | ||
| 2ecj_A | 58 | Solution Structure Of The Ring Domain Of The Human | 5e-07 | ||
| 3knv_A | 141 | Crystal Structure Of The Ring And First Zinc Finger | 3e-06 | ||
| 4ayc_B | 138 | Rnf8 Ring Domain Structure Length = 138 | 3e-05 | ||
| 4ayc_A | 138 | Rnf8 Ring Domain Structure Length = 138 | 5e-05 | ||
| 4epo_C | 149 | Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HE | 5e-05 | ||
| 1rmd_A | 116 | Rag1 Dimerization Domain Length = 116 | 3e-04 |
| >pdb|1LB4|A Chain A, Traf6 Apo Structure Length = 159 | Back alignment and structure |
|
| >pdb|1LB5|A Chain A, Traf6-Rank Complex Length = 160 | Back alignment and structure |
| >pdb|3HCT|A Chain A, Crystal Structure Of Traf6 In Complex With Ubc13 In The P1 Space Group Length = 118 | Back alignment and structure |
| >pdb|3HCS|A Chain A, Crystal Structure Of The N-Terminal Domain Of Traf6 Length = 170 | Back alignment and structure |
| >pdb|1CZZ|A Chain A, Structure Of Tnf Receptor Associated Factor 2 In Complex With A 17-Residue Cd40 Peptide Length = 187 | Back alignment and structure |
| >pdb|1CZY|A Chain A, Crystal Structure Of The Complex Between The Traf Domain Of Human Traf2 And An Lmp1 Binding Peptide Length = 168 | Back alignment and structure |
| >pdb|1F3V|B Chain B, Crystal Structure Of The Complex Between The N-Terminal Domain Of Tradd And The Traf Domain Of Traf2 Length = 171 | Back alignment and structure |
| >pdb|1CA9|A Chain A, Structure Of Tnf Receptor Associated Factor 2 In Complex With A Peptide From Tnf-R2 Length = 192 | Back alignment and structure |
| >pdb|2ECI|A Chain A, Solution Structure Of The Ring Domain Of The Human Tnf Receptor-Associated Factor 6 Protein Length = 86 | Back alignment and structure |
| >pdb|1CA4|A Chain A, Structure Of Tnf Receptor Associated Factor 2 (Traf2) Length = 168 | Back alignment and structure |
| >pdb|1QSC|A Chain A, Crystal Structure Of The Traf Domain Of Traf2 In A Complex With A Peptide From The Cd40 Receptor Length = 191 | Back alignment and structure |
| >pdb|1FLK|A Chain A, Molecular Basis For Cd40 Signaling Mediated By Traf3 Length = 228 | Back alignment and structure |
| >pdb|1RF3|A Chain A, Structurally Distinct Recognition Motifs In Lymphotoxin-B Receptor And Cd40 For Traf-Mediated Signaling Length = 200 | Back alignment and structure |
| >pdb|4GHU|A Chain A, Crystal Structure Of Traf3CARDIF Length = 198 | Back alignment and structure |
| >pdb|1KZZ|A Chain A, Downstream Regulator Tank Binds To The Cd40 Recognition Site On Traf3 Length = 192 | Back alignment and structure |
| >pdb|4GJH|A Chain A, Crystal Structure Of The Traf Domain Of Traf5 Length = 178 | Back alignment and structure |
| >pdb|2JMD|A Chain A, Solution Structure Of The Ring Domain Of Human Traf6 Length = 63 | Back alignment and structure |
| >pdb|2ECJ|A Chain A, Solution Structure Of The Ring Domain Of The Human Tripartite Motif-Containing Protein 39 Length = 58 | Back alignment and structure |
| >pdb|3KNV|A Chain A, Crystal Structure Of The Ring And First Zinc Finger Domains Of Traf2 Length = 141 | Back alignment and structure |
| >pdb|4AYC|B Chain B, Rnf8 Ring Domain Structure Length = 138 | Back alignment and structure |
| >pdb|4AYC|A Chain A, Rnf8 Ring Domain Structure Length = 138 | Back alignment and structure |
| >pdb|4EPO|C Chain C, Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HETERODIMER Length = 149 | Back alignment and structure |
| >pdb|1RMD|A Chain A, Rag1 Dimerization Domain Length = 116 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1ca9_A TRAF2, protein (TNF receptor associated factor 2); TNF signaling, TRAF, adapter protein, cell surviVal; 2.30A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1qsc_A 1czz_A Length = 192 | Back alignment and structure |
|---|
Score = 123 bits (309), Expect = 3e-33
Identities = 48/194 (24%), Positives = 90/194 (46%), Gaps = 9/194 (4%)
Query: 271 ERMVLLEQSMLEQKIKVNNFELNLKQTEEIEDNVVLKLCNGVYFWKMYNFPAKLKEMKE- 329
+++ L + + + + +L + E+ + +GV+ WK+ +F K +E
Sbjct: 3 DKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAG 62
Query: 330 INRYFYSACFYSSCFGYRFCTRVNI---SREDAQYLSLFIHLVQGENDDILDWPFVGRIR 386
+S FY+S +GY+ C R+ + +LSLF +++G ND +L WPF ++
Sbjct: 63 RIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVT 122
Query: 387 FTALNTSSEFSITDEIQSDKNFDSFKRPVNFFLNKKAFGFNNFIRVADVLDPGRGFLMED 446
L+ ++ + D + D SF+RPVN A G F V+ ++ ++ D
Sbjct: 123 LMLLDQNNREHVIDAFRPDVTSSSFQRPVND--MNIASGCPLFCPVSK-MEAKNSYV-RD 178
Query: 447 DTFVIKTQVTEMTH 460
D IK V ++T
Sbjct: 179 DAIFIKAIV-DLTG 191
|
| >2gkw_A TNF receptor-associated factor 3; CD40, NF-KB signaling, BAFF receptor, TRAF3, apoptosis; 2.70A {Homo sapiens} PDB: 1kzz_A 1l0a_A 1zms_A 1rf3_A Length = 192 | Back alignment and structure |
|---|
| >1flk_A TNF receptor associated factor 3; TNF signaling, TRAF3, CD40-binding protein, apoptosis; 2.80A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1fll_A Length = 228 | Back alignment and structure |
|---|
| >1lb6_A TNF receptor-associated factor 6; TRAF6-CD40 complex, signaling protein; 1.80A {Homo sapiens} SCOP: b.8.1.1 PDB: 1lb5_A 1lb4_A Length = 160 | Back alignment and structure |
|---|
| >1d00_A Tumor necrosis factor receptor associated protein 2; B-sandwich, protein-peptide complex, apoptosis; 2.00A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1ca4_A 1d0j_A 1f3v_B 1czy_A 1d01_A 1d0a_A Length = 168 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >3ivv_A Speckle-type POZ protein; protein binding, nucleus, UBL conjugation pathway, ligase; 1.25A {Homo sapiens} PDB: 3ivq_A 3ivb_A 3hsv_A 3hqh_A 3hqm_A 3hql_A 2cr2_A Length = 145 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2foj_A Ubiquitin carboxyl-terminal hydrolase 7; MATH domain, hydrolase; 1.60A {Homo sapiens} PDB: 1yze_A 1yy6_A 2foo_A 2fop_A 3mqr_A 3mqs_C 2f1w_A 2f1x_A 2f1y_A 2xxn_A Length = 155 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Length = 61 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Length = 78 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Length = 93 | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 | Back alignment and structure |
|---|
| >3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Length = 100 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 460 | |||
| 1flk_A | 228 | TNF receptor associated factor 3; TNF signaling, T | 100.0 | |
| 4ghu_A | 198 | TNF receptor-associated factor 3; alpha/beta, inna | 100.0 | |
| 2gkw_A | 192 | TNF receptor-associated factor 3; CD40, NF-KB sign | 100.0 | |
| 1ca9_A | 192 | TRAF2, protein (TNF receptor associated factor 2); | 100.0 | |
| 1lb6_A | 160 | TNF receptor-associated factor 6; TRAF6-CD40 compl | 100.0 | |
| 4gjh_A | 178 | TNF receptor-associated factor 5; TRAF domain, imm | 100.0 | |
| 1d00_A | 168 | Tumor necrosis factor receptor associated protein | 100.0 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 99.94 | |
| 4gwm_A | 592 | Meprin A subunit beta; mulidomain structure, hydro | 99.92 | |
| 3ivv_A | 145 | Speckle-type POZ protein; protein binding, nucleus | 99.92 | |
| 2foj_A | 155 | Ubiquitin carboxyl-terminal hydrolase 7; MATH doma | 99.88 | |
| 3hqi_A | 312 | Speckle-type POZ protein; SPOP, ubiquitin, puckere | 99.83 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 99.81 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 99.78 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 99.73 | |
| 2f1z_A | 522 | Ubiquitin carboxyl-terminal hydrolase 7; hausp, US | 99.71 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 99.39 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.39 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 99.36 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.36 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 99.35 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.26 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.24 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 99.24 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.21 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.21 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.18 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.16 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.15 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 99.15 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 99.15 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.14 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.13 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 99.13 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 99.11 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.1 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.08 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 99.08 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.07 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.07 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 99.07 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.05 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.04 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 99.04 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 99.02 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 99.01 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 99.0 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 98.97 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 98.95 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 98.95 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.92 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 98.91 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 98.86 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 98.83 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 98.82 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 98.8 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.79 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 98.78 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 98.78 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 98.78 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 98.73 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.73 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 98.73 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.7 | |
| 2yuc_A | 76 | TNF receptor-associated factor 4; ZF-TRAF, cystein | 98.6 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 98.55 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.53 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.51 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 98.41 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.4 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.39 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.36 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.33 | |
| 2yre_A | 100 | F-box only protein 30; zinc binding, E3 ubiquitin | 98.27 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.21 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.17 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 98.16 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.15 | |
| 2yuc_A | 76 | TNF receptor-associated factor 4; ZF-TRAF, cystein | 98.1 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 98.01 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 97.93 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 97.79 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 97.68 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 97.51 | |
| 2d9k_A | 75 | FLN29 gene product; zinc finger, ZF-TRAF, structur | 97.0 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 96.85 | |
| 2yre_A | 100 | F-box only protein 30; zinc binding, E3 ubiquitin | 96.34 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 96.08 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 96.04 | |
| 2a25_A | 193 | Ubiquitin ligase SIAH1; protein-peptide complex, l | 95.8 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 95.06 | |
| 2d9k_A | 75 | FLN29 gene product; zinc finger, ZF-TRAF, structur | 94.12 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 93.91 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 93.75 | |
| 2cs3_A | 93 | Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s | 93.46 | |
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 90.53 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 88.92 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 88.19 | |
| 4fo9_A | 360 | E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom | 87.57 | |
| 1weo_A | 93 | Cellulose synthase, catalytic subunit (IRX3); stru | 83.73 |
| >1flk_A TNF receptor associated factor 3; TNF signaling, TRAF3, CD40-binding protein, apoptosis; 2.80A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1fll_A | Back alignment and structure |
|---|
Probab=100.00 E-value=5.1e-41 Score=313.62 Aligned_cols=207 Identities=25% Similarity=0.415 Sum_probs=155.1
Q ss_pred Cccccccccccccccc-----cchhHHHHHhhhchHHHHHHHHHHhhccCcccCCCCCCCCCCchhHHHHHHHHHhhhhh
Q psy7814 158 ENFPCKFYQVGCREVF-----KSQALLEKHYDLKTSFHLELLFNKYCSDGSQSTNTPSHGRQDTSNQKEIEAYLMKNKEH 232 (460)
Q Consensus 158 ~~v~Cp~~~~GC~~~~-----~r~~~l~~H~~~~~~~Hl~ll~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 232 (460)
..+.|||...||..++ +|.. |++|+......|+.++...+.
T Consensus 8 ~~i~c~~~~~gc~~~~~~~~~~r~~-~~~h~~~~~~~h~~~~~~~i~--------------------------------- 53 (228)
T 1flk_A 8 DSMKSSVESLQNRVTELESVDKSAG-QVARNTGLLESQLSRHDQMLS--------------------------------- 53 (228)
T ss_dssp ----------------CTTTTTTTT-THHHHHHHHHHHHHHHHHHHH---------------------------------
T ss_pred hheeccccccCceeeccccccchhH-HHHHHHHHHHHHHHHHHHHHH---------------------------------
Confidence 3789999999999999 9999 999999988899888654331
Q ss_pred cccccCCCCCCCCCCCCCCCCCcccCCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhccccCcE
Q psy7814 233 ESKLWDPNKNQAGDDKSSEGDCSCKTCGDNSHLLKLVYERMVLLEQSMLEQKIKVNNFELNLKQTEEIEDNVVLKLCNGV 312 (460)
Q Consensus 233 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~i~~l~~~~~~l~~~~~~l~~~l~~l~~~~~~~~~~~~~g~ 312 (460)
.+..++..++.+|. +++..+++|+
T Consensus 54 -------------------------------------------------~~~~~i~~~~~~l~-------~l~~~~~~g~ 77 (228)
T 1flk_A 54 -------------------------------------------------VHDIRLADMDLRFQ-------VLETASYNGV 77 (228)
T ss_dssp -------------------------------------------------HHHHHHHHHHHHHH-------HHHTCCSSSE
T ss_pred -------------------------------------------------HHHHHHHHHHHHHH-------HhhccCcCcE
Confidence 11112222222333 3445678999
Q ss_pred EEEEECChHHHHHHhhh-cCCeEeccCceeCCCccEEEEEEEeCCCC---CCeEEEEEEEecCCCCCCCCCCCCceeEEE
Q psy7814 313 YFWKMYNFPAKLKEMKE-INRYFYSACFYSSCFGYRFCTRVNISRED---AQYLSLFIHLVQGENDDILDWPFVGRIRFT 388 (460)
Q Consensus 313 ~~w~I~~fs~~~~~~~~-~~~~~~S~~F~~~~~Gyk~~l~~yp~G~~---~~~lS~~l~l~~g~~D~~l~Wp~~~~~~l~ 388 (460)
|+|+|+|||.++..+.. ....++|++||+|.+||+|+|++||||++ ++|||+||+|++|++|+.|+|||+++|+|+
T Consensus 78 ~~wkI~nfS~~~~~~~~g~~~~i~S~~F~vg~~Gy~w~i~~yPnG~~~~~~~~lSlyL~l~~~~~d~~l~Wp~~a~~~l~ 157 (228)
T 1flk_A 78 LIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLM 157 (228)
T ss_dssp EEEEEECHHHHHHHHHTTSCCCEECCCEESSTTSCEECEEEETTCCGGGTTTEEEEEECCBCCTTTTSSCSSCCCCEEEE
T ss_pred EEEEECCHHHHHHHhhcCCCeeEECceEEeCCCCcEEEEEEEcCCCCCCCCCEEEEEEEEecCCccccCCCcEEEEEEEE
Confidence 99999999999865443 23589999999998899999999999964 689999999999999999999999999999
Q ss_pred EEcCCCCC-eeeEEEecCCCCCCCCCCcccCCCccCCCccceeecccccCCCCcccccCCeEEEEEEEeecc
Q psy7814 389 ALNTSSEF-SITDEIQSDKNFDSFKRPVNFFLNKKAFGFNNFIRVADVLDPGRGFLMEDDTFVIKTQVTEMT 459 (460)
Q Consensus 389 lldq~~~~-~~~~~~~~~~~~~~f~~p~~~~~~~~~~G~~~fi~~~~l~~~~~~~yl~dD~l~i~~~v~v~~ 459 (460)
|+||.+++ ++.+++.+++....|.+|.. ..+ .+|||+.||++++|+++| ||+||+|+|+|+|+|.+
T Consensus 158 lldq~~~~~~~~~~~~~~~~~~~F~rp~~-~~~-~~wG~~~Fi~~~~L~~~g---yL~dD~l~I~~~V~v~~ 224 (228)
T 1flk_A 158 LMDQGSSRRHLGDAFKPDPNSSSFKKPTG-EMN-IASGCPVFVAQTVLENGT---YIKDDTIFIKVIVDTSD 224 (228)
T ss_dssp ECCCSSSCCCEEEEECCCTTCTTSSSCSS-SBC-CCCSEEEEEEHHHHSSST---TCCSSEEEEEEECCCTT
T ss_pred EEcCCCCccceeeeecCCCccccccCCcc-CCC-CCcCHHHeeEHHHHccCC---CccCCEEEEEEEEEccc
Confidence 99998765 66677878877788999975 444 489999999999999877 99999999999998753
|
| >4ghu_A TNF receptor-associated factor 3; alpha/beta, innate immunity, IFN pathway, immune system; 2.20A {Mus musculus} PDB: 2gkw_A 1kzz_A 1l0a_A 1zms_A 1rf3_A | Back alignment and structure |
|---|
| >2gkw_A TNF receptor-associated factor 3; CD40, NF-KB signaling, BAFF receptor, TRAF3, apoptosis; 2.70A {Homo sapiens} PDB: 1kzz_A 1l0a_A 1zms_A 1rf3_A | Back alignment and structure |
|---|
| >1ca9_A TRAF2, protein (TNF receptor associated factor 2); TNF signaling, TRAF, adapter protein, cell surviVal; 2.30A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1qsc_A 1czz_A | Back alignment and structure |
|---|
| >1lb6_A TNF receptor-associated factor 6; TRAF6-CD40 complex, signaling protein; 1.80A {Homo sapiens} SCOP: b.8.1.1 PDB: 1lb5_A 1lb4_A | Back alignment and structure |
|---|
| >4gjh_A TNF receptor-associated factor 5; TRAF domain, immune system; 2.81A {Mus musculus} | Back alignment and structure |
|---|
| >1d00_A Tumor necrosis factor receptor associated protein 2; B-sandwich, protein-peptide complex, apoptosis; 2.00A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1ca4_A 1d0j_A 1f3v_B 1czy_A 1d01_A 1d0a_A | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >4gwm_A Meprin A subunit beta; mulidomain structure, hydrolase; HET: NAG BMA FUC MAN; 1.85A {Homo sapiens} PDB: 4gwn_A* | Back alignment and structure |
|---|
| >3ivv_A Speckle-type POZ protein; protein binding, nucleus, UBL conjugation pathway, ligase; 1.25A {Homo sapiens} SCOP: b.8.1.1 PDB: 3ivq_A 3ivb_A 3hsv_A 3hqh_A 3hqm_A 3hql_A 2cr2_A | Back alignment and structure |
|---|
| >2foj_A Ubiquitin carboxyl-terminal hydrolase 7; MATH domain, hydrolase; 1.60A {Homo sapiens} PDB: 1yze_A 1yy6_A 2foo_A 2fop_A 3mqr_A 3mqs_C 2f1w_A 2f1x_A 2f1y_A 2xxn_A | Back alignment and structure |
|---|
| >3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2f1z_A Ubiquitin carboxyl-terminal hydrolase 7; hausp, USP7, UBP, deubiquitinating enzyme, substrate recognition; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2yre_A F-box only protein 30; zinc binding, E3 ubiquitin ligase, SCF, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2yre_A F-box only protein 30; zinc binding, E3 ubiquitin ligase, SCF, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2a25_A Ubiquitin ligase SIAH1; protein-peptide complex, ligase; 2.20A {Homo sapiens} PDB: 2an6_A 1k2f_A | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B | Back alignment and structure |
|---|
| >1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 460 | ||||
| d1czya1 | 152 | b.8.1.1 (A:350-501) TNF receptor associated factor | 1e-21 | |
| d1lb6a_ | 155 | b.8.1.1 (A:) TNF receptor associated factor 6 (TRA | 1e-20 | |
| d1l0aa1 | 155 | b.8.1.1 (A:350-504) TNF receptor associated factor | 8e-19 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 8e-13 | |
| d2cr2a1 | 146 | b.8.1.1 (A:8-153) Speckle-type poz protein SPOP {H | 2e-11 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 1e-10 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 1e-10 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 3e-09 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 2e-08 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 4e-08 | |
| d1t1ha_ | 78 | g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre | 7e-08 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 4e-06 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 1e-05 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 1e-05 | |
| d2c2la2 | 80 | g.44.1.2 (A:225-304) STIP1 homology and U box-cont | 9e-05 | |
| d1vyxa_ | 60 | g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do | 1e-04 | |
| d1wima_ | 94 | g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 | 4e-04 | |
| d2baya1 | 56 | g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { | 0.002 | |
| d2cs3a1 | 80 | g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Huma | 0.002 | |
| d1v87a_ | 114 | g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou | 0.002 |
| >d1czya1 b.8.1.1 (A:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens) [TaxId: 9606]} Length = 152 | Back information, alignment and structure |
|---|
class: All beta proteins fold: TRAF domain-like superfamily: TRAF domain-like family: MATH domain domain: TNF receptor associated factor 2 (TRAF2) species: Human (Homo sapiens) [TaxId: 9606]
Score = 89.1 bits (220), Expect = 1e-21
Identities = 43/150 (28%), Positives = 73/150 (48%), Gaps = 8/150 (5%)
Query: 310 NGVYFWKMYNFPAKLKEMKE-INRYFYSACFYSSCFGYRFCTRVNISREDAQ---YLSLF 365
+GV+ WK+ +FP K +E +S FY+S +GY+ C R+ ++ + +LSLF
Sbjct: 2 DGVFIWKISDFPRKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLF 61
Query: 366 IHLVQGENDDILDWPFVGRIRFTALNTSSEFSITDEIQSDKNFDSFKRPVNFFLNKKAFG 425
+++G ND +L WPF ++ L+ ++ + D + D SF+RP A G
Sbjct: 62 FVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRP--VNDMNIASG 119
Query: 426 FNNFIRVADVLDPGRGFLMEDDTFVIKTQV 455
F V ++ ++ DD IK V
Sbjct: 120 CPLFCPV-SKMEAKNSYV-RDDAIFIKAIV 147
|
| >d1lb6a_ b.8.1.1 (A:) TNF receptor associated factor 6 (TRAF6) {Human (Homo sapiens) [TaxId: 9606]} Length = 155 | Back information, alignment and structure |
|---|
| >d1l0aa1 b.8.1.1 (A:350-504) TNF receptor associated factor 3 (TRAF3) {Human (Homo sapiens) [TaxId: 9606]} Length = 155 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d2cr2a1 b.8.1.1 (A:8-153) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]} Length = 146 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 460 | |||
| d1czya1 | 152 | TNF receptor associated factor 2 (TRAF2) {Human (H | 100.0 | |
| d1l0aa1 | 155 | TNF receptor associated factor 3 (TRAF3) {Human (H | 100.0 | |
| d1lb6a_ | 155 | TNF receptor associated factor 6 (TRAF6) {Human (H | 100.0 | |
| d2cr2a1 | 146 | Speckle-type poz protein SPOP {Human (Homo sapiens | 99.87 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 99.44 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 99.42 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.31 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.25 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 99.24 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.2 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.08 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.06 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 98.92 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 98.91 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 98.87 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 98.77 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 98.73 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 98.28 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 98.27 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 98.22 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 97.44 | |
| d1k2fa_ | 190 | SIAH, seven in absentia homolog {Mouse (Mus muscul | 96.42 | |
| d2cs3a1 | 80 | Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ | 91.73 | |
| d1weoa_ | 93 | Cellulose synthase A catalytic subunit 7, IRX3 {Th | 87.05 | |
| d1ncsa_ | 47 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 84.09 |
| >d1czya1 b.8.1.1 (A:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: TRAF domain-like superfamily: TRAF domain-like family: MATH domain domain: TNF receptor associated factor 2 (TRAF2) species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=2.2e-34 Score=250.68 Aligned_cols=147 Identities=31% Similarity=0.592 Sum_probs=130.4
Q ss_pred cCcEEEEEECChHHHHHHhhh-cCCeEeccCceeCCCccEEEEEEEeCCCC---CCeEEEEEEEecCCCCCCCCCCCCce
Q psy7814 309 CNGVYFWKMYNFPAKLKEMKE-INRYFYSACFYSSCFGYRFCTRVNISRED---AQYLSLFIHLVQGENDDILDWPFVGR 384 (460)
Q Consensus 309 ~~g~~~w~I~~fs~~~~~~~~-~~~~~~S~~F~~~~~Gyk~~l~~yp~G~~---~~~lS~~l~l~~g~~D~~l~Wp~~~~ 384 (460)
|+|+|+|+|.|||.+++.+.. .+..++||+||+|..||+|+|++||+|.+ ++||||||+|++|++|+.++||+.++
T Consensus 1 ~~g~f~W~I~nFs~l~~~~~~~~~~~~~Sp~F~~g~~Gy~w~l~~yP~G~~~~~~~~lSlyL~l~~~~~d~~~~~~~~~~ 80 (152)
T d1czya1 1 YDGVFIWKISDFPRKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQK 80 (152)
T ss_dssp SSSEEEEEECSHHHHHHHHHTTSCCCEECCCEESSTTSCEEEEEEETTCCGGGTTTEEEEEEEEECCTTGGGSCSSCCCC
T ss_pred CCCEEEEEECCcHHHHHhhhcCCCceEECcCEEcCCCCeEEEEEEEeCCCCCCCCCEEEEEEEEccCCcCcccccceeeE
Confidence 689999999999999887666 66789999999998899999999999964 68999999999999999999999999
Q ss_pred eEEEEEcCCCCCeeeEEEecCCCCCCCCCCcccCCCccCCCccceeecccccCCCCcccccCCeEEEEEEEeecc
Q psy7814 385 IRFTALNTSSEFSITDEIQSDKNFDSFKRPVNFFLNKKAFGFNNFIRVADVLDPGRGFLMEDDTFVIKTQVTEMT 459 (460)
Q Consensus 385 ~~l~lldq~~~~~~~~~~~~~~~~~~f~~p~~~~~~~~~~G~~~fi~~~~l~~~~~~~yl~dD~l~i~~~v~v~~ 459 (460)
++|+|+||.+.++...++...+....|++|.. ..+. +|||++||++++|+.. .|||+||+|+|+|+|+|.+
T Consensus 81 ~~~~l~d~~~~~~~~~~~~~~~~~~~~~r~~~-~~~~-~~G~~~fi~~~~L~~~--~gfl~dD~l~I~~~V~v~~ 151 (152)
T d1czya1 81 VTLMLLDQNNREHVIDAFRPDVTSSSFQRPVN-DMNI-ASGCPLFCPVSKMEAK--NSYVRDDAIFIKAIVDLTG 151 (152)
T ss_dssp EEEEECCTTSSCCEEEEECCCTTSGGGSCCSS-SBCC-CEEEEEEEETCCCCCS--TTTSCSSCEEEEEEECCTT
T ss_pred EEEEEEcCCCCccceeeeccccccccccCCCc-cccc-ccchhhEEEHHHhccc--CCcEeCCEEEEEEEEEecc
Confidence 99999999988877777777777788999986 5554 8999999999999642 1399999999999998864
|
| >d1l0aa1 b.8.1.1 (A:350-504) TNF receptor associated factor 3 (TRAF3) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lb6a_ b.8.1.1 (A:) TNF receptor associated factor 6 (TRAF6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cr2a1 b.8.1.1 (A:8-153) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k2fa_ b.8.1.2 (A:) SIAH, seven in absentia homolog {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|