Psyllid ID: psy858
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 72 | ||||||
| 328722868 | 670 | PREDICTED: ATP-binding cassette sub-fami | 0.986 | 0.105 | 0.718 | 2e-24 | |
| 328705811 | 1747 | PREDICTED: ATP-binding cassette sub-fami | 0.972 | 0.040 | 0.690 | 6e-24 | |
| 390344366 | 2717 | PREDICTED: ATP-binding cassette sub-fami | 0.972 | 0.025 | 0.676 | 1e-21 | |
| 405974925 | 1716 | ATP-binding cassette sub-family A member | 0.944 | 0.039 | 0.623 | 6e-21 | |
| 242013193 | 1441 | conserved hypothetical protein [Pediculu | 0.944 | 0.047 | 0.681 | 2e-20 | |
| 405945282 | 1191 | ATP-binding cassette sub-family A member | 0.944 | 0.057 | 0.608 | 9e-20 | |
| 289623446 | 1721 | ATP-binding cassette transporter sub-fam | 0.972 | 0.040 | 0.633 | 1e-19 | |
| 444723944 | 2286 | ATP-binding cassette sub-family A member | 0.986 | 0.031 | 0.638 | 1e-19 | |
| 524898263 | 1805 | PREDICTED: ATP-binding cassette sub-fami | 0.972 | 0.038 | 0.605 | 1e-19 | |
| 524897576 | 1674 | PREDICTED: ATP-binding cassette sub-fami | 0.944 | 0.040 | 0.608 | 1e-19 |
| >gi|328722868|ref|XP_001949822.2| PREDICTED: ATP-binding cassette sub-family A member 1-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 116 bits (290), Expect = 2e-24, Method: Composition-based stats.
Identities = 51/71 (71%), Positives = 61/71 (85%)
Query: 1 MGLTEYRHRESGRYSGGNKRKLSTAMALIGDPPLVFLDEPTSGVDPISRHRLWAVLSQIQ 60
+GL E++ R G YSGGNKRKL+TAMALIGDPP+VFLDEPTSGVDP++RH LW VL+ Q
Sbjct: 468 LGLEEHKDRICGTYSGGNKRKLNTAMALIGDPPVVFLDEPTSGVDPVARHNLWQVLAASQ 527
Query: 61 KTGQSIVLTSH 71
+ GQ+IVLTSH
Sbjct: 528 RGGQAIVLTSH 538
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328705811|ref|XP_001947916.2| PREDICTED: ATP-binding cassette sub-family A member 3-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|390344366|ref|XP_003726106.1| PREDICTED: ATP-binding cassette sub-family A member 1-like [Strongylocentrotus purpuratus] | Back alignment and taxonomy information |
|---|
| >gi|405974925|gb|EKC39537.1| ATP-binding cassette sub-family A member 3 [Crassostrea gigas] | Back alignment and taxonomy information |
|---|
| >gi|242013193|ref|XP_002427299.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212511640|gb|EEB14561.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|405945282|gb|EKC17257.1| ATP-binding cassette sub-family A member 3 [Crassostrea gigas] | Back alignment and taxonomy information |
|---|
| >gi|289623446|emb|CAH59462.2| ATP-binding cassette transporter sub-family A [Pecten maximus] | Back alignment and taxonomy information |
|---|
| >gi|444723944|gb|ELW64568.1| ATP-binding cassette sub-family A member 1 [Tupaia chinensis] | Back alignment and taxonomy information |
|---|
| >gi|524898263|ref|XP_005105583.1| PREDICTED: ATP-binding cassette sub-family A member 3-like [Aplysia californica] | Back alignment and taxonomy information |
|---|
| >gi|524897576|ref|XP_005105248.1| PREDICTED: ATP-binding cassette sub-family A member 3-like [Aplysia californica] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 72 | ||||||
| UNIPROTKB|F5H5R2 | 392 | ABCA4 "Retinal-specific ATP-bi | 0.986 | 0.181 | 0.619 | 3.6e-18 | |
| UNIPROTKB|I3L6Q4 | 954 | ABCA1 "Uncharacterized protein | 0.986 | 0.074 | 0.619 | 3.7e-18 | |
| UNIPROTKB|K7GNJ3 | 961 | ABCA1 "Uncharacterized protein | 0.986 | 0.073 | 0.619 | 3.7e-18 | |
| UNIPROTKB|E2QUX2 | 2262 | ABCA1 "Uncharacterized protein | 0.986 | 0.031 | 0.633 | 5.4e-18 | |
| UNIPROTKB|F1MG24 | 2261 | ABCA1 "Uncharacterized protein | 0.986 | 0.031 | 0.633 | 6.9e-18 | |
| UNIPROTKB|O95477 | 2261 | ABCA1 "ATP-binding cassette su | 0.986 | 0.031 | 0.619 | 6.9e-18 | |
| UNIPROTKB|B4DWY6 | 543 | ABCA4 "cDNA FLJ51128, highly s | 0.986 | 0.130 | 0.619 | 9.7e-18 | |
| UNIPROTKB|H0YCN5 | 591 | ABCA7 "ATP-binding cassette su | 0.986 | 0.120 | 0.577 | 1.2e-17 | |
| ZFIN|ZDB-GENE-031006-12 | 2268 | abca1a "ATP-binding cassette, | 0.986 | 0.031 | 0.619 | 1.8e-17 | |
| MGI|MGI:1351646 | 2159 | Abca7 "ATP-binding cassette, s | 0.986 | 0.032 | 0.591 | 2.2e-17 |
| UNIPROTKB|F5H5R2 ABCA4 "Retinal-specific ATP-binding cassette transporter" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 224 (83.9 bits), Expect = 3.6e-18, P = 3.6e-18
Identities = 44/71 (61%), Positives = 55/71 (77%)
Query: 1 MGLTEYRHRESGRYSGGNKRKLSTAMALIGDPPLVFLDEPTSGVDPISRHRLWAVLSQIQ 60
+GLT Y +G YSGGNKRKLSTA+ALIG PPLV LDEPT+G+DP +R LW V+ I
Sbjct: 177 LGLTVYADCLAGTYSGGNKRKLSTAIALIGCPPLVLLDEPTTGMDPQARRMLWNVIVSII 236
Query: 61 KTGQSIVLTSH 71
+ G+++VLTSH
Sbjct: 237 REGRAVVLTSH 247
|
|
| UNIPROTKB|I3L6Q4 ABCA1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7GNJ3 ABCA1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QUX2 ABCA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MG24 ABCA1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O95477 ABCA1 "ATP-binding cassette sub-family A member 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4DWY6 ABCA4 "cDNA FLJ51128, highly similar to Retinal-specific ATP-binding cassette transporter" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0YCN5 ABCA7 "ATP-binding cassette sub-family A member 7" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-031006-12 abca1a "ATP-binding cassette, sub-family A (ABC1), member 1A" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1351646 Abca7 "ATP-binding cassette, sub-family A (ABC1), member 7" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 72 | |||
| cd03263 | 220 | cd03263, ABC_subfamily_A, ATP-binding cassette dom | 7e-33 | |
| cd03230 | 173 | cd03230, ABC_DR_subfamily_A, ATP-binding cassette | 2e-25 | |
| COG1131 | 293 | COG1131, CcmA, ABC-type multidrug transport system | 4e-25 | |
| TIGR01257 | 2272 | TIGR01257, rim_protein, retinal-specific rim ABC t | 5e-25 | |
| cd03225 | 211 | cd03225, ABC_cobalt_CbiO_domain1, First domain of | 1e-20 | |
| cd03265 | 220 | cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist | 3e-20 | |
| cd00267 | 157 | cd00267, ABC_ATPase, ATP-binding cassette transpor | 7e-20 | |
| TIGR01188 | 302 | TIGR01188, drrA, daunorubicin resistance ABC trans | 1e-19 | |
| TIGR01257 | 2272 | TIGR01257, rim_protein, retinal-specific rim ABC t | 1e-16 | |
| cd03264 | 211 | cd03264, ABC_drug_resistance_like, ABC-type multid | 1e-16 | |
| cd03235 | 213 | cd03235, ABC_Metallic_Cations, ATP-binding cassett | 6e-16 | |
| COG1121 | 254 | COG1121, ZnuC, ABC-type Mn/Zn transport systems, A | 1e-15 | |
| PRK13536 | 340 | PRK13536, PRK13536, nodulation factor exporter sub | 1e-15 | |
| PRK13537 | 306 | PRK13537, PRK13537, nodulation ABC transporter Nod | 1e-15 | |
| TIGR01288 | 303 | TIGR01288, nodI, ATP-binding ABC transporter famil | 3e-15 | |
| cd03219 | 236 | cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas | 4e-15 | |
| cd03268 | 208 | cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c | 9e-15 | |
| COG1122 | 235 | COG1122, CbiO, ABC-type cobalt transport system, A | 1e-14 | |
| cd03213 | 194 | cd03213, ABCG_EPDR, Eye pigment and drug resistanc | 2e-14 | |
| COG1120 | 258 | COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore | 5e-14 | |
| COG4555 | 245 | COG4555, NatA, ABC-type Na+ transport system, ATPa | 2e-13 | |
| COG0411 | 250 | COG0411, LivG, ABC-type branched-chain amino acid | 2e-13 | |
| cd03224 | 222 | cd03224, ABC_TM1139_LivF_branched, ATP-binding cas | 5e-13 | |
| cd03269 | 210 | cd03269, ABC_putative_ATPase, ATP-binding cassette | 5e-13 | |
| cd03214 | 180 | cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind | 5e-13 | |
| TIGR01166 | 190 | TIGR01166, cbiO, cobalt transport protein ATP-bind | 7e-13 | |
| cd03228 | 171 | cd03228, ABCC_MRP_Like, ATP-binding cassette domai | 9e-13 | |
| TIGR00955 | 617 | TIGR00955, 3a01204, The Eye Pigment Precursor Tran | 1e-12 | |
| COG1125 | 309 | COG1125, OpuBA, ABC-type proline/glycine betaine t | 1e-12 | |
| cd03226 | 205 | cd03226, ABC_cobalt_CbiO_domain2, Second domain of | 2e-12 | |
| TIGR03740 | 223 | TIGR03740, galliderm_ABC, gallidermin-class lantib | 3e-12 | |
| cd03234 | 226 | cd03234, ABCG_White, White pigment protein homolog | 4e-12 | |
| cd03266 | 218 | cd03266, ABC_NatA_sodium_exporter, ATP-binding cas | 6e-12 | |
| cd03229 | 178 | cd03229, ABC_Class3, ATP-binding cassette domain o | 8e-12 | |
| cd03218 | 232 | cd03218, ABC_YhbG, ATP-binding cassette component | 1e-11 | |
| COG1116 | 248 | COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon | 1e-11 | |
| PRK13646 | 286 | PRK13646, cbiO, cobalt transporter ATP-binding sub | 2e-11 | |
| cd03295 | 242 | cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas | 2e-11 | |
| TIGR01186 | 363 | TIGR01186, proV, glycine betaine/L-proline transpo | 2e-11 | |
| cd03261 | 235 | cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca | 3e-11 | |
| COG1119 | 257 | COG1119, ModF, ABC-type molybdenum transport syste | 3e-11 | |
| cd03293 | 220 | cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c | 6e-11 | |
| cd03246 | 173 | cd03246, ABCC_Protease_Secretion, ATP-binding cass | 6e-11 | |
| COG4152 | 300 | COG4152, COG4152, ABC-type uncharacterized transpo | 1e-10 | |
| PRK13643 | 288 | PRK13643, cbiO, cobalt transporter ATP-binding sub | 1e-10 | |
| PRK15056 | 272 | PRK15056, PRK15056, manganese/iron transporter ATP | 1e-10 | |
| COG0410 | 237 | COG0410, LivF, ABC-type branched-chain amino acid | 2e-10 | |
| cd03255 | 218 | cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse | 2e-10 | |
| COG4987 | 573 | COG4987, CydC, ABC-type transport system involved | 2e-10 | |
| cd03259 | 213 | cd03259, ABC_Carb_Solutes_like, ATP-binding casset | 2e-10 | |
| cd03247 | 178 | cd03247, ABCC_cytochrome_bd, ATP-binding cassette | 3e-10 | |
| cd03299 | 235 | cd03299, ABC_ModC_like, ATP-binding cassette domai | 3e-10 | |
| COG2274 | 709 | COG2274, SunT, ABC-type bacteriocin/lantibiotic ex | 4e-10 | |
| COG0444 | 316 | COG0444, DppD, ABC-type dipeptide/oligopeptide/nic | 4e-10 | |
| COG4586 | 325 | COG4586, COG4586, ABC-type uncharacterized transpo | 4e-10 | |
| COG1135 | 339 | COG1135, AbcC, ABC-type metal ion transport system | 4e-10 | |
| COG1127 | 263 | COG1127, Ttg2A, ABC-type transport system involved | 4e-10 | |
| TIGR03608 | 206 | TIGR03608, L_ocin_972_ABC, putative bacteriocin ex | 5e-10 | |
| COG1136 | 226 | COG1136, SalX, ABC-type antimicrobial peptide tran | 6e-10 | |
| cd03257 | 228 | cd03257, ABC_NikE_OppD_transporters, ATP-binding c | 7e-10 | |
| cd03298 | 211 | cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin | 7e-10 | |
| PRK13651 | 305 | PRK13651, PRK13651, cobalt transporter ATP-binding | 1e-09 | |
| PRK13652 | 277 | PRK13652, cbiO, cobalt transporter ATP-binding sub | 1e-09 | |
| PRK13649 | 280 | PRK13649, cbiO, cobalt transporter ATP-binding sub | 1e-09 | |
| COG1123 | 539 | COG1123, COG1123, ATPase components of various ABC | 2e-09 | |
| PRK13641 | 287 | PRK13641, cbiO, cobalt transporter ATP-binding sub | 2e-09 | |
| COG4175 | 386 | COG4175, ProV, ABC-type proline/glycine betaine tr | 2e-09 | |
| TIGR03375 | 694 | TIGR03375, type_I_sec_LssB, type I secretion syste | 3e-09 | |
| cd03258 | 233 | cd03258, ABC_MetN_methionine_transporter, ATP-bind | 3e-09 | |
| PLN03211 | 659 | PLN03211, PLN03211, ABC transporter G-25; Provisio | 3e-09 | |
| TIGR03415 | 382 | TIGR03415, ABC_choXWV_ATP, choline ABC transporter | 4e-09 | |
| TIGR01842 | 544 | TIGR01842, type_I_sec_PrtD, type I secretion syste | 4e-09 | |
| TIGR01277 | 213 | TIGR01277, thiQ, thiamine ABC transporter, ATP-bin | 4e-09 | |
| COG1137 | 243 | COG1137, YhbG, ABC-type (unclassified) transport s | 5e-09 | |
| PRK13639 | 275 | PRK13639, cbiO, cobalt transporter ATP-binding sub | 6e-09 | |
| cd03294 | 269 | cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette | 6e-09 | |
| TIGR02673 | 214 | TIGR02673, FtsE, cell division ATP-binding protein | 7e-09 | |
| PRK10895 | 241 | PRK10895, PRK10895, lipopolysaccharide ABC transpo | 7e-09 | |
| PRK13638 | 271 | PRK13638, cbiO, cobalt transporter ATP-binding sub | 7e-09 | |
| COG4525 | 259 | COG4525, TauB, ABC-type taurine transport system, | 9e-09 | |
| TIGR03864 | 236 | TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi | 9e-09 | |
| PRK15134 | 529 | PRK15134, PRK15134, microcin C ABC transporter ATP | 9e-09 | |
| PRK11614 | 237 | PRK11614, livF, leucine/isoleucine/valine transpor | 1e-08 | |
| TIGR03771 | 223 | TIGR03771, anch_rpt_ABC, anchored repeat-type ABC | 1e-08 | |
| PRK09493 | 240 | PRK09493, glnQ, glutamine ABC transporter ATP-bind | 1e-08 | |
| cd03232 | 192 | cd03232, ABCG_PDR_domain2, Second domain of the pl | 1e-08 | |
| TIGR02324 | 224 | TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys | 1e-08 | |
| TIGR03522 | 301 | TIGR03522, GldA_ABC_ATP, gliding motility-associat | 1e-08 | |
| TIGR03410 | 230 | TIGR03410, urea_trans_UrtE, urea ABC transporter, | 2e-08 | |
| pfam00005 | 119 | pfam00005, ABC_tran, ABC transporter | 2e-08 | |
| COG1132 | 567 | COG1132, MdlB, ABC-type multidrug transport system | 2e-08 | |
| COG3840 | 231 | COG3840, ThiQ, ABC-type thiamine transport system, | 2e-08 | |
| cd03231 | 201 | cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog | 2e-08 | |
| PRK11160 | 574 | PRK11160, PRK11160, cysteine/glutathione ABC trans | 2e-08 | |
| cd03262 | 213 | cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai | 2e-08 | |
| PRK14262 | 250 | PRK14262, PRK14262, phosphate ABC transporter ATP- | 2e-08 | |
| cd03267 | 236 | cd03267, ABC_NatA_like, ATP-binding cassette domai | 2e-08 | |
| PRK10762 | 501 | PRK10762, PRK10762, D-ribose transporter ATP bindi | 3e-08 | |
| cd03300 | 232 | cd03300, ABC_PotA_N, ATP-binding cassette domain o | 3e-08 | |
| TIGR02314 | 343 | TIGR02314, ABC_MetN, D-methionine ABC transporter, | 3e-08 | |
| cd03297 | 214 | cd03297, ABC_ModC_molybdenum_transporter, ATP-bind | 3e-08 | |
| COG1123 | 539 | COG1123, COG1123, ATPase components of various ABC | 4e-08 | |
| cd03245 | 220 | cd03245, ABCC_bacteriocin_exporters, ATP-binding c | 4e-08 | |
| TIGR02857 | 529 | TIGR02857, CydD, thiol reductant ABC exporter, Cyd | 5e-08 | |
| COG4988 | 559 | COG4988, CydD, ABC-type transport system involved | 5e-08 | |
| TIGR02633 | 500 | TIGR02633, xylG, D-xylose ABC transporter, ATP-bin | 5e-08 | |
| PRK13634 | 290 | PRK13634, cbiO, cobalt transporter ATP-binding sub | 5e-08 | |
| PRK13647 | 274 | PRK13647, cbiO, cobalt transporter ATP-binding sub | 5e-08 | |
| PRK14248 | 268 | PRK14248, PRK14248, phosphate ABC transporter ATP- | 5e-08 | |
| PRK11248 | 255 | PRK11248, tauB, taurine transporter ATP-binding su | 6e-08 | |
| cd03292 | 214 | cd03292, ABC_FtsE_transporter, ATP-binding cassett | 6e-08 | |
| PRK13631 | 320 | PRK13631, cbiO, cobalt transporter ATP-binding sub | 7e-08 | |
| PRK11300 | 255 | PRK11300, livG, leucine/isoleucine/valine transpor | 8e-08 | |
| PRK14253 | 249 | PRK14253, PRK14253, phosphate ABC transporter ATP- | 8e-08 | |
| TIGR02868 | 530 | TIGR02868, CydC, thiol reductant ABC exporter, Cyd | 9e-08 | |
| TIGR01189 | 198 | TIGR01189, ccmA, heme ABC exporter, ATP-binding pr | 9e-08 | |
| cd03260 | 227 | cd03260, ABC_PstB_phosphate_transporter, ATP-bindi | 1e-07 | |
| PRK13637 | 287 | PRK13637, cbiO, cobalt transporter ATP-binding sub | 1e-07 | |
| COG4618 | 580 | COG4618, ArpD, ABC-type protease/lipase transport | 1e-07 | |
| COG1124 | 252 | COG1124, DppF, ABC-type dipeptide/oligopeptide/nic | 1e-07 | |
| PRK13549 | 506 | PRK13549, PRK13549, xylose transporter ATP-binding | 1e-07 | |
| COG1126 | 240 | COG1126, GlnQ, ABC-type polar amino acid transport | 1e-07 | |
| TIGR00956 | 1394 | TIGR00956, 3a01205, Pleiotropic Drug Resistance (P | 2e-07 | |
| cd03251 | 234 | cd03251, ABCC_MsbA, ATP-binding cassette domain of | 2e-07 | |
| PRK14247 | 250 | PRK14247, PRK14247, phosphate ABC transporter ATP- | 2e-07 | |
| cd03221 | 144 | cd03221, ABCF_EF-3, ATP-binding cassette domain of | 2e-07 | |
| pfam13304 | 256 | pfam13304, AAA_21, AAA domain | 2e-07 | |
| PRK10938 | 490 | PRK10938, PRK10938, putative molybdenum transport | 2e-07 | |
| PRK14269 | 246 | PRK14269, PRK14269, phosphate ABC transporter ATP- | 2e-07 | |
| COG3638 | 258 | COG3638, COG3638, ABC-type phosphate/phosphonate t | 2e-07 | |
| PRK14251 | 251 | PRK14251, PRK14251, phosphate ABC transporter ATP- | 3e-07 | |
| PRK13632 | 271 | PRK13632, cbiO, cobalt transporter ATP-binding sub | 3e-07 | |
| PRK13642 | 277 | PRK13642, cbiO, cobalt transporter ATP-binding sub | 3e-07 | |
| COG4136 | 213 | COG4136, COG4136, ABC-type uncharacterized transpo | 3e-07 | |
| TIGR01184 | 230 | TIGR01184, ntrCD, nitrate transport ATP-binding su | 3e-07 | |
| cd03254 | 229 | cd03254, ABCC_Glucan_exporter_like, ATP-binding ca | 3e-07 | |
| cd03253 | 236 | cd03253, ABCC_ATM1_transporter, ATP-binding casset | 3e-07 | |
| PRK14250 | 241 | PRK14250, PRK14250, phosphate ABC transporter ATP- | 3e-07 | |
| PRK14270 | 251 | PRK14270, PRK14270, phosphate ABC transporter ATP- | 3e-07 | |
| PRK14257 | 329 | PRK14257, PRK14257, phosphate ABC transporter ATP- | 3e-07 | |
| TIGR02315 | 243 | TIGR02315, ABC_phnC, phosphonate ABC transporter, | 3e-07 | |
| PRK14252 | 265 | PRK14252, PRK14252, phosphate ABC transporter ATP- | 3e-07 | |
| TIGR01193 | 708 | TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t | 4e-07 | |
| TIGR00972 | 247 | TIGR00972, 3a0107s01c2, phosphate ABC transporter, | 4e-07 | |
| COG4170 | 330 | COG4170, SapD, ABC-type antimicrobial peptide tran | 4e-07 | |
| PRK13650 | 279 | PRK13650, cbiO, cobalt transporter ATP-binding sub | 4e-07 | |
| PRK14245 | 250 | PRK14245, PRK14245, phosphate ABC transporter ATP- | 4e-07 | |
| COG1129 | 500 | COG1129, MglA, ABC-type sugar transport system, AT | 4e-07 | |
| PRK10619 | 257 | PRK10619, PRK10619, histidine/lysine/arginine/orni | 4e-07 | |
| cd03256 | 241 | cd03256, ABC_PhnC_transporter, ATP-binding cassett | 4e-07 | |
| PRK14267 | 253 | PRK14267, PRK14267, phosphate ABC transporter ATP- | 4e-07 | |
| PRK14272 | 252 | PRK14272, PRK14272, phosphate ABC transporter ATP- | 5e-07 | |
| PRK11176 | 582 | PRK11176, PRK11176, lipid transporter ATP-binding/ | 5e-07 | |
| COG2884 | 223 | COG2884, FtsE, Predicted ATPase involved in cell d | 6e-07 | |
| PRK14238 | 271 | PRK14238, PRK14238, phosphate transporter ATP-bind | 7e-07 | |
| PRK13640 | 282 | PRK13640, cbiO, cobalt transporter ATP-binding sub | 7e-07 | |
| PRK15439 | 510 | PRK15439, PRK15439, autoinducer 2 ABC transporter | 7e-07 | |
| cd03215 | 182 | cd03215, ABC_Carb_Monos_II, Second domain of the A | 7e-07 | |
| cd03227 | 162 | cd03227, ABC_Class2, ATP-binding cassette domain o | 7e-07 | |
| PRK13635 | 279 | PRK13635, cbiO, cobalt transporter ATP-binding sub | 8e-07 | |
| TIGR03411 | 242 | TIGR03411, urea_trans_UrtD, urea ABC transporter, | 8e-07 | |
| PRK14274 | 259 | PRK14274, PRK14274, phosphate ABC transporter ATP- | 8e-07 | |
| PRK14240 | 250 | PRK14240, PRK14240, phosphate transporter ATP-bind | 8e-07 | |
| PRK14268 | 258 | PRK14268, PRK14268, phosphate ABC transporter ATP- | 8e-07 | |
| COG4133 | 209 | COG4133, CcmA, ABC-type transport system involved | 9e-07 | |
| PRK13633 | 280 | PRK13633, PRK13633, cobalt transporter ATP-binding | 9e-07 | |
| cd03216 | 163 | cd03216, ABC_Carb_Monos_I, First domain of the ATP | 9e-07 | |
| PRK10771 | 232 | PRK10771, thiQ, thiamine transporter ATP-binding s | 1e-06 | |
| cd03248 | 226 | cd03248, ABCC_TAP, ATP-binding cassette domain of | 1e-06 | |
| PRK13636 | 283 | PRK13636, cbiO, cobalt transporter ATP-binding sub | 1e-06 | |
| PRK14263 | 261 | PRK14263, PRK14263, phosphate ABC transporter ATP- | 1e-06 | |
| PRK10535 | 648 | PRK10535, PRK10535, macrolide transporter ATP-bind | 1e-06 | |
| PRK14273 | 254 | PRK14273, PRK14273, phosphate ABC transporter ATP- | 2e-06 | |
| PRK13644 | 274 | PRK13644, cbiO, cobalt transporter ATP-binding sub | 2e-06 | |
| COG1118 | 345 | COG1118, CysA, ABC-type sulfate/molybdate transpor | 2e-06 | |
| TIGR02203 | 571 | TIGR02203, MsbA_lipidA, lipid A export permease/AT | 2e-06 | |
| PRK14255 | 252 | PRK14255, PRK14255, phosphate ABC transporter ATP- | 2e-06 | |
| COG4598 | 256 | COG4598, HisP, ABC-type histidine transport system | 2e-06 | |
| PRK13657 | 588 | PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra | 2e-06 | |
| PRK14243 | 264 | PRK14243, PRK14243, phosphate transporter ATP-bind | 2e-06 | |
| COG4674 | 249 | COG4674, COG4674, Uncharacterized ABC-type transpo | 2e-06 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 2e-06 | |
| cd03301 | 213 | cd03301, ABC_MalK_N, The N-terminal ATPase domain | 2e-06 | |
| TIGR03269 | 520 | TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc | 2e-06 | |
| PRK14258 | 261 | PRK14258, PRK14258, phosphate ABC transporter ATP- | 2e-06 | |
| PRK14246 | 257 | PRK14246, PRK14246, phosphate ABC transporter ATP- | 3e-06 | |
| PRK14249 | 251 | PRK14249, PRK14249, phosphate ABC transporter ATP- | 3e-06 | |
| TIGR02982 | 220 | TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi | 3e-06 | |
| COG4161 | 242 | COG4161, ArtP, ABC-type arginine transport system, | 3e-06 | |
| PRK10070 | 400 | PRK10070, PRK10070, glycine betaine transporter AT | 4e-06 | |
| PRK10982 | 491 | PRK10982, PRK10982, galactose/methyl galaxtoside t | 4e-06 | |
| PRK14237 | 267 | PRK14237, PRK14237, phosphate transporter ATP-bind | 5e-06 | |
| COG3839 | 338 | COG3839, MalK, ABC-type sugar transport systems, A | 5e-06 | |
| PTZ00265 | 1466 | PTZ00265, PTZ00265, multidrug resistance protein ( | 5e-06 | |
| TIGR03796 | 710 | TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste | 5e-06 | |
| COG4172 | 534 | COG4172, COG4172, ABC-type uncharacterized transpo | 6e-06 | |
| COG1129 | 500 | COG1129, MglA, ABC-type sugar transport system, AT | 7e-06 | |
| cd03223 | 166 | cd03223, ABCD_peroxisomal_ALDP, ATP-binding casset | 7e-06 | |
| cd03249 | 238 | cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett | 7e-06 | |
| PRK14266 | 250 | PRK14266, PRK14266, phosphate ABC transporter ATP- | 7e-06 | |
| TIGR01846 | 694 | TIGR01846, type_I_sec_HlyB, type I secretion syste | 7e-06 | |
| PRK13645 | 289 | PRK13645, cbiO, cobalt transporter ATP-binding sub | 7e-06 | |
| TIGR02204 | 576 | TIGR02204, MsbA_rel, ABC transporter, permease/ATP | 8e-06 | |
| PRK14254 | 285 | PRK14254, PRK14254, phosphate ABC transporter ATP- | 9e-06 | |
| PRK09700 | 510 | PRK09700, PRK09700, D-allose transporter ATP-bindi | 1e-05 | |
| PLN03140 | 1470 | PLN03140, PLN03140, ABC transporter G family membe | 1e-05 | |
| COG1117 | 253 | COG1117, PstB, ABC-type phosphate transport system | 1e-05 | |
| PTZ00265 | 1466 | PTZ00265, PTZ00265, multidrug resistance protein ( | 2e-05 | |
| PRK09700 | 510 | PRK09700, PRK09700, D-allose transporter ATP-bindi | 2e-05 | |
| PRK14236 | 272 | PRK14236, PRK14236, phosphate transporter ATP-bind | 2e-05 | |
| PRK14239 | 252 | PRK14239, PRK14239, phosphate transporter ATP-bind | 2e-05 | |
| PRK10744 | 260 | PRK10744, pstB, phosphate transporter ATP-binding | 2e-05 | |
| PRK14242 | 253 | PRK14242, PRK14242, phosphate transporter ATP-bind | 2e-05 | |
| cd03252 | 237 | cd03252, ABCC_Hemolysin, ATP-binding cassette doma | 2e-05 | |
| TIGR02770 | 230 | TIGR02770, nickel_nikD, nickel import ATP-binding | 2e-05 | |
| TIGR03269 | 520 | TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc | 3e-05 | |
| COG4172 | 534 | COG4172, COG4172, ABC-type uncharacterized transpo | 3e-05 | |
| PRK14264 | 305 | PRK14264, PRK14264, phosphate ABC transporter ATP- | 3e-05 | |
| PRK11153 | 343 | PRK11153, metN, DL-methionine transporter ATP-bind | 3e-05 | |
| TIGR03258 | 362 | TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans | 3e-05 | |
| PRK09984 | 262 | PRK09984, PRK09984, phosphonate/organophosphate es | 3e-05 | |
| PRK11701 | 258 | PRK11701, phnK, phosphonate C-P lyase system prote | 3e-05 | |
| PRK14259 | 269 | PRK14259, PRK14259, phosphate ABC transporter ATP- | 3e-05 | |
| TIGR02323 | 253 | TIGR02323, CP_lyasePhnK, phosphonate C-P lyase sys | 3e-05 | |
| COG4178 | 604 | COG4178, COG4178, ABC-type uncharacterized transpo | 4e-05 | |
| PRK11231 | 255 | PRK11231, fecE, iron-dicitrate transporter ATP-bin | 4e-05 | |
| PRK14265 | 274 | PRK14265, PRK14265, phosphate ABC transporter ATP- | 4e-05 | |
| PRK11147 | 635 | PRK11147, PRK11147, ABC transporter ATPase compone | 5e-05 | |
| PRK14261 | 253 | PRK14261, PRK14261, phosphate ABC transporter ATP- | 5e-05 | |
| PRK10418 | 254 | PRK10418, nikD, nickel transporter ATP-binding pro | 5e-05 | |
| TIGR03265 | 353 | TIGR03265, PhnT2, putative 2-aminoethylphosphonate | 5e-05 | |
| PRK14260 | 259 | PRK14260, PRK14260, phosphate ABC transporter ATP- | 6e-05 | |
| pfam13558 | 79 | pfam13558, SbcCD_C, Putative exonuclease SbcCD, C | 7e-05 | |
| PRK13648 | 269 | PRK13648, cbiO, cobalt transporter ATP-binding sub | 7e-05 | |
| COG5265 | 497 | COG5265, ATM1, ABC-type transport system involved | 7e-05 | |
| PRK09544 | 251 | PRK09544, znuC, high-affinity zinc transporter ATP | 8e-05 | |
| TIGR01187 | 325 | TIGR01187, potA, spermidine/putrescine ABC transpo | 8e-05 | |
| TIGR03873 | 256 | TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra | 8e-05 | |
| PLN03073 | 718 | PLN03073, PLN03073, ABC transporter F family; Prov | 8e-05 | |
| PRK14256 | 252 | PRK14256, PRK14256, phosphate ABC transporter ATP- | 8e-05 | |
| PRK11124 | 242 | PRK11124, artP, arginine transporter ATP-binding s | 8e-05 | |
| PRK14275 | 286 | PRK14275, PRK14275, phosphate ABC transporter ATP- | 9e-05 | |
| TIGR00958 | 711 | TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) | 9e-05 | |
| COG4107 | 258 | COG4107, PhnK, ABC-type phosphonate transport syst | 9e-05 | |
| cd03290 | 218 | cd03290, ABCC_SUR1_N, ATP-binding cassette domain | 1e-04 | |
| TIGR02142 | 354 | TIGR02142, modC_ABC, molybdenum ABC transporter, A | 1e-04 | |
| COG3842 | 352 | COG3842, PotA, ABC-type spermidine/putrescine tran | 1e-04 | |
| PRK11247 | 257 | PRK11247, ssuB, aliphatic sulfonates transport ATP | 1e-04 | |
| PRK11607 | 377 | PRK11607, potG, putrescine transporter ATP-binding | 1e-04 | |
| PRK11629 | 233 | PRK11629, lolD, lipoprotein transporter ATP-bindin | 1e-04 | |
| PRK11264 | 250 | PRK11264, PRK11264, putative amino-acid ABC transp | 1e-04 | |
| COG0488 | 530 | COG0488, Uup, ATPase components of ABC transporter | 1e-04 | |
| cd03217 | 200 | cd03217, ABC_FeS_Assembly, ABC-type transport syst | 2e-04 | |
| PRK14241 | 258 | PRK14241, PRK14241, phosphate transporter ATP-bind | 2e-04 | |
| PRK11174 | 588 | PRK11174, PRK11174, cysteine/glutathione ABC trans | 2e-04 | |
| PRK11831 | 269 | PRK11831, PRK11831, putative ABC transporter ATP-b | 2e-04 | |
| cd03240 | 204 | cd03240, ABC_Rad50, ATP-binding cassette domain of | 2e-04 | |
| PRK10789 | 569 | PRK10789, PRK10789, putative multidrug transporter | 2e-04 | |
| PRK13539 | 207 | PRK13539, PRK13539, cytochrome c biogenesis protei | 2e-04 | |
| COG1101 | 263 | COG1101, PhnK, ABC-type uncharacterized transport | 2e-04 | |
| PRK14235 | 267 | PRK14235, PRK14235, phosphate transporter ATP-bind | 3e-04 | |
| TIGR01192 | 585 | TIGR01192, chvA, glucan exporter ATP-binding prote | 3e-04 | |
| PRK14271 | 276 | PRK14271, PRK14271, phosphate ABC transporter ATP- | 3e-04 | |
| PRK10938 | 490 | PRK10938, PRK10938, putative molybdenum transport | 4e-04 | |
| PRK15439 | 510 | PRK15439, PRK15439, autoinducer 2 ABC transporter | 4e-04 | |
| COG0488 | 530 | COG0488, Uup, ATPase components of ABC transporter | 4e-04 | |
| cd03233 | 202 | cd03233, ABCG_PDR_domain1, First domain of the ple | 4e-04 | |
| PRK15093 | 330 | PRK15093, PRK15093, antimicrobial peptide ABC tran | 4e-04 | |
| PRK13548 | 258 | PRK13548, hmuV, hemin importer ATP-binding subunit | 4e-04 | |
| TIGR00968 | 237 | TIGR00968, 3a0106s01, sulfate ABC transporter, ATP | 4e-04 | |
| PRK10636 | 638 | PRK10636, PRK10636, putative ABC transporter ATP-b | 5e-04 | |
| PRK14244 | 251 | PRK14244, PRK14244, phosphate ABC transporter ATP- | 5e-04 | |
| COG3845 | 501 | COG3845, COG3845, ABC-type uncharacterized transpo | 5e-04 | |
| COG4778 | 235 | COG4778, PhnL, ABC-type phosphonate transport syst | 6e-04 | |
| PRK15079 | 331 | PRK15079, PRK15079, oligopeptide ABC transporter A | 6e-04 | |
| TIGR02211 | 221 | TIGR02211, LolD_lipo_ex, lipoprotein releasing sys | 6e-04 | |
| cd03236 | 255 | cd03236, ABC_RNaseL_inhibitor_domain1, The ATP-bin | 0.001 | |
| PRK11288 | 501 | PRK11288, araG, L-arabinose transporter ATP-bindin | 0.001 | |
| COG4138 | 248 | COG4138, BtuD, ABC-type cobalamin transport system | 0.001 | |
| COG1245 | 591 | COG1245, COG1245, Predicted ATPase, RNase L inhibi | 0.001 | |
| COG4181 | 228 | COG4181, COG4181, Predicted ABC-type transport sys | 0.001 | |
| cd03244 | 221 | cd03244, ABCC_MRP_domain2, ATP-binding cassette do | 0.001 | |
| cd03250 | 204 | cd03250, ABCC_MRP_domain1, ATP-binding cassette do | 0.001 | |
| PRK11308 | 327 | PRK11308, dppF, dipeptide transporter ATP-binding | 0.001 | |
| PRK09473 | 330 | PRK09473, oppD, oligopeptide transporter ATP-bindi | 0.001 | |
| PLN03140 | 1470 | PLN03140, PLN03140, ABC transporter G family membe | 0.002 | |
| COG0396 | 251 | COG0396, sufC, Cysteine desulfurase activator ATPa | 0.002 | |
| PRK13543 | 214 | PRK13543, PRK13543, cytochrome c biogenesis protei | 0.002 | |
| TIGR03797 | 686 | TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste | 0.002 | |
| cd03238 | 176 | cd03238, ABC_UvrA, ATP-binding cassette domain of | 0.002 | |
| PRK15134 | 529 | PRK15134, PRK15134, microcin C ABC transporter ATP | 0.003 | |
| COG4619 | 223 | COG4619, COG4619, ABC-type uncharacterized transpo | 0.003 | |
| TIGR03005 | 252 | TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine AB | 0.003 | |
| smart00382 | 148 | smart00382, AAA, ATPases associated with a variety | 0.004 | |
| PRK10575 | 265 | PRK10575, PRK10575, iron-hydroxamate transporter A | 0.004 | |
| PRK10584 | 228 | PRK10584, PRK10584, putative ABC transporter ATP-b | 0.004 | |
| COG4148 | 352 | COG4148, ModC, ABC-type molybdate transport system | 0.004 |
| >gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A | Back alignment and domain information |
|---|
Score = 111 bits (281), Expect = 7e-33
Identities = 36/71 (50%), Positives = 54/71 (76%), Gaps = 1/71 (1%)
Query: 1 MGLTEYRHRESGRYSGGNKRKLSTAMALIGDPPLVFLDEPTSGVDPISRHRLWAVLSQIQ 60
+GLT+ ++ + SGG KRKLS A+ALIG P ++ LDEPTSG+DP SR +W ++ +++
Sbjct: 121 LGLTDKANKRARTLSGGMKRKLSLAIALIGGPSVLLLDEPTSGLDPASRRAIWDLILEVR 180
Query: 61 KTGQSIVLTSH 71
K G+SI+LT+H
Sbjct: 181 K-GRSIILTTH 190
|
The ABCA subfamily mediates the transport of a variety of lipid compounds. Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders. The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis. The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle. The ABCA genes are not present in yeast. However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages. Length = 220 |
| >gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A | Back alignment and domain information |
|---|
| >gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system | Back alignment and domain information |
|---|
| >gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters | Back alignment and domain information |
|---|
| >gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system | Back alignment and domain information |
|---|
| >gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter | Back alignment and domain information |
|---|
| >gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter | Back alignment and domain information |
|---|
| >gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter | Back alignment and domain information |
|---|
| >gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters | Back alignment and domain information |
|---|
| >gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein | Back alignment and domain information |
|---|
| >gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system | Back alignment and domain information |
|---|
| >gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter | Back alignment and domain information |
|---|
| >gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems | Back alignment and domain information |
|---|
| >gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system | Back alignment and domain information |
|---|
| >gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter | Back alignment and domain information |
|---|
| >gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents | Back alignment and domain information |
|---|
| >gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters | Back alignment and domain information |
|---|
| >gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185016 PRK15056, PRK15056, manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein | Back alignment and domain information |
|---|
| >gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like | Back alignment and domain information |
|---|
| >gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter | Back alignment and domain information |
|---|
| >gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters | Back alignment and domain information |
|---|
| >gnl|CDD|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system | Back alignment and domain information |
|---|
| >gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|237456 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter | Back alignment and domain information |
|---|
| >gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188317 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family | Back alignment and domain information |
|---|
| >gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system | Back alignment and domain information |
|---|
| >gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184198 PRK13638, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183231 PRK11614, livF, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters | Back alignment and domain information |
|---|
| >gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter | Back alignment and domain information |
|---|
| >gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein | Back alignment and domain information |
|---|
| >gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters | Back alignment and domain information |
|---|
| >gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA | Back alignment and domain information |
|---|
| >gnl|CDD|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter | Back alignment and domain information |
|---|
| >gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system | Back alignment and domain information |
|---|
| >gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|237454 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237647 PRK14248, PRK14248, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter | Back alignment and domain information |
|---|
| >gnl|CDD|237451 PRK13631, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183080 PRK11300, livG, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172741 PRK14253, PRK14253, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system | Back alignment and domain information |
|---|
| >gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F | Back alignment and domain information |
|---|
| >gnl|CDD|222036 pfam13304, AAA_21, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|182852 PRK10938, PRK10938, putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172757 PRK14269, PRK14269, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184202 PRK13642, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226620 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172745 PRK14257, PRK14257, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|172740 PRK14252, PRK14252, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|226639 COG4170, SapD, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172733 PRK14245, PRK14245, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system | Back alignment and domain information |
|---|
| >gnl|CDD|184596 PRK14267, PRK14267, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172760 PRK14272, PRK14272, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213182 cd03215, ABC_Carb_Monos_II, Second domain of the ATP-binding cassette component of monosaccharide transport system | Back alignment and domain information |
|---|
| >gnl|CDD|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins | Back alignment and domain information |
|---|
| >gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234200 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172756 PRK14268, PRK14268, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|237453 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system | Back alignment and domain information |
|---|
| >gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172751 PRK14263, PRK14263, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172761 PRK14273, PRK14273, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|106587 PRK13644, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA | Back alignment and domain information |
|---|
| >gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226961 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184588 PRK14243, PRK14243, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >gnl|CDD|184593 PRK14258, PRK14258, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184590 PRK14249, PRK14249, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >gnl|CDD|226635 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237646 PRK14237, PRK14237, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213190 cd03223, ABCD_peroxisomal_ALDP, ATP-binding cassette domain of peroxisomal transporter, subfamily D | Back alignment and domain information |
|---|
| >gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|237651 PRK14266, PRK14266, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family | Back alignment and domain information |
|---|
| >gnl|CDD|184204 PRK13645, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|237649 PRK14254, PRK14254, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184582 PRK14236, PRK14236, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182692 PRK10744, pstB, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172730 PRK14242, PRK14242, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD | Back alignment and domain information |
|---|
| >gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|184594 PRK14264, PRK14264, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236863 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >gnl|CDD|182182 PRK09984, PRK09984, phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183280 PRK11701, phnK, phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172747 PRK14259, PRK14259, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188208 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >gnl|CDD|226646 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237650 PRK14265, PRK14265, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236861 PRK11147, PRK11147, ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|172749 PRK14261, PRK14261, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236688 PRK10418, nikD, nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234152 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|172748 PRK14260, PRK14260, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222219 pfam13558, SbcCD_C, Putative exonuclease SbcCD, C subunit | Back alignment and domain information |
|---|
| >gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|181939 PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|215558 PLN03073, PLN03073, ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172744 PRK14256, PRK14256, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182980 PRK11124, artP, arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237652 PRK14275, PRK14275, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
|---|
| >gnl|CDD|226592 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213257 cd03290, ABCC_SUR1_N, ATP-binding cassette domain of the sulfonylurea receptor, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|183055 PRK11247, ssuB, aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >gnl|CDD|184587 PRK14241, PRK14241, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236997 PRK11831, PRK11831, putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213207 cd03240, ABC_Rad50, ATP-binding cassette domain of Rad50 | Back alignment and domain information |
|---|
| >gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|237645 PRK14235, PRK14235, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|172759 PRK14271, PRK14271, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182852 PRK10938, PRK10938, putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters | Back alignment and domain information |
|---|
| >gnl|CDD|185049 PRK15093, PRK15093, antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|236729 PRK10636, PRK10636, putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172732 PRK14244, PRK14244, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|227118 COG4778, PhnL, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|185037 PRK15079, PRK15079, oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|213203 cd03236, ABC_RNaseL_inhibitor_domain1, The ATP-binding cassette domain 1 of RNase L inhibitor | Back alignment and domain information |
|---|
| >gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226622 COG4138, BtuD, ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein | Back alignment and domain information |
|---|
| >gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|236898 PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181888 PRK09473, oppD, oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|184129 PRK13543, PRK13543, cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|213205 cd03238, ABC_UvrA, ATP-binding cassette domain of the excision repair protein UvrA | Back alignment and domain information |
|---|
| >gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182569 PRK10584, PRK10584, putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 72 | |||
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 99.97 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 99.96 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 99.96 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 99.96 | |
| COG1127 | 263 | Ttg2A ABC-type transport system involved in resist | 99.95 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 99.95 | |
| COG1135 | 339 | AbcC ABC-type metal ion transport system, ATPase c | 99.95 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 99.95 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 99.95 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 99.95 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 99.95 | |
| COG1122 | 235 | CbiO ABC-type cobalt transport system, ATPase comp | 99.94 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 99.94 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 99.94 | |
| COG1131 | 293 | CcmA ABC-type multidrug transport system, ATPase c | 99.94 | |
| TIGR01188 | 302 | drrA daunorubicin resistance ABC transporter ATP-b | 99.94 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 99.94 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 99.94 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 99.94 | |
| PRK13537 | 306 | nodulation ABC transporter NodI; Provisional | 99.94 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 99.94 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 99.94 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 99.94 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 99.94 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 99.94 | |
| TIGR02314 | 343 | ABC_MetN D-methionine ABC transporter, ATP-binding | 99.94 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 99.94 | |
| TIGR01288 | 303 | nodI ATP-binding ABC transporter family nodulation | 99.94 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 99.94 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 99.94 | |
| PRK13536 | 340 | nodulation factor exporter subunit NodI; Provision | 99.94 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 99.94 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 99.94 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 99.94 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 99.94 | |
| TIGR01184 | 230 | ntrCD nitrate transport ATP-binding subunits C and | 99.94 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 99.94 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 99.94 | |
| cd03297 | 214 | ABC_ModC_molybdenum_transporter ModC is an ABC-typ | 99.94 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 99.94 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 99.94 | |
| PRK11650 | 356 | ugpC glycerol-3-phosphate transporter ATP-binding | 99.94 | |
| COG4555 | 245 | NatA ABC-type Na+ transport system, ATPase compone | 99.94 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 99.94 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 99.94 | |
| TIGR01189 | 198 | ccmA heme ABC exporter, ATP-binding protein CcmA. | 99.94 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 99.94 | |
| cd03231 | 201 | ABC_CcmA_heme_exporter CcmA, the ATP-binding compo | 99.94 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 99.94 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 99.94 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 99.94 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 99.94 | |
| cd03298 | 211 | ABC_ThiQ_thiamine_transporter ABC-type thiamine tr | 99.94 | |
| TIGR03258 | 362 | PhnT 2-aminoethylphosphonate ABC transport system, | 99.93 | |
| PRK13638 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.93 | |
| PRK13651 | 305 | cobalt transporter ATP-binding subunit; Provisiona | 99.93 | |
| PRK13647 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.93 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 99.93 | |
| cd03294 | 269 | ABC_Pro_Gly_Bertaine This family comprises the gly | 99.93 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 99.93 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 99.93 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 99.93 | |
| PRK13637 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.93 | |
| PRK11153 | 343 | metN DL-methionine transporter ATP-binding subunit | 99.93 | |
| PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 99.93 | |
| PRK13641 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.93 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 99.93 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 99.93 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 99.93 | |
| PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 99.93 | |
| PRK13650 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.93 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 99.93 | |
| PRK13644 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.93 | |
| TIGR03771 | 223 | anch_rpt_ABC anchored repeat-type ABC transporter, | 99.93 | |
| PRK11231 | 255 | fecE iron-dicitrate transporter ATP-binding subuni | 99.93 | |
| PRK11432 | 351 | fbpC ferric transporter ATP-binding subunit; Provi | 99.93 | |
| PRK11000 | 369 | maltose/maltodextrin transporter ATP-binding prote | 99.93 | |
| PRK15079 | 331 | oligopeptide ABC transporter ATP-binding protein O | 99.93 | |
| PRK10851 | 353 | sulfate/thiosulfate transporter subunit; Provision | 99.93 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 99.93 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 99.93 | |
| TIGR01187 | 325 | potA spermidine/putrescine ABC transporter ATP-bin | 99.93 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 99.93 | |
| PRK09536 | 402 | btuD corrinoid ABC transporter ATPase; Reviewed | 99.93 | |
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 99.93 | |
| PRK13643 | 288 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.93 | |
| TIGR02142 | 354 | modC_ABC molybdenum ABC transporter, ATP-binding p | 99.93 | |
| COG0444 | 316 | DppD ABC-type dipeptide/oligopeptide/nickel transp | 99.93 | |
| PRK15056 | 272 | manganese/iron transporter ATP-binding protein; Pr | 99.93 | |
| TIGR03265 | 353 | PhnT2 putative 2-aminoethylphosphonate ABC transpo | 99.93 | |
| PRK11144 | 352 | modC molybdate transporter ATP-binding protein; Pr | 99.93 | |
| PRK13634 | 290 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.93 | |
| COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 99.93 | |
| TIGR03740 | 223 | galliderm_ABC gallidermin-class lantibiotic protec | 99.93 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 99.93 | |
| PRK11308 | 327 | dppF dipeptide transporter ATP-binding subunit; Pr | 99.93 | |
| TIGR01277 | 213 | thiQ thiamine ABC transporter, ATP-binding protein | 99.93 | |
| PRK15093 | 330 | antimicrobial peptide ABC transporter ATP-binding | 99.93 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 99.93 | |
| PRK10771 | 232 | thiQ thiamine transporter ATP-binding subunit; Pro | 99.93 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 99.93 | |
| cd03237 | 246 | ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o | 99.93 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 99.93 | |
| PRK09452 | 375 | potA putrescine/spermidine ABC transporter ATPase | 99.93 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 99.93 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 99.93 | |
| PRK10619 | 257 | histidine/lysine/arginine/ornithine transporter su | 99.93 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 99.93 | |
| PRK13649 | 280 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.93 | |
| TIGR02324 | 224 | CP_lyasePhnL phosphonate C-P lyase system protein | 99.93 | |
| PRK13631 | 320 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.93 | |
| COG4598 | 256 | HisP ABC-type histidine transport system, ATPase c | 99.93 | |
| PRK11022 | 326 | dppD dipeptide transporter ATP-binding subunit; Pr | 99.93 | |
| PRK13635 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.93 | |
| PRK13639 | 275 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.93 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 99.93 | |
| PRK13636 | 283 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.93 | |
| PRK13633 | 280 | cobalt transporter ATP-binding subunit; Provisiona | 99.93 | |
| TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 99.93 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 99.93 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 99.93 | |
| PRK13646 | 286 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.93 | |
| cd03295 | 242 | ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin | 99.93 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 99.93 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 99.93 | |
| TIGR02770 | 230 | nickel_nikD nickel import ATP-binding protein NikD | 99.93 | |
| TIGR03411 | 242 | urea_trans_UrtD urea ABC transporter, ATP-binding | 99.93 | |
| cd03267 | 236 | ABC_NatA_like Similar in sequence to NatA, this is | 99.93 | |
| PRK09984 | 262 | phosphonate/organophosphate ester transporter subu | 99.93 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 99.93 | |
| TIGR03522 | 301 | GldA_ABC_ATP gliding motility-associated ABC trans | 99.93 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 99.93 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 99.93 | |
| PRK09544 | 251 | znuC high-affinity zinc transporter ATPase; Review | 99.92 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 99.92 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 99.92 | |
| PRK13652 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.92 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 99.92 | |
| PRK13645 | 289 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.92 | |
| PRK10253 | 265 | iron-enterobactin transporter ATP-binding protein; | 99.92 | |
| TIGR02769 | 265 | nickel_nikE nickel import ATP-binding protein NikE | 99.92 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 99.92 | |
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 99.92 | |
| TIGR03873 | 256 | F420-0_ABC_ATP proposed F420-0 ABC transporter, AT | 99.92 | |
| PRK11607 | 377 | potG putrescine transporter ATP-binding subunit; P | 99.92 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 99.92 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 99.92 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 99.92 | |
| TIGR03005 | 252 | ectoine_ehuA ectoine/hydroxyectoine ABC transporte | 99.92 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 99.92 | |
| TIGR00972 | 247 | 3a0107s01c2 phosphate ABC transporter, ATP-binding | 99.92 | |
| PRK11614 | 237 | livF leucine/isoleucine/valine transporter ATP-bin | 99.92 | |
| PRK13642 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.92 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 99.92 | |
| PRK09580 | 248 | sufC cysteine desulfurase ATPase component; Review | 99.92 | |
| cd03234 | 226 | ABCG_White The White subfamily represents ABC tran | 99.92 | |
| cd03252 | 237 | ABCC_Hemolysin The ABC-transporter hemolysin B is | 99.92 | |
| PRK13632 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.92 | |
| PRK13548 | 258 | hmuV hemin importer ATP-binding subunit; Provision | 99.92 | |
| PRK13640 | 282 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.92 | |
| PRK09473 | 330 | oppD oligopeptide transporter ATP-binding componen | 99.92 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 99.92 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 99.92 | |
| PRK13648 | 269 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.92 | |
| PRK15112 | 267 | antimicrobial peptide ABC system ATP-binding prote | 99.92 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 99.92 | |
| CHL00131 | 252 | ycf16 sulfate ABC transporter protein; Validated | 99.92 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 99.92 | |
| COG3840 | 231 | ThiQ ABC-type thiamine transport system, ATPase co | 99.92 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 99.92 | |
| PRK10418 | 254 | nikD nickel transporter ATP-binding protein NikD; | 99.92 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 99.92 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 99.92 | |
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 99.92 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 99.92 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 99.92 | |
| cd03300 | 232 | ABC_PotA_N PotA is an ABC-type transporter and the | 99.92 | |
| TIGR02982 | 220 | heterocyst_DevA ABC exporter ATP-binding subunit, | 99.92 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 99.92 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 99.92 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 99.92 | |
| cd03299 | 235 | ABC_ModC_like Archeal protein closely related to M | 99.92 | |
| cd03270 | 226 | ABC_UvrA_I The excision repair protein UvrA domain | 99.92 | |
| PRK03695 | 248 | vitamin B12-transporter ATPase; Provisional | 99.92 | |
| cd03248 | 226 | ABCC_TAP TAP, the Transporter Associated with Anti | 99.92 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 99.92 | |
| cd03245 | 220 | ABCC_bacteriocin_exporters ABC-type bacteriocin ex | 99.92 | |
| PRK14268 | 258 | phosphate ABC transporter ATP-binding protein; Pro | 99.92 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 99.92 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 99.92 | |
| COG1137 | 243 | YhbG ABC-type (unclassified) transport system, ATP | 99.92 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 99.92 | |
| cd03254 | 229 | ABCC_Glucan_exporter_like Glucan exporter ATP-bind | 99.91 | |
| COG1118 | 345 | CysA ABC-type sulfate/molybdate transport systems, | 99.91 | |
| cd03249 | 238 | ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) | 99.91 | |
| cd03251 | 234 | ABCC_MsbA MsbA is an essential ABC transporter, cl | 99.91 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 99.91 | |
| cd03253 | 236 | ABCC_ATM1_transporter ATM1 is an ABC transporter t | 99.91 | |
| PRK14273 | 254 | phosphate ABC transporter ATP-binding protein; Pro | 99.91 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 99.91 | |
| PRK13546 | 264 | teichoic acids export protein ATP-binding subunit; | 99.91 | |
| PRK14245 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.91 | |
| PRK14259 | 269 | phosphate ABC transporter ATP-binding protein; Pro | 99.91 | |
| PRK13547 | 272 | hmuV hemin importer ATP-binding subunit; Provision | 99.91 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.91 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 99.91 | |
| TIGR00968 | 237 | 3a0106s01 sulfate ABC transporter, ATP-binding pro | 99.91 | |
| cd03236 | 255 | ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o | 99.91 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 99.91 | |
| PRK10419 | 268 | nikE nickel transporter ATP-binding protein NikE; | 99.91 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 99.91 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 99.91 | |
| PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 99.91 | |
| PRK14249 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.91 | |
| cd03290 | 218 | ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec | 99.91 | |
| PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 99.91 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 99.91 | |
| PRK13545 | 549 | tagH teichoic acids export protein ATP-binding sub | 99.91 | |
| PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 99.91 | |
| PRK14244 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.91 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 99.91 | |
| PRK14269 | 246 | phosphate ABC transporter ATP-binding protein; Pro | 99.91 | |
| PRK14267 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 99.91 | |
| PRK14239 | 252 | phosphate transporter ATP-binding protein; Provisi | 99.91 | |
| PRK14265 | 274 | phosphate ABC transporter ATP-binding protein; Pro | 99.91 | |
| cd03244 | 221 | ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. | 99.9 | |
| PRK14270 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.9 | |
| PRK14272 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 99.9 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 99.9 | |
| PRK14258 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 99.9 | |
| cd03217 | 200 | ABC_FeS_Assembly ABC-type transport system involve | 99.9 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 99.9 | |
| PRK14255 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 99.9 | |
| PRK14254 | 285 | phosphate ABC transporter ATP-binding protein; Pro | 99.9 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 99.9 | |
| PRK14238 | 271 | phosphate transporter ATP-binding protein; Provisi | 99.9 | |
| cd03250 | 204 | ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. | 99.9 | |
| PRK14251 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.9 | |
| COG4181 | 228 | Predicted ABC-type transport system involved in ly | 99.9 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 99.9 | |
| PRK14262 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.9 | |
| PRK14253 | 249 | phosphate ABC transporter ATP-binding protein; Pro | 99.9 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 99.9 | |
| PRK14274 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 99.9 | |
| PRK14243 | 264 | phosphate transporter ATP-binding protein; Provisi | 99.9 | |
| PRK14260 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 99.9 | |
| PRK14275 | 286 | phosphate ABC transporter ATP-binding protein; Pro | 99.9 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 99.9 | |
| PRK14256 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 99.9 | |
| PRK14236 | 272 | phosphate transporter ATP-binding protein; Provisi | 99.9 | |
| COG4161 | 242 | ArtP ABC-type arginine transport system, ATPase co | 99.9 | |
| cd03271 | 261 | ABC_UvrA_II The excision repair protein UvrA domai | 99.9 | |
| cd03369 | 207 | ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty | 99.9 | |
| PRK14266 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.9 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 99.9 | |
| PRK14261 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 99.9 | |
| PRK14264 | 305 | phosphate ABC transporter ATP-binding protein; Pro | 99.9 | |
| TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 99.89 | |
| PRK14237 | 267 | phosphate transporter ATP-binding protein; Provisi | 99.89 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 99.89 | |
| COG0411 | 250 | LivG ABC-type branched-chain amino acid transport | 99.89 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 99.89 | |
| COG4525 | 259 | TauB ABC-type taurine transport system, ATPase com | 99.89 | |
| PRK14271 | 276 | phosphate ABC transporter ATP-binding protein; Pro | 99.89 | |
| PRK14263 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 99.89 | |
| PLN03211 | 659 | ABC transporter G-25; Provisional | 99.89 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 99.89 | |
| PRK14246 | 257 | phosphate ABC transporter ATP-binding protein; Pro | 99.89 | |
| PRK14257 | 329 | phosphate ABC transporter ATP-binding protein; Pro | 99.89 | |
| PRK14252 | 265 | phosphate ABC transporter ATP-binding protein; Pro | 99.89 | |
| COG4148 | 352 | ModC ABC-type molybdate transport system, ATPase c | 99.89 | |
| TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 99.89 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 99.89 | |
| TIGR01842 | 544 | type_I_sec_PrtD type I secretion system ABC transp | 99.89 | |
| cd03288 | 257 | ABCC_SUR2 The SUR domain 2. The sulfonylurea recep | 99.89 | |
| PRK11174 | 588 | cysteine/glutathione ABC transporter membrane/ATP- | 99.89 | |
| COG4152 | 300 | ABC-type uncharacterized transport system, ATPase | 99.89 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 99.89 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 99.89 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 99.89 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 99.88 | |
| cd03289 | 275 | ABCC_CFTR2 The CFTR subfamily domain 2. The cystic | 99.88 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 99.88 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 99.88 | |
| COG0410 | 237 | LivF ABC-type branched-chain amino acid transport | 99.88 | |
| TIGR01192 | 585 | chvA glucan exporter ATP-binding protein. This mod | 99.88 | |
| TIGR02203 | 571 | MsbA_lipidA lipid A export permease/ATP-binding pr | 99.88 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 99.88 | |
| PRK10535 | 648 | macrolide transporter ATP-binding /permease protei | 99.88 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 99.87 | |
| PRK11176 | 582 | lipid transporter ATP-binding/permease protein; Pr | 99.87 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 99.87 | |
| TIGR00955 | 617 | 3a01204 The Eye Pigment Precursor Transporter (EPP | 99.87 | |
| PLN03140 | 1470 | ABC transporter G family member; Provisional | 99.87 | |
| PRK13657 | 588 | cyclic beta-1,2-glucan ABC transporter; Provisiona | 99.87 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 99.87 | |
| PRK15177 | 213 | Vi polysaccharide export ATP-binding protein VexC; | 99.87 | |
| TIGR02857 | 529 | CydD thiol reductant ABC exporter, CydD subunit. U | 99.87 | |
| cd03279 | 213 | ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex | 99.87 | |
| COG1119 | 257 | ModF ABC-type molybdenum transport system, ATPase | 99.87 | |
| PRK10790 | 592 | putative multidrug transporter membrane\ATP-bindin | 99.87 | |
| PRK10789 | 569 | putative multidrug transporter membrane\ATP-bindin | 99.87 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 99.87 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 99.87 | |
| cd03291 | 282 | ABCC_CFTR1 The CFTR subfamily domain 1. The cystic | 99.87 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 99.87 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 99.87 | |
| TIGR00956 | 1394 | 3a01205 Pleiotropic Drug Resistance (PDR) Family p | 99.87 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 99.87 | |
| TIGR03375 | 694 | type_I_sec_LssB type I secretion system ATPase, Ls | 99.87 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 99.86 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 99.86 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 99.86 | |
| PRK11160 | 574 | cysteine/glutathione ABC transporter membrane/ATP- | 99.86 | |
| TIGR03797 | 686 | NHPM_micro_ABC2 NHPM bacteriocin system ABC transp | 99.86 | |
| TIGR03796 | 710 | NHPM_micro_ABC1 NHPM bacteriocin system ABC transp | 99.86 | |
| cd03278 | 197 | ABC_SMC_barmotin Barmotin is a tight junction-asso | 99.86 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 99.86 | |
| TIGR01846 | 694 | type_I_sec_HlyB type I secretion system ABC transp | 99.86 | |
| PRK00349 | 943 | uvrA excinuclease ABC subunit A; Reviewed | 99.86 | |
| COG4988 | 559 | CydD ABC-type transport system involved in cytochr | 99.86 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 99.86 | |
| TIGR01193 | 708 | bacteriocin_ABC ABC-type bacteriocin transporter. | 99.86 | |
| TIGR02204 | 576 | MsbA_rel ABC transporter, permease/ATP-binding pro | 99.86 | |
| TIGR00630 | 924 | uvra excinuclease ABC, A subunit. This family is b | 99.86 | |
| PTZ00265 | 1466 | multidrug resistance protein (mdr1); Provisional | 99.86 | |
| PTZ00265 | 1466 | multidrug resistance protein (mdr1); Provisional | 99.85 | |
| TIGR00954 | 659 | 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA | 99.85 | |
| TIGR01194 | 555 | cyc_pep_trnsptr cyclic peptide transporter. This m | 99.85 | |
| cd03272 | 243 | ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein | 99.85 | |
| cd03273 | 251 | ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein | 99.85 | |
| TIGR00956 | 1394 | 3a01205 Pleiotropic Drug Resistance (PDR) Family p | 99.85 | |
| PRK10522 | 547 | multidrug transporter membrane component/ATP-bindi | 99.85 | |
| COG1132 | 567 | MdlB ABC-type multidrug transport system, ATPase a | 99.85 | |
| KOG0061|consensus | 613 | 99.85 | ||
| COG4107 | 258 | PhnK ABC-type phosphonate transport system, ATPase | 99.84 | |
| TIGR00958 | 711 | 3a01208 Conjugate Transporter-2 (CT2) Family prote | 99.84 | |
| cd03276 | 198 | ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein | 99.84 | |
| KOG0055|consensus | 1228 | 99.84 | ||
| COG4987 | 573 | CydC ABC-type transport system involved in cytochr | 99.84 | |
| KOG0059|consensus | 885 | 99.84 | ||
| cd03240 | 204 | ABC_Rad50 The catalytic domains of Rad50 are simil | 99.84 | |
| COG1129 | 500 | MglA ABC-type sugar transport system, ATPase compo | 99.84 | |
| cd03275 | 247 | ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein | 99.84 | |
| PRK00635 | 1809 | excinuclease ABC subunit A; Provisional | 99.83 | |
| PRK00349 | 943 | uvrA excinuclease ABC subunit A; Reviewed | 99.83 | |
| COG4586 | 325 | ABC-type uncharacterized transport system, ATPase | 99.83 | |
| cd03274 | 212 | ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein | 99.83 | |
| COG3845 | 501 | ABC-type uncharacterized transport systems, ATPase | 99.83 | |
| PRK00635 | 1809 | excinuclease ABC subunit A; Provisional | 99.82 | |
| COG1129 | 500 | MglA ABC-type sugar transport system, ATPase compo | 99.82 | |
| KOG0055|consensus | 1228 | 99.82 | ||
| KOG0058|consensus | 716 | 99.82 | ||
| PLN03232 | 1495 | ABC transporter C family member; Provisional | 99.82 | |
| TIGR00630 | 924 | uvra excinuclease ABC, A subunit. This family is b | 99.82 | |
| COG4133 | 209 | CcmA ABC-type transport system involved in cytochr | 99.82 | |
| PLN03140 | 1470 | ABC transporter G family member; Provisional | 99.81 | |
| PLN03130 | 1622 | ABC transporter C family member; Provisional | 99.81 | |
| TIGR00957 | 1522 | MRP_assoc_pro multi drug resistance-associated pro | 99.8 | |
| COG4604 | 252 | CeuD ABC-type enterochelin transport system, ATPas | 99.8 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 99.8 | |
| PTZ00243 | 1560 | ABC transporter; Provisional | 99.8 | |
| PLN03232 | 1495 | ABC transporter C family member; Provisional | 99.8 | |
| TIGR00957 | 1522 | MRP_assoc_pro multi drug resistance-associated pro | 99.8 | |
| TIGR01271 | 1490 | CFTR_protein cystic fibrosis transmembrane conduct | 99.79 | |
| TIGR01271 | 1490 | CFTR_protein cystic fibrosis transmembrane conduct | 99.79 | |
| PTZ00243 | 1560 | ABC transporter; Provisional | 99.78 | |
| PLN03130 | 1622 | ABC transporter C family member; Provisional | 99.78 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 99.78 | |
| KOG0057|consensus | 591 | 99.78 | ||
| cd03239 | 178 | ABC_SMC_head The structural maintenance of chromos | 99.78 | |
| COG4618 | 580 | ArpD ABC-type protease/lipase transport system, AT | 99.77 | |
| COG4136 | 213 | ABC-type uncharacterized transport system, ATPase | 99.77 | |
| KOG0062|consensus | 582 | 99.77 | ||
| cd03277 | 213 | ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein | 99.76 | |
| COG1101 | 263 | PhnK ABC-type uncharacterized transport system, AT | 99.76 | |
| COG4674 | 249 | Uncharacterized ABC-type transport system, ATPase | 99.76 | |
| COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 99.76 | |
| COG1245 | 591 | Predicted ATPase, RNase L inhibitor (RLI) homolog | 99.76 | |
| TIGR00618 | 1042 | sbcc exonuclease SbcC. This family is based on the | 99.75 | |
| COG1245 | 591 | Predicted ATPase, RNase L inhibitor (RLI) homolog | 99.73 | |
| COG4559 | 259 | ABC-type hemin transport system, ATPase component | 99.73 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 99.73 | |
| cd03227 | 162 | ABC_Class2 ABC-type Class 2 contains systems invol | 99.72 | |
| cd03241 | 276 | ABC_RecN RecN ATPase involved in DNA repair; ABC ( | 99.72 | |
| COG4778 | 235 | PhnL ABC-type phosphonate transport system, ATPase | 99.72 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 99.71 | |
| KOG0927|consensus | 614 | 99.7 | ||
| PRK03918 | 880 | chromosome segregation protein; Provisional | 99.69 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 99.69 | |
| cd03280 | 200 | ABC_MutS2 MutS2 homologs in bacteria and eukaryote | 99.68 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 99.67 | |
| KOG0927|consensus | 614 | 99.66 | ||
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 99.65 | |
| KOG0062|consensus | 582 | 99.65 | ||
| PRK10869 | 553 | recombination and repair protein; Provisional | 99.65 | |
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 99.64 | |
| KOG0065|consensus | 1391 | 99.64 | ||
| COG5265 | 497 | ATM1 ABC-type transport system involved in Fe-S cl | 99.63 | |
| KOG0066|consensus | 807 | 99.63 | ||
| PRK01156 | 895 | chromosome segregation protein; Provisional | 99.6 | |
| KOG0054|consensus | 1381 | 99.59 | ||
| COG4178 | 604 | ABC-type uncharacterized transport system, permeas | 99.59 | |
| COG4167 | 267 | SapF ABC-type antimicrobial peptide transport syst | 99.58 | |
| KOG0056|consensus | 790 | 99.58 | ||
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 99.58 | |
| COG4138 | 248 | BtuD ABC-type cobalamin transport system, ATPase c | 99.58 | |
| COG4170 | 330 | SapD ABC-type antimicrobial peptide transport syst | 99.56 | |
| COG0178 | 935 | UvrA Excinuclease ATPase subunit [DNA replication, | 99.55 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 99.55 | |
| smart00534 | 185 | MUTSac ATPase domain of DNA mismatch repair MUTS f | 99.53 | |
| COG3845 | 501 | ABC-type uncharacterized transport systems, ATPase | 99.53 | |
| KOG0054|consensus | 1381 | 99.51 | ||
| PRK02224 | 880 | chromosome segregation protein; Provisional | 99.48 | |
| cd03243 | 202 | ABC_MutS_homologs The MutS protein initiates DNA m | 99.48 | |
| cd03242 | 270 | ABC_RecF RecF is a recombinational DNA repair ATPa | 99.46 | |
| cd03285 | 222 | ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS | 99.44 | |
| cd03282 | 204 | ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS | 99.43 | |
| TIGR00611 | 365 | recf recF protein. All proteins in this family for | 99.41 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 99.4 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 99.4 | |
| KOG0066|consensus | 807 | 99.39 | ||
| PRK00064 | 361 | recF recombination protein F; Reviewed | 99.37 | |
| KOG0060|consensus | 659 | 99.37 | ||
| COG0178 | 935 | UvrA Excinuclease ATPase subunit [DNA replication, | 99.36 | |
| KOG2355|consensus | 291 | 99.34 | ||
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 99.34 | |
| PF13304 | 303 | AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T | 99.31 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 99.28 | |
| cd03283 | 199 | ABC_MutS-like MutS-like homolog in eukaryotes. The | 99.28 | |
| COG4615 | 546 | PvdE ABC-type siderophore export system, fused ATP | 99.26 | |
| PF02463 | 220 | SMC_N: RecF/RecN/SMC N terminal domain; InterPro: | 99.23 | |
| cd03281 | 213 | ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS | 99.22 | |
| KOG0063|consensus | 592 | 99.2 | ||
| KOG0063|consensus | 592 | 99.2 | ||
| KOG0065|consensus | 1391 | 99.2 | ||
| PF13558 | 90 | SbcCD_C: Putative exonuclease SbcCD, C subunit; PD | 99.13 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 99.11 | |
| COG2401 | 593 | ABC-type ATPase fused to a predicted acetyltransfe | 99.03 | |
| KOG0064|consensus | 728 | 99.02 | ||
| PRK14079 | 349 | recF recombination protein F; Provisional | 99.01 | |
| cd03284 | 216 | ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr | 99.01 | |
| PTZ00132 | 215 | GTP-binding nuclear protein Ran; Provisional | 99.0 | |
| cd03286 | 218 | ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS | 98.87 | |
| cd03287 | 222 | ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS | 98.77 | |
| PRK13695 | 174 | putative NTPase; Provisional | 98.66 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 98.6 | |
| PRK13891 | 852 | conjugal transfer protein TrbE; Provisional | 98.57 | |
| PF13175 | 415 | AAA_15: AAA ATPase domain | 98.57 | |
| PRK13830 | 818 | conjugal transfer protein TrbE; Provisional | 98.51 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 98.49 | |
| COG3910 | 233 | Predicted ATPase [General function prediction only | 98.44 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 98.41 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 98.38 | |
| PF13166 | 712 | AAA_13: AAA domain | 98.34 | |
| COG4637 | 373 | Predicted ATPase [General function prediction only | 98.3 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 98.29 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 98.24 | |
| PRK13873 | 811 | conjugal transfer ATPase TrbE; Provisional | 98.18 | |
| KOG0964|consensus | 1200 | 98.13 | ||
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 98.07 | |
| PRK13898 | 800 | type IV secretion system ATPase VirB4; Provisional | 98.03 | |
| KOG0962|consensus | 1294 | 98.03 | ||
| PRK05399 | 854 | DNA mismatch repair protein MutS; Provisional | 97.94 | |
| KOG0996|consensus | 1293 | 97.88 | ||
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 97.87 | |
| KOG0933|consensus | 1174 | 97.87 | ||
| COG0497 | 557 | RecN ATPase involved in DNA repair [DNA replicatio | 97.76 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 97.76 | |
| KOG0018|consensus | 1141 | 97.67 | ||
| PF00488 | 235 | MutS_V: MutS domain V C-terminus.; InterPro: IPR00 | 97.62 | |
| PRK08699 | 325 | DNA polymerase III subunit delta'; Validated | 97.48 | |
| COG4694 | 758 | Uncharacterized protein conserved in bacteria [Fun | 97.41 | |
| PF13514 | 1111 | AAA_27: AAA domain | 97.3 | |
| TIGR01070 | 840 | mutS1 DNA mismatch repair protein MutS. | 97.16 | |
| PRK06793 | 432 | fliI flagellum-specific ATP synthase; Validated | 97.1 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 97.07 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 96.67 | |
| TIGR00152 | 188 | dephospho-CoA kinase. This model produces scores i | 96.52 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 96.46 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 96.46 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 96.43 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 96.41 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 96.34 | |
| COG1195 | 363 | RecF Recombinational DNA repair ATPase (RecF pathw | 96.11 | |
| COG4938 | 374 | Uncharacterized conserved protein [Function unknow | 96.1 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 96.09 | |
| PF09818 | 448 | ABC_ATPase: Predicted ATPase of the ABC class; Int | 96.04 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 95.64 | |
| TIGR00929 | 785 | VirB4_CagE type IV secretion/conjugal transfer ATP | 95.42 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 95.15 | |
| PRK08181 | 269 | transposase; Validated | 94.95 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 94.81 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 94.75 | |
| PRK07721 | 438 | fliI flagellum-specific ATP synthase; Validated | 94.72 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 94.48 | |
| COG4913 | 1104 | Uncharacterized protein conserved in bacteria [Fun | 94.36 | |
| cd00561 | 159 | CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B | 94.31 | |
| PRK00454 | 196 | engB GTP-binding protein YsxC; Reviewed | 94.29 | |
| PRK06526 | 254 | transposase; Provisional | 94.17 |
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
Probab=99.97 E-value=3.9e-30 Score=158.54 Aligned_cols=72 Identities=28% Similarity=0.560 Sum_probs=70.0
Q ss_pred CCCcchhcCcCCCCChHHHHHHHHHHHHhcCCCEEEEeCCCCCCCHHHHHHHHHHHHHHHhCCceEEEEecC
Q psy858 1 MGLTEYRHRESGRYSGGNKRKLSTAMALIGDPPLVFLDEPTSGVDPISRHRLWAVLSQIQKTGQSIVLTSHR 72 (72)
Q Consensus 1 ~~l~~~~~~~~~~lS~G~~qr~~ia~~l~~~p~~lllDEP~~gld~~~~~~i~~~l~~~~~~g~til~~~h~ 72 (72)
+||.++++.||.+||||||||++|||||+.+|+++++|||||+|||....++.+.+++++++|.|.+++||+
T Consensus 124 VGL~~ka~~yP~qLSGGQqQRVAIARALaM~P~vmLFDEPTSALDPElv~EVL~vm~~LA~eGmTMivVTHE 195 (240)
T COG1126 124 VGLADKADAYPAQLSGGQQQRVAIARALAMDPKVMLFDEPTSALDPELVGEVLDVMKDLAEEGMTMIIVTHE 195 (240)
T ss_pred cCchhhhhhCccccCcHHHHHHHHHHHHcCCCCEEeecCCcccCCHHHHHHHHHHHHHHHHcCCeEEEEech
Confidence 588899999999999999999999999999999999999999999999999999999999999999999995
|
|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13537 nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >PRK13536 nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP | Back alignment and domain information |
|---|
| >TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13651 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
|---|
| >PRK10851 sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15056 manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11144 modC molybdate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13633 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >TIGR02770 nickel_nikD nickel import ATP-binding protein NikD | Back alignment and domain information |
|---|
| >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake | Back alignment and domain information |
|---|
| >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02769 nickel_nikE nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11607 potG putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >PRK09580 sufC cysteine desulfurase ATPase component; Reviewed | Back alignment and domain information |
|---|
| >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors | Back alignment and domain information |
|---|
| >cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E | Back alignment and domain information |
|---|
| >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >CHL00131 ycf16 sulfate ABC transporter protein; Validated | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D | Back alignment and domain information |
|---|
| >TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03299 ABC_ModC_like Archeal protein closely related to ModC | Back alignment and domain information |
|---|
| >cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PRK03695 vitamin B12-transporter ATPase; Provisional | Back alignment and domain information |
|---|
| >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters | Back alignment and domain information |
|---|
| >PRK14268 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 | Back alignment and domain information |
|---|
| >cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria | Back alignment and domain information |
|---|
| >PRK14273 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >PRK13546 teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14245 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14259 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13547 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14249 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03290 ABCC_SUR1_N The SUR domain 1 | Back alignment and domain information |
|---|
| >PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14244 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14269 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14267 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14239 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14265 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C | Back alignment and domain information |
|---|
| >PRK14270 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14272 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >PRK14258 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >PRK14255 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14254 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >PRK14238 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C | Back alignment and domain information |
|---|
| >PRK14251 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >PRK14262 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14253 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >PRK14274 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14243 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14260 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14275 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >PRK14256 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14236 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) | Back alignment and domain information |
|---|
| >PRK14266 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >PRK14261 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14264 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >PRK14237 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14271 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14263 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PLN03211 ABC transporter G-25; Provisional | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >PRK14246 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14257 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14252 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family | Back alignment and domain information |
|---|
| >cd03288 ABCC_SUR2 The SUR domain 2 | Back alignment and domain information |
|---|
| >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01192 chvA glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10535 macrolide transporter ATP-binding /permease protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >PRK11176 lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein | Back alignment and domain information |
|---|
| >PLN03140 ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional | Back alignment and domain information |
|---|
| >TIGR02857 CydD thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends | Back alignment and domain information |
|---|
| >COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family | Back alignment and domain information |
|---|
| >PRK00349 uvrA excinuclease ABC subunit A; Reviewed | Back alignment and domain information |
|---|
| >COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR00630 uvra excinuclease ABC, A subunit | Back alignment and domain information |
|---|
| >PTZ00265 multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >PTZ00265 multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei | Back alignment and domain information |
|---|
| >TIGR01194 cyc_pep_trnsptr cyclic peptide transporter | Back alignment and domain information |
|---|
| >cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0061|consensus | Back alignment and domain information |
|---|
| >COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
|---|
| >cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >KOG0055|consensus | Back alignment and domain information |
|---|
| >COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0059|consensus | Back alignment and domain information |
|---|
| >cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains | Back alignment and domain information |
|---|
| >COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >PRK00635 excinuclease ABC subunit A; Provisional | Back alignment and domain information |
|---|
| >PRK00349 uvrA excinuclease ABC subunit A; Reviewed | Back alignment and domain information |
|---|
| >COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00635 excinuclease ABC subunit A; Provisional | Back alignment and domain information |
|---|
| >COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0055|consensus | Back alignment and domain information |
|---|
| >KOG0058|consensus | Back alignment and domain information |
|---|
| >PLN03232 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >TIGR00630 uvra excinuclease ABC, A subunit | Back alignment and domain information |
|---|
| >COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03140 ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >PLN03130 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00243 ABC transporter; Provisional | Back alignment and domain information |
|---|
| >PLN03232 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >PTZ00243 ABC transporter; Provisional | Back alignment and domain information |
|---|
| >PLN03130 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0057|consensus | Back alignment and domain information |
|---|
| >cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms | Back alignment and domain information |
|---|
| >COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] | Back alignment and domain information |
|---|
| >COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0062|consensus | Back alignment and domain information |
|---|
| >cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00618 sbcc exonuclease SbcC | Back alignment and domain information |
|---|
| >COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport | Back alignment and domain information |
|---|
| >cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0927|consensus | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG0927|consensus | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >KOG0062|consensus | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG0065|consensus | Back alignment and domain information |
|---|
| >COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0066|consensus | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0054|consensus | Back alignment and domain information |
|---|
| >COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0056|consensus | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family | Back alignment and domain information |
|---|
| >COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0054|consensus | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch | Back alignment and domain information |
|---|
| >cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage | Back alignment and domain information |
|---|
| >cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes | Back alignment and domain information |
|---|
| >TIGR00611 recf recF protein | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0066|consensus | Back alignment and domain information |
|---|
| >PRK00064 recF recombination protein F; Reviewed | Back alignment and domain information |
|---|
| >KOG0060|consensus | Back alignment and domain information |
|---|
| >COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG2355|consensus | Back alignment and domain information |
|---|
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >cd03283 ABC_MutS-like MutS-like homolog in eukaryotes | Back alignment and domain information |
|---|
| >COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] | Back alignment and domain information |
|---|
| >cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes | Back alignment and domain information |
|---|
| >KOG0063|consensus | Back alignment and domain information |
|---|
| >KOG0063|consensus | Back alignment and domain information |
|---|
| >KOG0065|consensus | Back alignment and domain information |
|---|
| >PF13558 SbcCD_C: Putative exonuclease SbcCD, C subunit; PDB: 3QG5_B 3QF7_A 3THO_A 3EUK_H 3EUJ_A 3AV0_B 3AUY_B 3AUX_A | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0064|consensus | Back alignment and domain information |
|---|
| >PRK14079 recF recombination protein F; Provisional | Back alignment and domain information |
|---|
| >cd03284 ABC_MutS1 MutS1 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PTZ00132 GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK13891 conjugal transfer protein TrbE; Provisional | Back alignment and domain information |
|---|
| >PF13175 AAA_15: AAA ATPase domain | Back alignment and domain information |
|---|
| >PRK13830 conjugal transfer protein TrbE; Provisional | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >COG3910 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >COG4637 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PRK13873 conjugal transfer ATPase TrbE; Provisional | Back alignment and domain information |
|---|
| >KOG0964|consensus | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >PRK13898 type IV secretion system ATPase VirB4; Provisional | Back alignment and domain information |
|---|
| >KOG0962|consensus | Back alignment and domain information |
|---|
| >PRK05399 DNA mismatch repair protein MutS; Provisional | Back alignment and domain information |
|---|
| >KOG0996|consensus | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >KOG0933|consensus | Back alignment and domain information |
|---|
| >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >KOG0018|consensus | Back alignment and domain information |
|---|
| >PF00488 MutS_V: MutS domain V C-terminus | Back alignment and domain information |
|---|
| >PRK08699 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG4694 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >TIGR01070 mutS1 DNA mismatch repair protein MutS | Back alignment and domain information |
|---|
| >PRK06793 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >TIGR00152 dephospho-CoA kinase | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >COG1195 RecF Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG4938 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PF09818 ABC_ATPase: Predicted ATPase of the ABC class; InterPro: IPR019195 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >TIGR00929 VirB4_CagE type IV secretion/conjugal transfer ATPase, VirB4 family | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK07721 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >COG4913 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP | Back alignment and domain information |
|---|
| >PRK00454 engB GTP-binding protein YsxC; Reviewed | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 72 | ||||
| 1vpl_A | 256 | Crystal Structure Of Abc Transporter Atp-binding Pr | 2e-07 | ||
| 2pcj_A | 224 | Crystal Structure Of Abc Transporter (Aq_297) From | 3e-07 | ||
| 4huq_A | 290 | Crystal Structure Of A Transporter Length = 290 | 7e-07 | ||
| 3c41_J | 242 | Abc Protein Artp In Complex With Amp-PnpMG2+ Length | 8e-07 | ||
| 4hlu_D | 268 | Structure Of The Ecfa-a' Heterodimer Bound To Adp L | 8e-07 | ||
| 2olj_A | 263 | Abc Protein Artp In Complex With AdpMG2+ Length = 2 | 1e-06 | ||
| 1b0u_A | 262 | Atp-Binding Subunit Of The Histidine Permease From | 1e-06 | ||
| 3qf4_A | 587 | Crystal Structure Of A Heterodimeric Abc Transporte | 1e-06 | ||
| 3b5w_A | 582 | Crystal Structure Of Eschericia Coli Msba Length = | 3e-06 | ||
| 3b5y_A | 582 | Crystal Structure Of Msba From Salmonella Typhimuri | 3e-06 | ||
| 3gfo_A | 275 | Structure Of Cbio1 From Clostridium Perfringens: Pa | 3e-06 | ||
| 3b5x_A | 582 | Crystal Structure Of Msba From Vibrio Cholerae Leng | 4e-06 | ||
| 1g29_1 | 372 | Malk Length = 372 | 1e-05 | ||
| 1g6h_A | 257 | Crystal Structure Of The Adp Conformation Of Mj1267 | 1e-05 | ||
| 2yz2_A | 266 | Crystal Structure Of The Abc Transporter In The Cob | 1e-05 | ||
| 1g9x_A | 257 | Characterization Of The Twinning Structure Of Mj126 | 1e-05 | ||
| 1f3o_A | 235 | Crystal Structure Of Mj0796 Atp-Binding Cassette Le | 1e-05 | ||
| 4hlu_A | 268 | Structure Of The Ecfa-a' Heterodimer Bound To Adp L | 1e-05 | ||
| 4huq_B | 279 | Crystal Structure Of A Transporter Length = 279 | 2e-05 | ||
| 1oxs_C | 353 | Crystal Structure Of Glcv, The Abc-Atpase Of The Gl | 2e-05 | ||
| 1l2t_A | 235 | Dimeric Structure Of Mj0796, A Bacterial Abc Transp | 2e-05 | ||
| 2pmk_A | 243 | Crystal Structures Of An Isolated Abc-Atpase In Com | 2e-05 | ||
| 3b5j_A | 243 | Crystal Structures Of The S504a Mutant Of An Isolat | 2e-05 | ||
| 1mt0_A | 241 | Atp-Binding Domain Of Haemolysin B From Escherichia | 3e-05 | ||
| 2ff7_A | 247 | The Abc-Atpase Of The Abc-Transporter Hlyb In The A | 3e-05 | ||
| 1gaj_A | 257 | Crystal Structure Of A Nucleotide-Free Atp-Binding | 3e-05 | ||
| 2it1_A | 362 | Structure Of Ph0203 Protein From Pyrococcus Horikos | 4e-05 | ||
| 3tif_A | 235 | Dimeric Structure Of A Post-Hydrolysis State Of The | 5e-05 | ||
| 3g60_A | 1284 | Structure Of P-Glycoprotein Reveals A Molecular Bas | 7e-05 | ||
| 3g5u_A | 1284 | Structure Of P-Glycoprotein Reveals A Molecular Bas | 7e-05 | ||
| 2ffb_A | 247 | The Crystal Structure Of The Hlyb-Nbd E631q Mutant | 7e-05 | ||
| 3dhw_C | 343 | Crystal Structure Of Methionine Importer Metni Leng | 7e-05 | ||
| 1oxx_K | 353 | Crystal Structure Of Glcv, The Abc-Atpase Of The Gl | 7e-05 | ||
| 2d62_A | 375 | Crystal Structure Of Multiple Sugar Binding Transpo | 1e-04 | ||
| 2onk_A | 240 | Abc Transporter Modbc In Complex With Its Binding P | 1e-04 | ||
| 3d31_A | 348 | Modbc From Methanosarcina Acetivorans Length = 348 | 1e-04 | ||
| 1ji0_A | 240 | Crystal Structure Analysis Of The Abc Transporter F | 1e-04 | ||
| 4f4c_A | 1321 | The Crystal Structure Of The Multi-Drug Transporter | 2e-04 | ||
| 3tui_C | 366 | Inward Facing Conformations Of The Metni Methionine | 2e-04 | ||
| 3tuj_C | 366 | Inward Facing Conformations Of The Metni Methionine | 2e-04 | ||
| 4ayt_A | 595 | Structure Of The Human Mitochondrial Abc Transporte | 2e-04 | ||
| 2hyd_A | 578 | Multidrug Abc Transporter Sav1866 Length = 578 | 2e-04 | ||
| 2nq2_C | 253 | An Inward-Facing Conformation Of A Putative Metal-C | 2e-04 | ||
| 1xef_A | 241 | Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DI | 3e-04 | ||
| 2ffa_A | 247 | Crystal Structure Of Abc-Atpase H662a Of The Abc-Tr | 3e-04 | ||
| 2ghi_A | 260 | Crystal Structure Of Plasmodium Yoelii Multidrug Re | 5e-04 |
| >pdb|1VPL|A Chain A, Crystal Structure Of Abc Transporter Atp-binding Protein (tm0544) From Thermotoga Maritima At 2.10 A Resolution Length = 256 | Back alignment and structure |
|
| >pdb|2PCJ|A Chain A, Crystal Structure Of Abc Transporter (Aq_297) From Aquifex Aeolicus Vf5 Length = 224 | Back alignment and structure |
| >pdb|4HUQ|A Chain A, Crystal Structure Of A Transporter Length = 290 | Back alignment and structure |
| >pdb|3C41|J Chain J, Abc Protein Artp In Complex With Amp-PnpMG2+ Length = 242 | Back alignment and structure |
| >pdb|4HLU|D Chain D, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 | Back alignment and structure |
| >pdb|2OLJ|A Chain A, Abc Protein Artp In Complex With AdpMG2+ Length = 263 | Back alignment and structure |
| >pdb|1B0U|A Chain A, Atp-Binding Subunit Of The Histidine Permease From Salmonella Typhimurium Length = 262 | Back alignment and structure |
| >pdb|3QF4|A Chain A, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 587 | Back alignment and structure |
| >pdb|3B5W|A Chain A, Crystal Structure Of Eschericia Coli Msba Length = 582 | Back alignment and structure |
| >pdb|3B5Y|A Chain A, Crystal Structure Of Msba From Salmonella Typhimurium With Amppnp Length = 582 | Back alignment and structure |
| >pdb|3GFO|A Chain A, Structure Of Cbio1 From Clostridium Perfringens: Part Of The Abc Transporter Complex Cbionq Length = 275 | Back alignment and structure |
| >pdb|3B5X|A Chain A, Crystal Structure Of Msba From Vibrio Cholerae Length = 582 | Back alignment and structure |
| >pdb|1G29|1 Chain 1, Malk Length = 372 | Back alignment and structure |
| >pdb|1G6H|A Chain A, Crystal Structure Of The Adp Conformation Of Mj1267, An Atp- Binding Cassette Of An Abc Transporter Length = 257 | Back alignment and structure |
| >pdb|2YZ2|A Chain A, Crystal Structure Of The Abc Transporter In The Cobalt Transport System Length = 266 | Back alignment and structure |
| >pdb|1G9X|A Chain A, Characterization Of The Twinning Structure Of Mj1267, An Atp-Binding Cassette Of An Abc Transporter Length = 257 | Back alignment and structure |
| >pdb|1F3O|A Chain A, Crystal Structure Of Mj0796 Atp-Binding Cassette Length = 235 | Back alignment and structure |
| >pdb|4HLU|A Chain A, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 | Back alignment and structure |
| >pdb|4HUQ|B Chain B, Crystal Structure Of A Transporter Length = 279 | Back alignment and structure |
| >pdb|1OXS|C Chain C, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 | Back alignment and structure |
| >pdb|1L2T|A Chain A, Dimeric Structure Of Mj0796, A Bacterial Abc Transporter Cassette Length = 235 | Back alignment and structure |
| >pdb|2PMK|A Chain A, Crystal Structures Of An Isolated Abc-Atpase In Complex With Tnp-Adp Length = 243 | Back alignment and structure |
| >pdb|3B5J|A Chain A, Crystal Structures Of The S504a Mutant Of An Isolated Abc-atpase In Complex With Tnp-adp Length = 243 | Back alignment and structure |
| >pdb|1MT0|A Chain A, Atp-Binding Domain Of Haemolysin B From Escherichia Coli Length = 241 | Back alignment and structure |
| >pdb|2FF7|A Chain A, The Abc-Atpase Of The Abc-Transporter Hlyb In The Adp Bound State Length = 247 | Back alignment and structure |
| >pdb|1GAJ|A Chain A, Crystal Structure Of A Nucleotide-Free Atp-Binding Cassette From An Abc Transporter Length = 257 | Back alignment and structure |
| >pdb|2IT1|A Chain A, Structure Of Ph0203 Protein From Pyrococcus Horikoshii Length = 362 | Back alignment and structure |
| >pdb|3TIF|A Chain A, Dimeric Structure Of A Post-Hydrolysis State Of The Atp-Binding Cassette Mj0796 Bound To Adp And Pi Length = 235 | Back alignment and structure |
| >pdb|3G60|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 | Back alignment and structure |
| >pdb|3G5U|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 | Back alignment and structure |
| >pdb|2FFB|A Chain A, The Crystal Structure Of The Hlyb-Nbd E631q Mutant In Complex With Adp Length = 247 | Back alignment and structure |
| >pdb|3DHW|C Chain C, Crystal Structure Of Methionine Importer Metni Length = 343 | Back alignment and structure |
| >pdb|1OXX|K Chain K, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 | Back alignment and structure |
| >pdb|2D62|A Chain A, Crystal Structure Of Multiple Sugar Binding Transport Atp- Binding Protein Length = 375 | Back alignment and structure |
| >pdb|2ONK|A Chain A, Abc Transporter Modbc In Complex With Its Binding Protein Moda Length = 240 | Back alignment and structure |
| >pdb|3D31|A Chain A, Modbc From Methanosarcina Acetivorans Length = 348 | Back alignment and structure |
| >pdb|1JI0|A Chain A, Crystal Structure Analysis Of The Abc Transporter From Thermotoga Maritima Length = 240 | Back alignment and structure |
| >pdb|4F4C|A Chain A, The Crystal Structure Of The Multi-Drug Transporter Length = 1321 | Back alignment and structure |
| >pdb|3TUI|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Cy5 Native Crystal Form Length = 366 | Back alignment and structure |
| >pdb|3TUJ|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Dm Crystal Form Length = 366 | Back alignment and structure |
| >pdb|4AYT|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 Length = 595 | Back alignment and structure |
| >pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866 Length = 578 | Back alignment and structure |
| >pdb|2NQ2|C Chain C, An Inward-Facing Conformation Of A Putative Metal-Chelate Type Abc Transporter. Length = 253 | Back alignment and structure |
| >pdb|1XEF|A Chain A, Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DIMER OF HLYB-Nbd Length = 241 | Back alignment and structure |
| >pdb|2FFA|A Chain A, Crystal Structure Of Abc-Atpase H662a Of The Abc-Transporter Hlyb In Complex With Adp Length = 247 | Back alignment and structure |
| >pdb|2GHI|A Chain A, Crystal Structure Of Plasmodium Yoelii Multidrug Resistance Protein 2 Length = 260 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 72 | |||
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 3e-27 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 2e-22 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 1e-18 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 6e-14 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 1e-13 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 5e-13 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 1e-12 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 2e-12 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 2e-12 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 7e-11 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 5e-12 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 4e-11 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 4e-11 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 6e-10 | |
| 3qkt_A | 339 | DNA double-strand break repair RAD50 ATPase; RECA- | 6e-11 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 5e-10 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 1e-09 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 2e-08 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 1e-07 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 8e-06 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 3e-07 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 2e-04 | |
| 1f2t_B | 148 | RAD50 ABC-ATPase; DNA double-strand break repair, | 4e-07 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 5e-07 | |
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 1e-06 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 4e-06 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 4e-06 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 7e-06 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 1e-05 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 3e-05 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 3e-05 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 6e-05 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 9e-05 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 2e-04 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 3e-04 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 4e-04 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 6e-04 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 9e-04 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 9e-04 |
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 | Back alignment and structure |
|---|
Score = 97.6 bits (244), Expect = 3e-27
Identities = 28/71 (39%), Positives = 40/71 (56%)
Query: 1 MGLTEYRHRESGRYSGGNKRKLSTAMALIGDPPLVFLDEPTSGVDPISRHRLWAVLSQIQ 60
GL E YS G RKL A AL+ +P L LDEPTSG+D ++ + +L Q
Sbjct: 134 AGLGEKIKDRVSTYSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQAS 193
Query: 61 KTGQSIVLTSH 71
+ G +I+++SH
Sbjct: 194 QEGLTILVSSH 204
|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Length = 339 | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 | Back alignment and structure |
|---|
| >1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Length = 148 | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Length = 371 | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Length = 240 | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Length = 235 | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 598 | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Length = 263 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 72 | |||
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 99.96 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 99.96 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 99.96 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 99.96 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 99.96 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 99.96 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 99.96 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 99.96 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 99.96 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 99.96 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 99.95 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 99.95 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 99.95 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 99.95 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 99.95 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 99.95 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 99.95 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 99.95 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 99.95 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 99.95 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 99.95 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 99.95 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 99.95 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 99.95 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 99.95 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 99.95 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 99.95 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 99.94 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 99.94 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 99.94 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 99.94 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 99.94 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 99.94 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 99.93 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 99.93 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 99.93 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 99.93 | |
| 1f2t_B | 148 | RAD50 ABC-ATPase; DNA double-strand break repair, | 99.93 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 99.93 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 99.92 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 99.92 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 99.92 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 99.92 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 99.92 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 99.92 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 99.91 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 99.91 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 99.91 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 99.91 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 99.91 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 99.91 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 99.9 | |
| 3qf7_A | 365 | RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. | 99.9 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 99.9 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 99.9 | |
| 3pih_A | 916 | Uvrabc system protein A; hydrolase, ABC ATPase, DN | 99.88 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 99.88 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 99.88 | |
| 3pih_A | 916 | Uvrabc system protein A; hydrolase, ABC ATPase, DN | 99.88 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 99.88 | |
| 2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 99.88 | |
| 2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 99.87 | |
| 3qkt_A | 339 | DNA double-strand break repair RAD50 ATPase; RECA- | 99.87 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 99.87 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 99.86 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 99.86 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 99.86 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 99.86 | |
| 4aby_A | 415 | DNA repair protein RECN; hydrolase, double strand | 99.85 | |
| 3kta_B | 173 | Chromosome segregation protein SMC; structural mai | 99.85 | |
| 1e69_A | 322 | Chromosome segregation SMC protein; structural mai | 99.85 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 99.84 | |
| 4ad8_A | 517 | DNA repair protein RECN; DNA binding protein, ATPa | 99.84 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 99.83 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 99.8 | |
| 1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 99.78 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 99.77 | |
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 99.75 | |
| 2o5v_A | 359 | DNA replication and repair protein RECF; ABC ATPas | 99.73 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 99.7 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 99.64 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 99.63 | |
| 3thx_B | 918 | DNA mismatch repair protein MSH3; ABC family ATPas | 99.55 | |
| 3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 99.46 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 99.43 | |
| 2o8b_B | 1022 | DNA mismatch repair protein MSH6; DNA damage respo | 99.41 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 99.39 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 99.25 | |
| 1ewq_A | 765 | DNA mismatch repair protein MUTS; multiple domains | 99.22 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 99.18 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 99.18 | |
| 1wb9_A | 800 | DNA mismatch repair protein MUTS; DNA-binding, ATP | 99.18 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 99.13 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 99.11 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 99.1 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 99.09 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 99.05 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 98.93 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 98.92 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 98.91 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 98.84 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 98.79 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 98.78 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 98.76 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 98.73 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 98.73 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 98.7 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 98.67 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 98.65 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 98.49 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 98.41 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 98.39 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 98.37 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 98.35 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 98.33 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 98.27 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 98.22 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 98.18 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 98.17 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 98.15 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 98.13 | |
| 3szr_A | 608 | Interferon-induced GTP-binding protein MX1; interf | 98.07 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 97.96 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 97.95 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 97.92 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 97.84 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 97.7 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 97.63 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 97.55 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 97.52 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 97.52 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 97.44 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 97.42 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.39 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 97.26 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 97.26 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 97.21 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 97.19 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 97.07 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 97.05 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 96.82 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 96.79 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 96.65 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 96.51 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 95.67 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 95.39 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 95.37 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 94.68 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 94.49 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 94.32 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 94.08 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 94.02 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 93.96 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 93.88 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 93.8 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 93.75 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 93.62 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 93.47 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 93.35 | |
| 2ius_A | 512 | DNA translocase FTSK; nucleotide-binding, chromoso | 93.28 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 93.27 | |
| 4dgh_A | 130 | Sulfate permease family protein; STAS domain, anio | 93.21 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 92.75 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 92.75 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 92.72 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 92.58 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 92.56 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 92.4 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 92.07 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 91.94 | |
| 4dgf_A | 135 | Sulfate transporter sulfate transporter family PR; | 91.65 | |
| 3szr_A | 608 | Interferon-induced GTP-binding protein MX1; interf | 91.53 | |
| 3oiz_A | 99 | Antisigma-factor antagonist, STAS; PSI-2, midwest | 91.3 | |
| 1ni3_A | 392 | YCHF GTPase, YCHF GTP-binding protein; structural | 90.86 | |
| 3llo_A | 143 | Prestin; STAS domain, cell shape, glycoprotein, me | 90.77 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 90.77 | |
| 3ny7_A | 118 | YCHM protein, sulfate transporter; fatty acid bios | 90.01 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 90.0 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 89.98 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 89.01 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 88.66 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 88.43 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 88.24 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 88.11 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 87.92 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 87.46 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 86.39 | |
| 2ka5_A | 125 | Putative anti-sigma factor antagonist TM_1081; ter | 86.18 | |
| 2orv_A | 234 | Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 | 85.09 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 85.06 | |
| 2kln_A | 130 | Probable sulphate-transport transmembrane protein; | 84.75 | |
| 3t34_A | 360 | Dynamin-related protein 1A, linker, dynamin-relat | 84.6 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 83.74 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 83.72 | |
| 1th8_B | 116 | Anti-sigma F factor antagonist; SPOIIAB, SPOIIAA, | 82.84 | |
| 1x52_A | 124 | Pelota homolog, CGI-17; ERF1_3 domain, structural | 82.54 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 82.47 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 82.17 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 81.7 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 81.3 | |
| 1sbo_A | 110 | Putative anti-sigma factor antagonist TM1442; open | 80.82 |
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
Probab=99.96 E-value=3e-29 Score=154.09 Aligned_cols=72 Identities=33% Similarity=0.609 Sum_probs=68.5
Q ss_pred CCCcchhcCcCCCCChHHHHHHHHHHHHhcCCCEEEEeCCCCCCCHHHHHHHHHHHHHHHhCCceEEEEecC
Q psy858 1 MGLTEYRHRESGRYSGGNKRKLSTAMALIGDPPLVFLDEPTSGVDPISRHRLWAVLSQIQKTGQSIVLTSHR 72 (72)
Q Consensus 1 ~~l~~~~~~~~~~lS~G~~qr~~ia~~l~~~p~~lllDEP~~gld~~~~~~i~~~l~~~~~~g~til~~~h~ 72 (72)
+|+.+..++++.+||||||||+++|+|++.+|+++||||||+|||+.+++.+.+++++++++|.|||++|||
T Consensus 128 ~~l~~~~~~~~~~LSgGq~qrv~laral~~~p~lllLDEPt~~LD~~~~~~~~~~l~~l~~~g~tvi~vtHd 199 (224)
T 2pcj_A 128 LGLGDKLSRKPYELSGGEQQRVAIARALANEPILLFADEPTGNLDSANTKRVMDIFLKINEGGTSIVMVTHE 199 (224)
T ss_dssp TTCTTCTTCCGGGSCHHHHHHHHHHHHTTTCCSEEEEESTTTTCCHHHHHHHHHHHHHHHHTTCEEEEECSC
T ss_pred cCCchhhhCChhhCCHHHHHHHHHHHHHHcCCCEEEEeCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEcCC
Confidence 477788899999999999999999999999999999999999999999999999999997779999999997
|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* | Back alignment and structure |
|---|
| >1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* | Back alignment and structure |
|---|
| >2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* | Back alignment and structure |
|---|
| >3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >4dgh_A Sulfate permease family protein; STAS domain, anion exchange, membrane, transport protein; HET: MSE; 1.90A {Vibrio cholerae} PDB: 3mgl_A* | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >4dgf_A Sulfate transporter sulfate transporter family PR; STAS domain, anion exchange, membrane, transport protein; HET: MSE; 1.60A {Wolinella succinogenes} PDB: 3oir_A* | Back alignment and structure |
|---|
| >3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B | Back alignment and structure |
|---|
| >3oiz_A Antisigma-factor antagonist, STAS; PSI-2, midwest center for structural genomics, protein struc initiative, MCSG, STAS domain; 1.65A {Rhodobacter sphaeroides} PDB: 3lkl_A | Back alignment and structure |
|---|
| >1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >3llo_A Prestin; STAS domain, cell shape, glycoprotein, membrane, motor prote transmembrane; HET: BOG; 1.57A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >3ny7_A YCHM protein, sulfate transporter; fatty acid biosynthesis(FAB), bicarbonate transport, anion T membrane protein, STAS domain, SLC26; HET: SXM; 1.92A {Escherichia coli} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >2ka5_A Putative anti-sigma factor antagonist TM_1081; termotoga marithima, phosphoprotein, structural GENO PSI-2, protein structure initiative; NMR {Thermotoga maritima} PDB: 3f43_A* | Back alignment and structure |
|---|
| >2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >2kln_A Probable sulphate-transport transmembrane protein; SLC26, sulfate, antisigma factor antagonist, ensemble structures, transport protein; NMR {Mycobacterium bovis} | Back alignment and structure |
|---|
| >3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1th8_B Anti-sigma F factor antagonist; SPOIIAB, SPOIIAA, anti-ANTI-sigma, sporulation, serine kinase, transcription; HET: ADP; 2.40A {Geobacillus stearothermophilus} SCOP: c.13.2.1 PDB: 1thn_B* 1tid_B* 1til_B* 1auz_A 1buz_A | Back alignment and structure |
|---|
| >1x52_A Pelota homolog, CGI-17; ERF1_3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.79.3.2 | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >1sbo_A Putative anti-sigma factor antagonist TM1442; open sandwich, JCSG, structural genomics, joint center for structural genomics, PSI; NMR {Thermotoga maritima} SCOP: c.13.2.1 PDB: 1t6r_A* 1vc1_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 72 | ||||
| d1ji0a_ | 240 | c.37.1.12 (A:) Branched chain aminoacid ABC transp | 4e-19 | |
| d1v43a3 | 239 | c.37.1.12 (A:7-245) Hypothetical protein PH0022, N | 3e-18 | |
| d1g6ha_ | 254 | c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann | 2e-17 | |
| d1vpla_ | 238 | c.37.1.12 (A:) Putative ABC transporter TM0544 {Th | 3e-16 | |
| d1l2ta_ | 230 | c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann | 2e-14 | |
| d3dhwc1 | 240 | c.37.1.12 (C:1-240) Methionine import ATP-binding | 3e-14 | |
| d1g2912 | 240 | c.37.1.12 (1:1-240) Maltose transport protein MalK | 8e-14 | |
| d1sgwa_ | 200 | c.37.1.12 (A:) Putative ABC transporter PF0895 {Py | 9e-14 | |
| d3b60a1 | 253 | c.37.1.12 (A:329-581) Multidrug resistance ABC tra | 1e-13 | |
| d1l7vc_ | 231 | c.37.1.12 (C:) ABC transporter involved in vitamin | 2e-13 | |
| d1b0ua_ | 258 | c.37.1.12 (A:) ATP-binding subunit of the histidin | 3e-13 | |
| d1r0wa_ | 281 | c.37.1.12 (A:) Cystic fibrosis transmembrane condu | 4e-13 | |
| d2pmka1 | 241 | c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro | 1e-12 | |
| g1ii8.1 | 369 | c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio | 2e-12 | |
| d2hyda1 | 255 | c.37.1.12 (A:324-578) Putative multidrug export AT | 3e-12 | |
| d1mv5a_ | 242 | c.37.1.12 (A:) Multidrug resistance ABC transporte | 2e-10 | |
| d2awna2 | 232 | c.37.1.12 (A:4-235) Maltose transport protein MalK | 2e-10 | |
| g1f2t.1 | 292 | c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio | 2e-10 | |
| d1jj7a_ | 251 | c.37.1.12 (A:) Peptide transporter Tap1, C-termina | 2e-09 | |
| d3d31a2 | 229 | c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor | 4e-07 | |
| d1oxxk2 | 242 | c.37.1.12 (K:1-242) Glucose transport protein GlcV | 4e-07 | |
| d2onka1 | 240 | c.37.1.12 (A:1-240) Molybdate/tungstate import ATP | 3e-06 | |
| d1w1wa_ | 427 | c.37.1.12 (A:) Smc head domain {Baker's yeast (Sac | 7e-06 |
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: ABC transporter ATPase domain-like domain: Branched chain aminoacid ABC transporter species: Thermotoga maritima, TM1139 [TaxId: 2336]
Score = 74.9 bits (184), Expect = 4e-19
Identities = 22/70 (31%), Positives = 38/70 (54%)
Query: 2 GLTEYRHRESGRYSGGNKRKLSTAMALIGDPPLVFLDEPTSGVDPISRHRLWAVLSQIQK 61
L E + G SGG ++ L+ AL+ P L+ +DEP+ G+ PI ++ V+ +I +
Sbjct: 128 RLKERLKQLGGTLSGGEQQMLAIGRALMSRPKLLMMDEPSLGLAPILVSEVFEVIQKINQ 187
Query: 62 TGQSIVLTSH 71
G +I+L
Sbjct: 188 EGTTILLVEQ 197
|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 427 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 72 | |||
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 99.97 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 99.97 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 99.97 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 99.97 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 99.97 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 99.97 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 99.96 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 99.96 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 99.96 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 99.96 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 99.96 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 99.96 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 99.95 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 99.94 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 99.94 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 99.94 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 99.93 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 99.93 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 99.91 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 99.91 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 99.81 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 99.67 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 99.43 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 98.85 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 98.83 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 98.21 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 97.82 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 97.58 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 93.6 | |
| d2vgna3 | 104 | Dom34 {Saccharomyces cerevisiae [TaxId: 4932]} | 92.46 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 91.69 | |
| d1x8ha_ | 228 | Zn metallo-beta-lactamase {Aeromonas hydrophila, C | 85.99 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 85.34 | |
| d1x52a1 | 111 | Cell division protein pelota {Human (Homo sapiens) | 84.67 | |
| d1jcea1 | 137 | Prokaryotic actin homolog MreB {Thermotoga maritim | 80.95 | |
| d1th8b_ | 115 | Anti-sigma factor antagonist SpoIIaa {Bacillus ste | 80.88 | |
| d1g5ta_ | 157 | ATP:corrinoid adenosyltransferase CobA {Salmonella | 80.82 | |
| d1mqoa_ | 221 | Zn metallo-beta-lactamase {Bacillus cereus [TaxId: | 80.61 | |
| d1znba_ | 230 | Zn metallo-beta-lactamase {Bacteroides fragilis [T | 80.53 |
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: ABC transporter ATPase domain-like domain: Maltose transport protein MalK, N-terminal domain species: Archaeon Thermococcus litoralis [TaxId: 2265]
Probab=99.97 E-value=3.3e-31 Score=163.45 Aligned_cols=72 Identities=31% Similarity=0.595 Sum_probs=68.8
Q ss_pred CCCcchhcCcCCCCChHHHHHHHHHHHHhcCCCEEEEeCCCCCCCHHHHHHHHHHHHHHHhC-CceEEEEecC
Q psy858 1 MGLTEYRHRESGRYSGGNKRKLSTAMALIGDPPLVFLDEPTSGVDPISRHRLWAVLSQIQKT-GQSIVLTSHR 72 (72)
Q Consensus 1 ~~l~~~~~~~~~~lS~G~~qr~~ia~~l~~~p~~lllDEP~~gld~~~~~~i~~~l~~~~~~-g~til~~~h~ 72 (72)
+++.+..++++.+||||||||++|||||+.+|+++|+||||+|||+..+..+++.++++.++ |.|||++|||
T Consensus 127 ~~l~~~~~~~p~~LSGGqkQRv~IAraL~~~P~iLllDEPt~~LD~~~~~~i~~~l~~l~~~~g~tvi~vTHd 199 (240)
T d1g2912 127 LGLTELLNRKPRELSGGQRQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKLQRQLGVTTIYVTHD 199 (240)
T ss_dssp HTCGGGTTCCGGGSCHHHHHHHHHHHHHHTCCSEEEEECTTTTSCHHHHHHHHHHHHHHHHHHTCEEEEEESC
T ss_pred cCChhHhcCChhhCCHHHHHHHHHHHHHhcCCCEEEecCCCcccCHHHHHHHHHHHHHHHhccCCEEEEEcCC
Confidence 36788999999999999999999999999999999999999999999999999999999766 9999999997
|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2vgna3 d.79.3.2 (A:278-381) Dom34 {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1x8ha_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Aeromonas hydrophila, CphA [TaxId: 644]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1x52a1 d.79.3.2 (A:8-118) Cell division protein pelota {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1th8b_ c.13.2.1 (B:) Anti-sigma factor antagonist SpoIIaa {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1mqoa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1znba_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacteroides fragilis [TaxId: 817]} | Back information, alignment and structure |
|---|