Psyllid ID: psy8681


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-
VKNKAPAEIQITAEQLLREAKERDLEIVPPVEEGWEEVFDYIFPEDEAAKPNLKLLEKAKAWKKAMEEKQGNKIGEEGANKENEEEERDKERDREEEDERKDEGDRDSDTTYGMRELVFEEQNGFVSGARKVYERAVEFFGEENLDEKLFIAFAKFEEGQREKYGDRAGIEDVIVSKRKFQYEEHERARVIYKYALDHIPKDRTAEIYKAYTIHEKKYGDRAGIEDVIVSKRKFQYEEEVNSNPNNYDAWFDYLRLLEDEGNADLIRETYERAIANIPPTKFAELESLLGDMERARAIYELAISQPRLDMPELVWKAYIDFEVGQGERDKVRELHERLLERTVHVKVWMNYAQFEMSSGDEDSVSLARRVFERANQALKASSEKEERVMLLEAWKEFEAQHGDDESRAKLNSKLPRRAKKRVKTYNDEGVEEGWEEVFDYIFPEDEAAKPNLKLLEKAKAWKKAMEEKQGNKIGEEGANKENEEEERDKERDREEEDEKKDERDRDSDDERDDREEDSINV
cccccccHHcccHHHHHHHHHHccccccccccccHHHHHcccccHHHHccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcHHHHHHHHHcccccccccHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHccHHHHccccHHcccccccHHHHHcccccc
cccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcEEEEEEccccccccHHHHHHcccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHcccccEEEEEcccccccccccEEEccc
VKNKAPAEIQITAEQLLREAKerdleivppveegwEEVFDYifpedeaakPNLKLLEKAKAWKKAMEEKqgnkigeegankeneeeerdkerdreeederkdegdrdsdttyGMRELVFEEQNGFVSGARKVYERAVEFFGEENLDEKLFIAFAKFEegqrekygdragiEDVIVSKRKFQYEEHERARVIYKYALDHIPKDRTAEIYKAYTIHekkygdragiEDVIVSKRKFQYEeevnsnpnnydAWFDYLRLLEDEGNADLIRETYERAianipptkFAELESLLGDMERARAIYELAIsqprldmpELVWKAYIDFEVGQGERDKVRELHERLLERTVHVKVWMNYAQFemssgdedSVSLARRVFERANQALKASSEKEERVMLLEAWKEFeaqhgddesRAKLNSKLPRRAKKRVKTyndegveeGWEEVFDYifpedeaakPNLKLLEKAKAWKKAMEEKqgnkigeegankeneeeerdkerdreeedekkderdrdsdderddreedsinv
vknkapaeiqITAEQLLREAKERDLEIVPPVEEGWEEVFDYIFPEDEAAKPNLKLLEKAKAWKKAMEekqgnkigeegankeneeeerdkerdreeederkdegdrdsdttygMRELVfeeqngfvsGARKVYERAVEFFGEENLDEKLFIAFAKFeegqrekygdragiedvivskrkfqyeeheRARVIYKyaldhipkdrTAEIYKAYTihekkygdragiEDVIVSKRKFQyeeevnsnpnnyDAWFDYLRLLEDEGNADLIRETYEraianipptKFAELESLLGDMERARAIYELAisqprldmpELVWKAYIDFEVGQGERDKVRELHERLLERTVHVKVWMNYAQFEMSSGDEDSVSLARRVFERANqalkassekeERVMLLEAWKEfeaqhgddesraklnsklprrakkrvktyndegveegWEEVFDYIFPEDEAAKPNLKLLEKAKAWKKAMEekqgnkigeegankeneeeerdkerdreeedekkderdrdsdderddreedsinv
VKNKAPAEIQITAEQLLREAKERDLEIVPPVEEGWEEVFDYIFPEDEAAKPNlkllekakawkkameekQGNKIgeegankeneeeerdkerdreeederkdegdrdSDTTYGMRELVFEEQNGFVSGARKVYERAVEFFGEENLDEKLFIAFAKFEEGQREKYGDRAGIEDVIVSKRKFQYEEHERARVIYKYALDHIPKDRTAEIYKAYTIHEKKYGDRAGIEDVIVSKRKFQYEEEVNSNPNNYDAWFDYLRLLEDEGNADLIRETYERAIANIPPTKFAELESLLGDMERARAIYELAISQPRLDMPELVWKAYIDFEVGQGERDKVRELHERLLERTVHVKVWMNYAQFEMSSGDEDSVSLARRVFERANQALKASSEKEERVMLLEAWKEFEAQHGDDESRAKLNSKLPRRAKKRVKTYNDEGVEEGWEEVFDYIFPEDEAAKPNlkllekakawkkameekQGNKIGEEGAnkeneeeerdkerdreeedekkderdrdsdderddreedsINV
************************LEIVPPVEEGWEEVFDYIFPE*******************************************************************GMRELVFEEQNGFVSGARKVYERAVEFFGEENLDEKLFIAFAKFEEGQREKYGDRAGIEDVIVSKRKFQYEEHERARVIYKYALDHIPKDRTAEIYKAYTIHEKKYGDRAGIEDVIVSKRKFQYEEEVNSNPNNYDAWFDYLRLLEDEGNADLIRETYERAIANIPPTKFAELESLLGDMERARAIYELAISQPRLDMPELVWKAYIDFEVGQGERDKVRELHERLLERTVHVKVWMNYAQFE*************************************************************************GVEEGWEEVFDYIFPE*****************************************************************************
VKNKAPAEIQITAEQLLREAKERDLEIVPPVEEGWEEVFDYIFPEDEAAKPNLKLLEKAKAWKKAMEEKQGNKIGEEGANKENEEEERDKERDREEEDERKDEGDRDSDTTYGMRELVFEEQNGFVSGARKVYERAVEFFGEENLDEKLFIAFAKFEEGQREKYGDRAGIEDVIVSKRKFQYEEHERARVIYKYALDHIPKDRTAEIYKAYTIHEKKYGDRAGIEDVIVSKRKFQYEEEVNSNPNNYDAWFDYLRLLEDEGNADLIRETYERAIANIPPTKFAELESLLGDMERARAIYELAISQPRLDMPELVWKAYIDFEVGQGERDKVRELHERLLERTVHVKVWMNYAQFEMSSGDEDSVSLARRVFERANQALKASSEKEERVMLLEAWKEFEAQHGDDESRAKLNSKLPRRAKKRVKTYNDEGVEEGWEEVFDYIFPEDEA*****KL*******************************************************************
VKNKAPAEIQITAEQLLREAKERDLEIVPPVEEGWEEVFDYIFPEDEAAKPNLKLLEKAKAWKKAMEEKQGNKIGEE*******************************DTTYGMRELVFEEQNGFVSGARKVYERAVEFFGEENLDEKLFIAFAKFEEGQREKYGDRAGIEDVIVSKRKFQYEEHERARVIYKYALDHIPKDRTAEIYKAYTIHEKKYGDRAGIEDVIVSKRKFQYEEEVNSNPNNYDAWFDYLRLLEDEGNADLIRETYERAIANIPPTKFAELESLLGDMERARAIYELAISQPRLDMPELVWKAYIDFEVGQGERDKVRELHERLLERTVHVKVWMNYAQFEMSSGDEDSVSLARRVFERANQALKASSEKEERVMLLEAWKEFEAQHGDDESRAKLNSKLPRRAKKRVKTYNDEGVEEGWEEVFDYIFPEDEAAKPNLKLLEKAKAWKKAMEEKQGNKIGEE*********************************************
***KAPAEIQITAEQLLREAKERDLEIVPPVEEGWEEVFDYIFPEDEAAKPNLKLLEKAKAWKKAMEEKQGNKIGEEGANKENEEEERDKERDREEEDERKDEGDRDSDTTYGMRELVFEEQNGFVSGARKVYERAVEFFGEENLDEKLFIAFAKFEEGQREKYGDRAGIEDVIVSKRKFQYEEHERARVIYKYALDHIPKDRTAEIYKAYTIHEKKYGDRAGIEDVIVSKRKFQYEEEVNSNPNNYDAWFDYLRLLEDEGNADLIRETYERAIANIPPTKFAELESLLGDMERARAIYELAISQPRLDMPELVWKAYIDFEVGQGERDKVRELHERLLERTVHVKVWMNYAQFEMSSGDEDSVSLARRVFERANQALKASSEKEERVMLLEAWKEFEAQHGDDESRAKLNSKLPRRAKKRVKTYNDEGVEEGWEEVFDYIFPEDEAAKPNLKLLEKAKAWKKAMEEKQGNKIGEEGANKENEEEERDKERDREEEDEKKDERDRDSDDERDDREEDS***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VKNKAPAEIQITAEQLLREAKERDLEIVPPVEEGWEEVFDYIFPEDEAAKPNLKLLEKAKAWKKAMEEKQGNKIGxxxxxxxxxxxxxxxxxxxxxxxxxxxxGDRDSDTTYGMRELVFEEQNGFVSGARKVYERAVEFFGEENLDEKLFIAFAKFEEGQREKYGDRAGIEDVIVSKRKFQYEEHERARVIYKYALDHIPKDRTAEIYKAYTIHEKKYGDRAGIEDVIVSKRKFQYEEEVNSNPNNYDAWFDYLRLLEDEGNADLIRETYERAIANIPPTKFAELESLLGDMERARAIYELAISQPRLDMPELVWKAYIDFEVGQGERDKVRELHERLLERTVHVKVWMNYAQFEMSSGDEDSVSLARRVFERANQALKASSEKEERVMLLEAWKEFEAQHGDDESRAKLNSKLPRRAKKRVKTYNDEGVEEGWEEVFDYIFPEDEAAKPNLKLLEKAKAWKKAMEEKQGNKIGxxxxxxxxxxxxxxxxxxxxxxxxxxxxRDRDSDDERDDREEDSINV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query521 2.2.26 [Sep-21-2011]
Q9BZJ0848 Crooked neck-like protein yes N/A 0.673 0.413 0.385 1e-78
P63155690 Crooked neck-like protein yes N/A 0.669 0.505 0.386 1e-77
P63154690 Crooked neck-like protein yes N/A 0.669 0.505 0.386 1e-77
P17886702 Protein crooked neck OS=D yes N/A 0.612 0.454 0.400 1e-76
Q4WT84676 Pre-mRNA-splicing factor yes N/A 0.652 0.502 0.350 3e-52
Q5BDX1673 Pre-mRNA-splicing factor yes N/A 0.652 0.505 0.341 2e-51
Q54XP4705 Crooked neck-like protein yes N/A 0.642 0.475 0.320 1e-49
Q7SGD2695 Pre-mRNA-splicing factor N/A N/A 0.652 0.489 0.313 4e-45
Q5K654677 Pre-mRNA-splicing factor N/A N/A 0.443 0.341 0.391 2e-42
P0CO10726 Pre-mRNA-splicing factor yes N/A 0.476 0.341 0.382 1e-40
>sp|Q9BZJ0|CRNL1_HUMAN Crooked neck-like protein 1 OS=Homo sapiens GN=CRNKL1 PE=1 SV=4 Back     alignment and function desciption
 Score =  294 bits (753), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 173/449 (38%), Positives = 242/449 (53%), Gaps = 98/449 (21%)

Query: 119 FEEQNGFVSGARKVYERAVEFFGEENLDEKLFIAFAKFEEGQRE---------------- 162
           FEE++ + + ARKVYERAVEFFG+E++DE L++AFAKFEE Q+E                
Sbjct: 385 FEEKHAYFAHARKVYERAVEFFGDEHMDEHLYVAFAKFEENQKEFERVRVIYKYALDRIS 444

Query: 163 ----------------KYGDRAGIEDVIVSKRKFQYEEHERA------------------ 188
                           K+GDR GIED+IVSKR+FQYEE  +A                  
Sbjct: 445 KQDAQELFKNYTIFEKKFGDRRGIEDIIVSKRRFQYEEEVKANPHNYDAWFDYLRLVESD 504

Query: 189 ------RVIYKYALDHIPKDRTAEIYKAYTIHEKKYGDRAGIEDVIVSKRKFQYEEEVNS 242
                 R +Y+ A+ ++P  +    +K Y      Y     +E     + +  Y+  +  
Sbjct: 505 AEAEAVREVYERAIANVPPIQEKRHWKRYIYLWINYALYEELEAKDPERTRQVYQASLEL 564

Query: 243 NPNN----YDAWFDYLRLLEDEGNADLIRETYERAIANIPP------------------- 279
            P+        W  Y +    + N  L R     +I   P                    
Sbjct: 565 IPHKKFTFAKMWILYAQFEIRQKNLSLARRALGTSIGKCPKNKLFKVYIELELQLREFDR 624

Query: 280 -------------------TKFAELESLLGDMERARAIYELAISQPRLDMPELVWKAYID 320
                               KFAELE++LGD++RARAIYELAISQPRLDMPE++WK+YID
Sbjct: 625 CRKLYEKFLEFGPENCTSWIKFAELETILGDIDRARAIYELAISQPRLDMPEVLWKSYID 684

Query: 321 FEVGQGERDKVRELHERLLERTVHVKVWMNYAQFEMSSGDEDSVSLARRVFERANQALKA 380
           FE+ Q E ++ R L+ RLL+RT HVKVW+++AQFE+SSG E S++  R+++E AN+ ++ 
Sbjct: 685 FEIEQEETERTRNLYRRLLQRTQHVKVWISFAQFELSSGKEGSLTKCRQIYEEANKTMRN 744

Query: 381 SSEKEERVMLLEAWKEFEAQHGDDESRAKLNSKLPRRAKKRVKTYNDEGVEEGWEEVFDY 440
             EKEER+MLLE+W+ FE + G    + +++  +P + KKR K   D+G + GWEE FDY
Sbjct: 745 CEEKEERLMLLESWRSFEEEFGTASDKERVDKLMPEKVKKRRKVQTDDGSDAGWEEYFDY 804

Query: 441 IFPEDEAAKPNLKLLEKAKAWKKAMEEKQ 469
           IFPED A +PNLKLL  AK WKK  +EK+
Sbjct: 805 IFPEDAANQPNLKLLAMAKLWKKQQQEKE 833




Involved in pre-mRNA splicing process.
Homo sapiens (taxid: 9606)
>sp|P63155|CRNL1_RAT Crooked neck-like protein 1 OS=Rattus norvegicus GN=Crnkl1 PE=2 SV=1 Back     alignment and function description
>sp|P63154|CRNL1_MOUSE Crooked neck-like protein 1 OS=Mus musculus GN=Crnkl1 PE=2 SV=1 Back     alignment and function description
>sp|P17886|CRN_DROME Protein crooked neck OS=Drosophila melanogaster GN=crn PE=2 SV=2 Back     alignment and function description
>sp|Q4WT84|CLF1_ASPFU Pre-mRNA-splicing factor clf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=clf1 PE=3 SV=1 Back     alignment and function description
>sp|Q5BDX1|CLF1_EMENI Pre-mRNA-splicing factor clf1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=clf1 PE=3 SV=2 Back     alignment and function description
>sp|Q54XP4|CRNL1_DICDI Crooked neck-like protein 1 OS=Dictyostelium discoideum GN=crnkl1 PE=3 SV=1 Back     alignment and function description
>sp|Q7SGD2|CLF1_NEUCR Pre-mRNA-splicing factor clf-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=clf-1 PE=3 SV=1 Back     alignment and function description
>sp|Q5K654|CLF1_PARBR Pre-mRNA-splicing factor CLF1 OS=Paracoccidioides brasiliensis GN=CLF1 PE=3 SV=1 Back     alignment and function description
>sp|P0CO10|CLF1_CRYNJ Pre-mRNA-splicing factor CLF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CLF1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query521
357614027536 hypothetical protein KGM_05790 [Danaus p 0.637 0.619 0.516 1e-104
157123075 691 crooked neck protein [Aedes aegypti] gi| 0.662 0.499 0.447 7e-91
91094535 671 PREDICTED: similar to AGAP001879-PA [Tri 0.662 0.514 0.433 3e-87
312380118 698 hypothetical protein AND_07846 [Anophele 0.662 0.494 0.434 2e-86
347966738 720 AGAP001879-PA [Anopheles gambiae str. PE 0.662 0.479 0.428 1e-85
241730155583 crooked neck protein, putative [Ixodes s 0.882 0.789 0.388 2e-85
449671984 647 PREDICTED: crooked neck-like protein 1 [ 0.639 0.514 0.429 9e-83
156549704 686 PREDICTED: protein crooked neck-like [Na 0.677 0.514 0.403 1e-80
431894127 701 Crooked neck-like protein 1 [Pteropus al 0.698 0.519 0.402 3e-78
326914759 686 PREDICTED: crooked neck-like protein 1-l 0.669 0.508 0.397 3e-78
>gi|357614027|gb|EHJ68863.1| hypothetical protein KGM_05790 [Danaus plexippus] Back     alignment and taxonomy information
 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 207/401 (51%), Positives = 267/401 (66%), Gaps = 69/401 (17%)

Query: 109 DTTYGMRELVFEEQNGFVSGARKVYERAVEFFGEENLDEKLFIAFAKFEEGQREKYGDRA 168
           D  + ++   FEE +GF++ ARK++ERAVEFFG+E LDE+LFIAFAKFEE Q+E      
Sbjct: 203 DVKHWIKYAKFEENHGFINSARKIFERAVEFFGDEELDERLFIAFAKFEENQKE------ 256

Query: 169 GIEDVIVSKRKFQYEEHERARVIYKYALDHIPKDRTAEIYKAYTIHEKKYGDRAGIEDVI 228
                           H+RARVIYKYALDHIPKDR  E+YKAYTIHEKKYGDR+GIEDVI
Sbjct: 257 ----------------HDRARVIYKYALDHIPKDRNKELYKAYTIHEKKYGDRSGIEDVI 300

Query: 229 VSKRKFQYEEEVNSNPNNYDAWFDYLRLLEDEGNADLIRETYERAIANIPPTKFAELESL 288
               KF     +   P N   W                              KFAELE+L
Sbjct: 301 ----KF-----LEYGPENCVTWI-----------------------------KFAELETL 322

Query: 289 LGDMERARAIYELAISQPRLDMPELVWKAYIDFEVGQGERDKVRELHERLLERTVHVKVW 348
           LGD++RARAIYE+A+ QPRLDMPEL+WK+YIDFEV Q E DK R+L+ERLLERTVHVKVW
Sbjct: 323 LGDIDRARAIYEIAVGQPRLDMPELLWKSYIDFEVAQSETDKARQLYERLLERTVHVKVW 382

Query: 349 MNYAQFEMSSGDEDSVS--LARRVFERANQALKASSEKEERVMLLEAWKEFEAQHGDDES 406
           ++YA+FE+++ + D+++  LARRV+ERAN++LK++ EKE RV+LLEAWKEFE +  D E 
Sbjct: 383 LSYAKFELNAENPDNINTELARRVYERANESLKSAGEKESRVLLLEAWKEFETEIDDKEK 442

Query: 407 RAKLNSKLPRRAKKRVKTYNDEGVEEGWEEVFDYIFPEDEAAKPNLKLLEKAKAWKKAME 466
             K+ +K+PRR KKR K  ++ G+EEGWEEVFDYIFPEDE  +PNLKLL  AK W+K   
Sbjct: 443 LEKVLAKMPRRVKKRQKIISEAGIEEGWEEVFDYIFPEDEMVRPNLKLLAAAKNWRK--- 499

Query: 467 EKQGNKIGEEGANKENEEEERDKERDREEEDEKKDERDRDS 507
                ++  + +  E+ +E+     D +EED  K+  + +S
Sbjct: 500 ----KQVVPDNSETESNDEQDKNSGDTQEEDPSKESANEES 536




Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|157123075|ref|XP_001653815.1| crooked neck protein [Aedes aegypti] gi|108874541|gb|EAT38766.1| AAEL009383-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|91094535|ref|XP_972454.1| PREDICTED: similar to AGAP001879-PA [Tribolium castaneum] gi|270000758|gb|EEZ97205.1| hypothetical protein TcasGA2_TC004395 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|312380118|gb|EFR26202.1| hypothetical protein AND_07846 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|347966738|ref|XP_321188.4| AGAP001879-PA [Anopheles gambiae str. PEST] gi|333469921|gb|EAA01065.4| AGAP001879-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|241730155|ref|XP_002412275.1| crooked neck protein, putative [Ixodes scapularis] gi|215505514|gb|EEC15008.1| crooked neck protein, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|449671984|ref|XP_002165886.2| PREDICTED: crooked neck-like protein 1 [Hydra magnipapillata] Back     alignment and taxonomy information
>gi|156549704|ref|XP_001605480.1| PREDICTED: protein crooked neck-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|431894127|gb|ELK03927.1| Crooked neck-like protein 1 [Pteropus alecto] Back     alignment and taxonomy information
>gi|326914759|ref|XP_003203690.1| PREDICTED: crooked neck-like protein 1-like [Meleagris gallopavo] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query521
TAIR|locus:2161363673 AT5G45990 [Arabidopsis thalian 0.351 0.271 0.476 9.4e-86
UNIPROTKB|F1P3Q8704 CRNKL1 "Uncharacterized protei 0.506 0.375 0.432 2.2e-84
UNIPROTKB|F1PYE9797 CRNKL1 "Uncharacterized protei 0.510 0.333 0.420 3.1e-81
ASPGD|ASPL0000053069673 AN1259 [Emericella nidulans (t 0.345 0.267 0.487 4.9e-80
FB|FBgn0000377702 crn "crooked neck" [Drosophila 0.512 0.380 0.475 5.3e-71
UNIPROTKB|F1MZT2781 CRNKL1 "Uncharacterized protei 0.506 0.338 0.425 8.7e-67
MGI|MGI:1914127690 Crnkl1 "Crn, crooked neck-like 0.506 0.382 0.425 1.8e-66
RGD|620507690 Crnkl1 "crooked neck pre-mRNA 0.506 0.382 0.425 1.8e-66
UNIPROTKB|Q5JY65836 CRNKL1 "Crooked neck-like prot 0.506 0.315 0.425 1.9e-66
UNIPROTKB|Q9BZJ0848 CRNKL1 "Crooked neck-like prot 0.506 0.311 0.425 2.6e-66
TAIR|locus:2161363 AT5G45990 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 431 (156.8 bits), Expect = 9.4e-86, Sum P(3) = 9.4e-86
 Identities = 92/193 (47%), Positives = 125/193 (64%)

Query:   262 NADLIRETYERAIANIPPT-----KFAELESLLGDMERARAIYELAISQPRLDMPELVWK 316
             N D  R+ YER +   P        +AE E  L + ERARAI+ELAISQP LDMPEL+WK
Sbjct:   458 NIDRCRKLYERFLEWSPENCYAWRNYAEFEISLAETERARAIFELAISQPALDMPELLWK 517

Query:   317 AYIDFEVGQGERDKVRELHERLLERTVHVKVWMNYAQFEMSSGD--EDSVSLARRVFERA 374
              YIDFE+ +GE +K R L+ERLL+RT H KVW+++A+FE S+ +  ED +  AR +F+RA
Sbjct:   518 TYIDFEISEGEFEKTRALYERLLDRTKHCKVWISFAKFEASASEHKEDGIKSARVIFDRA 577

Query:   375 NQALKASSEK--EERVMLLEAWKEFEAQHGDDESRAKLNSKLPRRAKKRVKTYNDEGVEE 432
             N   K ++ +  EER  LLE W   E   G+    + + SKLP++ KKR  T  ++G  E
Sbjct:   578 NTYYKDTTPELEEERATLLEDWLNMETGFGELGDVSVVQSKLPKKLKKRKMTSREDGSTE 637

Query:   433 GWEEVFDYIFPED 445
              +EE FDY+FPE+
Sbjct:   638 -YEEYFDYLFPEE 649


GO:0005622 "intracellular" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;IEA
GO:0006396 "RNA processing" evidence=IEA;ISS
GO:0006397 "mRNA processing" evidence=IEA
UNIPROTKB|F1P3Q8 CRNKL1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PYE9 CRNKL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ASPGD|ASPL0000053069 AN1259 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
FB|FBgn0000377 crn "crooked neck" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1MZT2 CRNKL1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1914127 Crnkl1 "Crn, crooked neck-like 1 (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620507 Crnkl1 "crooked neck pre-mRNA splicing factor-like 1 (Drosophila)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5JY65 CRNKL1 "Crooked neck-like protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BZJ0 CRNKL1 "Crooked neck-like protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query521
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 0.002
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
 Score = 40.4 bits (94), Expect = 0.002
 Identities = 34/159 (21%), Positives = 65/159 (40%), Gaps = 16/159 (10%)

Query: 359 GDEDSVSL-ARRVFERANQALKASSEKEERVMLLEAWKEFEAQ-------HGDDESRAKL 410
            DE       +   E      +   E E      E   E E Q        GD+ +  K+
Sbjct: 742 EDEGEGEAEGKHEVETEGDRKETEHEGETEAEGKEDEDEGEIQAGEDGEMKGDEGAEGKV 801

Query: 411 NSKLPRRAKKRVKTYNDEGVEEGWEEVFDYIFPEDEAAKPNLKLLEKAKAWKKAMEEKQG 470
             +    A ++ +       +    EV D    E    + N +   +AK  +K ++   G
Sbjct: 802 EHEGETEAGEKDEHEGQSETQADDTEVKD----ETGEQELNAENQGEAKQDEKGVDGGGG 857

Query: 471 NKIGEEGANKENEEEERDKERDREEEDEKKDERDRDSDD 509
           +    +G + E EEEE ++E + EEE+E+++E + ++++
Sbjct: 858 S----DGGDSEEEEEEEEEEEEEEEEEEEEEEEEEENEE 892


[Transport and binding proteins, Cations and iron carrying compounds]. Length = 1096

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 521
KOG1915|consensus677 100.0
KOG0495|consensus913 100.0
KOG1915|consensus677 100.0
KOG0495|consensus913 99.96
KOG2047|consensus835 99.93
KOG2047|consensus835 99.93
KOG4626|consensus 966 99.87
KOG1914|consensus656 99.87
KOG1070|consensus1710 99.83
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.83
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.81
KOG4626|consensus 966 99.81
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.81
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.81
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.79
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.79
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.79
PRK11788389 tetratricopeptide repeat protein; Provisional 99.76
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 99.75
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.74
PRK11788389 tetratricopeptide repeat protein; Provisional 99.72
KOG1258|consensus577 99.71
PLN03218 1060 maturation of RBCL 1; Provisional 99.69
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.69
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.68
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.67
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.66
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.66
PLN03077857 Protein ECB2; Provisional 99.65
PLN03218 1060 maturation of RBCL 1; Provisional 99.64
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.63
PLN03077857 Protein ECB2; Provisional 99.62
KOG1070|consensus1710 99.62
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.61
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.59
KOG1258|consensus577 99.59
KOG1914|consensus656 99.57
KOG2396|consensus568 99.57
KOG1126|consensus638 99.55
KOG2076|consensus 895 99.54
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.53
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.53
KOG1155|consensus559 99.52
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.51
PRK12370553 invasion protein regulator; Provisional 99.51
KOG2002|consensus 1018 99.48
PRK11189296 lipoprotein NlpI; Provisional 99.47
KOG1126|consensus638 99.47
PRK12370553 invasion protein regulator; Provisional 99.46
KOG0547|consensus606 99.46
KOG0547|consensus606 99.43
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.42
KOG1173|consensus611 99.42
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 99.41
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.41
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.39
KOG0128|consensus 881 99.38
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 99.38
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.37
PRK11189296 lipoprotein NlpI; Provisional 99.36
PRK14574 822 hmsH outer membrane protein; Provisional 99.36
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.34
KOG1155|consensus559 99.34
PRK14574 822 hmsH outer membrane protein; Provisional 99.32
KOG1125|consensus579 99.29
KOG2076|consensus 895 99.28
KOG1129|consensus478 99.23
KOG2002|consensus 1018 99.21
KOG1174|consensus564 99.21
KOG2396|consensus 568 99.2
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.19
KOG1125|consensus579 99.17
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 99.15
KOG0128|consensus 881 99.14
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.07
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.06
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.04
KOG1156|consensus 700 99.04
KOG1173|consensus611 99.03
KOG0624|consensus504 99.02
KOG1840|consensus508 99.01
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.92
KOG1129|consensus478 98.9
PLN02789320 farnesyltranstransferase 98.9
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.89
KOG1174|consensus564 98.86
KOG2003|consensus840 98.84
KOG2003|consensus840 98.83
PRK15359144 type III secretion system chaperone protein SscB; 98.83
PLN02789320 farnesyltranstransferase 98.82
KOG1127|consensus 1238 98.81
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.81
KOG1840|consensus508 98.8
PRK10370198 formate-dependent nitrite reductase complex subuni 98.8
KOG0548|consensus539 98.79
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.79
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.78
PRK10370198 formate-dependent nitrite reductase complex subuni 98.77
KOG4162|consensus799 98.76
KOG3060|consensus289 98.76
PRK15359144 type III secretion system chaperone protein SscB; 98.76
KOG2376|consensus652 98.76
KOG1156|consensus 700 98.74
KOG3060|consensus289 98.74
KOG4162|consensus799 98.69
KOG3617|consensus 1416 98.67
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.63
KOG0624|consensus504 98.6
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.59
KOG1128|consensus777 98.57
KOG1128|consensus777 98.56
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.51
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.5
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.5
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 98.49
KOG1127|consensus 1238 98.49
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 98.44
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.43
KOG0548|consensus539 98.38
KOG0550|consensus486 98.37
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.33
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.28
KOG3617|consensus1416 98.26
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.25
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.19
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.18
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.16
PRK04841903 transcriptional regulator MalT; Provisional 98.15
PRK04841903 transcriptional regulator MalT; Provisional 98.15
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.14
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.09
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.08
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.06
PRK11906458 transcriptional regulator; Provisional 98.03
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.03
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.03
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.02
KOG0553|consensus304 98.01
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.97
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.97
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.94
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.91
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.89
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.88
KOG2376|consensus652 97.88
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.85
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.84
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.84
PF0218432 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 97.84
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.83
KOG0553|consensus304 97.81
COG5191 435 Uncharacterized conserved protein, contains HAT (H 97.8
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.8
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.79
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.79
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.75
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.75
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.74
PRK10803263 tol-pal system protein YbgF; Provisional 97.74
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.73
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.71
PF0218432 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 97.69
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.67
PF08311126 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro 97.63
PRK10803263 tol-pal system protein YbgF; Provisional 97.61
KOG0550|consensus486 97.61
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.61
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.6
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.59
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.58
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.57
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.53
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.51
COG3898531 Uncharacterized membrane-bound protein [Function u 97.48
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.41
COG5191435 Uncharacterized conserved protein, contains HAT (H 97.37
PRK11906458 transcriptional regulator; Provisional 97.37
COG3898531 Uncharacterized membrane-bound protein [Function u 97.35
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.35
PF1337173 TPR_9: Tetratricopeptide repeat 97.33
KOG0543|consensus397 97.24
PF1343134 TPR_17: Tetratricopeptide repeat 97.19
KOG2053|consensus 932 97.17
COG4700251 Uncharacterized protein conserved in bacteria cont 97.16
PF1337173 TPR_9: Tetratricopeptide repeat 97.15
PF12688120 TPR_5: Tetratrico peptide repeat 97.12
PRK15331165 chaperone protein SicA; Provisional 97.08
KOG3785|consensus557 97.06
PF1342844 TPR_14: Tetratricopeptide repeat 96.99
PRK15331165 chaperone protein SicA; Provisional 96.93
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.92
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.92
PF12688120 TPR_5: Tetratrico peptide repeat 96.91
COG4700251 Uncharacterized protein conserved in bacteria cont 96.89
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.87
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 96.79
KOG1585|consensus308 96.78
PF08311126 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro 96.73
PF06552186 TOM20_plant: Plant specific mitochondrial import r 96.71
PF1342844 TPR_14: Tetratricopeptide repeat 96.7
KOG0543|consensus397 96.7
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.63
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 96.58
KOG3785|consensus 557 96.42
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 96.37
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.32
KOG3616|consensus 1636 96.23
PF13512142 TPR_18: Tetratricopeptide repeat 96.16
KOG1586|consensus288 96.13
PF13512142 TPR_18: Tetratricopeptide repeat 96.1
COG4105254 ComL DNA uptake lipoprotein [General function pred 96.07
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 96.05
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.04
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.0
KOG2053|consensus 932 95.97
PF06552186 TOM20_plant: Plant specific mitochondrial import r 95.9
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 95.89
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.89
KOG3616|consensus 1636 95.79
KOG4555|consensus175 95.78
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.76
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.7
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 95.7
smart00777125 Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region 95.62
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 95.57
KOG4340|consensus459 95.46
KOG3081|consensus299 95.44
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 95.44
KOG4340|consensus459 95.33
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.33
KOG3081|consensus299 95.26
KOG4234|consensus271 95.22
KOG4555|consensus175 95.21
COG4105254 ComL DNA uptake lipoprotein [General function pred 95.12
KOG1130|consensus 639 95.12
smart00777125 Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region 95.1
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 95.02
KOG0890|consensus 2382 94.81
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 94.78
COG3118304 Thioredoxin domain-containing protein [Posttransla 94.65
KOG4234|consensus271 94.26
KOG2422|consensus665 94.21
PF1343134 TPR_17: Tetratricopeptide repeat 93.7
KOG4648|consensus536 93.69
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 93.28
KOG4648|consensus536 93.28
KOG0985|consensus 1666 92.87
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 92.59
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 92.56
KOG4642|consensus284 92.54
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 92.35
COG3118304 Thioredoxin domain-containing protein [Posttransla 92.27
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 92.15
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 92.09
KOG2796|consensus366 91.94
KOG4642|consensus284 91.9
KOG1585|consensus308 91.62
KOG4507|consensus886 90.9
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 90.59
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 90.4
KOG4318|consensus1088 90.3
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 90.12
KOG2610|consensus491 90.1
PF1285434 PPR_1: PPR repeat 89.67
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 89.39
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 89.01
PF13281374 DUF4071: Domain of unknown function (DUF4071) 88.85
KOG3824|consensus472 88.61
PF1304150 PPR_2: PPR repeat family 88.53
KOG1464|consensus440 88.46
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 88.38
KOG3824|consensus 472 88.3
COG2976207 Uncharacterized protein conserved in bacteria [Fun 88.23
COG4976287 Predicted methyltransferase (contains TPR repeat) 88.22
KOG0376|consensus 476 88.22
KOG2610|consensus491 87.89
KOG2471|consensus696 87.45
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 87.4
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 86.93
KOG1130|consensus 639 86.66
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 86.39
KOG1308|consensus377 85.23
KOG0545|consensus329 85.13
PF1304150 PPR_2: PPR repeat family 84.95
KOG2041|consensus1189 84.75
COG2976207 Uncharacterized protein conserved in bacteria [Fun 84.4
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 84.13
KOG1586|consensus288 84.08
KOG0890|consensus 2382 83.32
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 82.75
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 82.33
PF1286294 Apc5: Anaphase-promoting complex subunit 5 81.32
KOG0545|consensus329 80.1
>KOG1915|consensus Back     alignment and domain information
Probab=100.00  E-value=1.1e-96  Score=723.05  Aligned_cols=443  Identities=55%  Similarity=0.878  Sum_probs=419.9

Q ss_pred             CCCCCCCcccCCHHHHHHHHHhccccCCCCCCC---CHHHHHhhccCcCcc-----------------------------
Q psy8681           1 VKNKAPAEIQITAEQLLREAKERDLEIVPPVEE---GWEEVFDYIFPEDEA-----------------------------   48 (521)
Q Consensus         1 ~~~~~~~~~qit~~q~l~ea~~~~~~~~~~~~~---d~eel~~~~~~~~~~-----------------------------   48 (521)
                      ||||+|||+|||||||||||++|+....+||.+   |++||.+||+|||+.                             
T Consensus        11 vknktpa~vqItAEQlLRea~er~~~~~~ppk~~ItD~~EL~eYq~RkRkefEd~irrnR~~~~~WikYaqwEesq~e~~   90 (677)
T KOG1915|consen   11 VKNKTPAPVQITAEQLLREARERQLAAPRPPKQKITDSEELSEYQLRKRKEFEDQIRRNRLNMQVWIKYAQWEESQKEIQ   90 (677)
T ss_pred             ccCCCCCcceecHHHHHHHHHHhhcccCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHH
Confidence            899999999999999999999999855544444   999999999999643                             


Q ss_pred             ---------------------------------------CCCchhhhhhH-HHHHH--HHHHhcCChhhhhhhcC-----
Q psy8681          49 ---------------------------------------AKPNLKLLEKA-KAWKK--AMEEKQGNKIGEEGANK-----   81 (521)
Q Consensus        49 ---------------------------------------~~rai~~lP~~-~~W~~--~~e~~~gn~~~Ar~ife-----   81 (521)
                                                             +.|||++|||| ++|||  +||+++||+.+||+||+     
T Consensus        91 RARSv~ERALdvd~r~itLWlkYae~Emknk~vNhARNv~dRAvt~lPRVdqlWyKY~ymEE~LgNi~gaRqiferW~~w  170 (677)
T KOG1915|consen   91 RARSVFERALDVDYRNITLWLKYAEFEMKNKQVNHARNVWDRAVTILPRVDQLWYKYIYMEEMLGNIAGARQIFERWMEW  170 (677)
T ss_pred             HHHHHHHHHHhcccccchHHHHHHHHHHhhhhHhHHHHHHHHHHHhcchHHHHHHHHHHHHHHhcccHHHHHHHHHHHcC
Confidence                                                   44888999999 99999  99999999999999999     


Q ss_pred             CCcH---------HHhcccchhhHHH-HhhhccCCCCChhhHHHHHHHHHHcCChhHHHHHHHHHHHhcCCccccHHHHH
Q psy8681          82 ENEE---------EERDKERDREEED-ERKDEGDRDSDTTYGMRELVFEEQNGFVSGARKVYERAVEFFGEENLDEKLFI  151 (521)
Q Consensus        82 ~P~~---------e~r~g~~e~Ar~~-eral~~~~~P~~~~W~~~a~~e~~~g~~~~Ar~vye~Al~~~~~~~~~~~lw~  151 (521)
                      .|+.         |+|+++++.||.+ +|+|  .+||.+..|+.|+.|++++|++..||.||++|++.++++.....+++
T Consensus       171 ~P~eqaW~sfI~fElRykeieraR~IYerfV--~~HP~v~~wikyarFE~k~g~~~~aR~VyerAie~~~~d~~~e~lfv  248 (677)
T KOG1915|consen  171 EPDEQAWLSFIKFELRYKEIERARSIYERFV--LVHPKVSNWIKYARFEEKHGNVALARSVYERAIEFLGDDEEAEILFV  248 (677)
T ss_pred             CCcHHHHHHHHHHHHHhhHHHHHHHHHHHHh--eecccHHHHHHHHHHHHhcCcHHHHHHHHHHHHHHhhhHHHHHHHHH
Confidence            6876         9999999999999 9999  99999999999999999999999999999999999998777789999


Q ss_pred             HHHHHHHhhhhhccccchhhHHHHHhhhhhhhhHHHHHHHHHHHHhcCChhhHHHHHHHHHHHHHHcCChhhHHHHHHhh
Q psy8681         152 AFAKFEEGQREKYGDRAGIEDVIVSKRKFQYEEHERARVIYKYALDHIPKDRTAEIYKAYTIHEKKYGDRAGIEDVIVSK  231 (521)
Q Consensus       152 ~~a~~e~~~~~~~~~~~~~~~~~l~~~~~~~~~~e~Ar~iy~~aL~~~P~~~~~~l~~~~~~~e~~~G~~~~a~~~i~~k  231 (521)
                      +||.|+.+++                      ++++||.||+.||+++|.+.+..||..|+.||+++|+..+++++|+.|
T Consensus       249 aFA~fEe~qk----------------------E~ERar~iykyAld~~pk~raeeL~k~~~~fEKqfGd~~gIEd~Iv~K  306 (677)
T KOG1915|consen  249 AFAEFEERQK----------------------EYERARFIYKYALDHIPKGRAEELYKKYTAFEKQFGDKEGIEDAIVGK  306 (677)
T ss_pred             HHHHHHHHHH----------------------HHHHHHHHHHHHHHhcCcccHHHHHHHHHHHHHHhcchhhhHHHHhhh
Confidence            9999999999                      999999999999999999988899999999999999999999999999


Q ss_pred             HHHHHHHHHhhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHcCCchh------------------------------
Q psy8681         232 RKFQYEEEVNSNPNNYDAWFDYLRLLEDEGNADLIRETYERAIANIPPTK------------------------------  281 (521)
Q Consensus       232 rr~~ye~al~~~P~~~~~W~~y~~~~~~~g~~~~Ar~~~erAl~~~P~~~------------------------------  281 (521)
                      |+.+|+..+..||.|+++|++|+++....|+.++++++|++||.++|+..                              
T Consensus       307 Rk~qYE~~v~~np~nYDsWfdylrL~e~~g~~~~Ire~yErAIanvpp~~ekr~W~RYIYLWinYalyeEle~ed~ertr  386 (677)
T KOG1915|consen  307 RKFQYEKEVSKNPYNYDSWFDYLRLEESVGDKDRIRETYERAIANVPPASEKRYWRRYIYLWINYALYEELEAEDVERTR  386 (677)
T ss_pred             hhhHHHHHHHhCCCCchHHHHHHHHHHhcCCHHHHHHHHHHHHccCCchhHHHHHHHHHHHHHHHHHHHHHHhhhHHHHH
Confidence            99999999999999999999999999999999999999999999999855                              


Q ss_pred             --------------------------------------------------------------------------------
Q psy8681         282 --------------------------------------------------------------------------------  281 (521)
Q Consensus       282 --------------------------------------------------------------------------------  281 (521)
                                                                                                      
T Consensus       387 ~vyq~~l~lIPHkkFtFaKiWlmyA~feIRq~~l~~ARkiLG~AIG~cPK~KlFk~YIelElqL~efDRcRkLYEkfle~  466 (677)
T KOG1915|consen  387 QVYQACLDLIPHKKFTFAKIWLMYAQFEIRQLNLTGARKILGNAIGKCPKDKLFKGYIELELQLREFDRCRKLYEKFLEF  466 (677)
T ss_pred             HHHHHHHhhcCcccchHHHHHHHHHHHHHHHcccHHHHHHHHHHhccCCchhHHHHHHHHHHHHhhHHHHHHHHHHHHhc
Confidence                                                                                            


Q ss_pred             ----------HHHHHHHcCCHHHHHHHHHHHHcCCCCCCcHHHHHHHHHHHHhcCChHHHHHHHHHHHhcCCCHHHHHHH
Q psy8681         282 ----------FAELESLLGDMERARAIYELAISQPRLDMPELVWKAYIDFEVGQGERDKVRELHERLLERTVHVKVWMNY  351 (521)
Q Consensus       282 ----------~a~le~~~g~~e~Ar~ife~al~~~~~~~~~~lw~~yi~~e~~~g~~~~Ar~l~eral~~~~~~~vwi~y  351 (521)
                                ||.||..+|+.++||+||+.|+++|..+|+..+|.+||+|++..|++++||.||+++|..++|++||+++
T Consensus       467 ~Pe~c~~W~kyaElE~~LgdtdRaRaifelAi~qp~ldmpellwkaYIdFEi~~~E~ekaR~LYerlL~rt~h~kvWisF  546 (677)
T KOG1915|consen  467 SPENCYAWSKYAELETSLGDTDRARAIFELAISQPALDMPELLWKAYIDFEIEEGEFEKARALYERLLDRTQHVKVWISF  546 (677)
T ss_pred             ChHhhHHHHHHHHHHHHhhhHHHHHHHHHHHhcCcccccHHHHHHHhhhhhhhcchHHHHHHHHHHHHHhcccchHHHhH
Confidence                      8999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHc--CCch-----------hhHHHHHHHHHHHHHhccchhhHHHHHHHHHHHHHHHHcCCHHHHHHHHhhCchhh
Q psy8681         352 AQFEMSS--GDED-----------SVSLARRVFERANQALKASSEKEERVMLLEAWKEFEAQHGDDESRAKLNSKLPRRA  418 (521)
Q Consensus       352 a~~e~~~--g~~~-----------~~~~AR~vferAl~~~~~~~~~~~~~~l~~~~~~fE~~~G~~~~~~~v~~~~p~~v  418 (521)
                      |.|+.+.  |+++           ++..||.+|++|...+.+.+++++|++|+++|.+||..+|+..+++.|.++||++|
T Consensus       547 A~fe~s~~~~~~~~~~~~~e~~~~~~~~AR~iferAn~~~k~~~~KeeR~~LLEaw~~~E~~~G~~~d~~~V~s~mPk~v  626 (677)
T KOG1915|consen  547 AKFEASASEGQEDEDLAELEITDENIKRARKIFERANTYLKESTPKEERLMLLEAWKNMEETFGTEGDVERVQSKMPKKV  626 (677)
T ss_pred             HHHhccccccccccchhhhhcchhHHHHHHHHHHHHHHHHHhcCcHHHHHHHHHHHHHHHHhcCchhhHHHHHHhccHHH
Confidence            9999954  2222           68999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhcccccCCCCCCeeEEEEeecCCcccCCCcHHHHHHHHHHHHHhHhh
Q psy8681         419 KKRVKTYNDEGVEEGWEEVFDYIFPEDEAAKPNLKLLEKAKAWKKAMEEK  468 (521)
Q Consensus       419 ~krr~~~~~~~~~~~~~e~~d~if~e~~~~~~~~~~~~~a~~w~~~~~~~  468 (521)
                      ||||++..+|| +.+|+||+|||||||..+++|+|||++|++||+++..+
T Consensus       627 KKrr~~~~edG-~~~~EEy~DYiFPed~~~~~~~K~LeaA~kWK~q~~~~  675 (677)
T KOG1915|consen  627 KKRRKIQREDG-DTEYEEYFDYIFPEDASATKNLKILEAAKKWKKQKAKA  675 (677)
T ss_pred             HhhhhhhcccC-chhHHHHHHhcCccccccCcchHHHHHHHHHHHHHHhc
Confidence            99999888888 66899999999999998899999999999999988754



>KOG0495|consensus Back     alignment and domain information
>KOG1915|consensus Back     alignment and domain information
>KOG0495|consensus Back     alignment and domain information
>KOG2047|consensus Back     alignment and domain information
>KOG2047|consensus Back     alignment and domain information
>KOG4626|consensus Back     alignment and domain information
>KOG1914|consensus Back     alignment and domain information
>KOG1070|consensus Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG4626|consensus Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG1258|consensus Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1070|consensus Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1258|consensus Back     alignment and domain information
>KOG1914|consensus Back     alignment and domain information
>KOG2396|consensus Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>KOG1129|consensus Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>KOG1174|consensus Back     alignment and domain information
>KOG2396|consensus Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1156|consensus Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1129|consensus Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1174|consensus Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1127|consensus Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG4162|consensus Back     alignment and domain information
>KOG3060|consensus Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG2376|consensus Back     alignment and domain information
>KOG1156|consensus Back     alignment and domain information
>KOG3060|consensus Back     alignment and domain information
>KOG4162|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1128|consensus Back     alignment and domain information
>KOG1128|consensus Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG1127|consensus Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG2376|consensus Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF02184 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 The HAT (Half A TPR) repeat has a repetitive pattern characterised by three aromatic residues with a conserved spacing Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF02184 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 The HAT (Half A TPR) repeat has a repetitive pattern characterised by three aromatic residues with a conserved spacing Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG2053|consensus Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG3785|consensus Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1585|consensus Back     alignment and domain information
>PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>KOG3785|consensus Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1586|consensus Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2053|consensus Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>KOG4555|consensus Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>smart00777 Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region 1 Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4340|consensus Back     alignment and domain information
>KOG3081|consensus Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG4340|consensus Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG3081|consensus Back     alignment and domain information
>KOG4234|consensus Back     alignment and domain information
>KOG4555|consensus Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1130|consensus Back     alignment and domain information
>smart00777 Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region 1 Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0890|consensus Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4234|consensus Back     alignment and domain information
>KOG2422|consensus Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG4648|consensus Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4648|consensus Back     alignment and domain information
>KOG0985|consensus Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG4642|consensus Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG2796|consensus Back     alignment and domain information
>KOG4642|consensus Back     alignment and domain information
>KOG1585|consensus Back     alignment and domain information
>KOG4507|consensus Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG4318|consensus Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG2610|consensus Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG3824|consensus Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1464|consensus Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG3824|consensus Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG0376|consensus Back     alignment and domain information
>KOG2610|consensus Back     alignment and domain information
>KOG2471|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1130|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1308|consensus Back     alignment and domain information
>KOG0545|consensus Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG1586|consensus Back     alignment and domain information
>KOG0890|consensus Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG0545|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query521
2ooe_A 530 Crystal Structure Of Hat Domain Of Murine Cstf-77 L 2e-04
>pdb|2OOE|A Chain A, Crystal Structure Of Hat Domain Of Murine Cstf-77 Length = 530 Back     alignment and structure

Iteration: 1

Score = 44.3 bits (103), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 31/118 (26%), Positives = 50/118 (42%), Gaps = 32/118 (27%) Query: 237 EEEVNSNPNNYDAWFDYLRLLEDEGNADLIRETYERAIANIPPTKFAELESLLGDMERAR 296 E+++ NP + DAW +R +++ D R+TYER +A P Sbjct: 3 EKKLEENPYDLDAWSILIREAQNQP-IDKARKTYERLVAQFP------------------ 43 Query: 297 AIYELAISQPRLDMPELVWKAYIDFEVGQGERDKVRELHERLLERTVHVKVWMNYAQF 354 S R WK YI+ E+ DKV +L +R L + +H+ +W Y + Sbjct: 44 -------SSGRF------WKLYIEAEIKAKNYDKVEKLFQRCLMKVLHIDLWKCYLSY 88

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query521
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 1e-20
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 4e-18
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 3e-12
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 3e-05
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 3e-18
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 3e-16
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 7e-06
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 1e-17
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 2e-05
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 2e-13
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 2e-11
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 1e-07
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
 Score = 94.2 bits (233), Expect = 1e-20
 Identities = 58/355 (16%), Positives = 124/355 (34%), Gaps = 30/355 (8%)

Query: 63  KKAMEEKQGNKIGEEGANKENEEEERDKERDREEEDERKDEGDRDSDTTYGMRELVFEEQ 122
           KK +E++  + +      KE E   +  +R+      +    +      +  + + +E+ 
Sbjct: 184 KKMIEDRSRDYMNARRVAKEYETVMKGLDRNAPSVPPQNTPQEAQQVDMW-KKYIQWEKS 242

Query: 123 NGFVSGARKVYERAVEFFGEENLDEKLFIAFAKFEEGQREKYGDRAGIEDVIVSKRKFQY 182
           N   +  + +  + V F  E+ L     +        +  +Y +++              
Sbjct: 243 NPLRTEDQTLITKRVMFAYEQCLLV---LGHHPDIWYEAAQYLEQSSKLLAEKGDMNNAK 299

Query: 183 EEHERARVIYKYALDHIPKDRTAEIYKAYTIHEKKYGDRAGIEDVIVSKRKFQYEEEVNS 242
              + A  IY+ A+  + K     +Y AY  +E+       +  +        Y   +  
Sbjct: 300 LFSDEAANIYERAISTLLKKN-MLLYFAYADYEESRMKYEKVHSI--------YNRLLAI 350

Query: 243 NPNNYD-AWFDYLRLLEDEGNADLIRETYERAIANIPPTKFAELES------LLGDMERA 295
              +    +  Y++           R  +++A  +        + +         D   A
Sbjct: 351 EDIDPTLVYIQYMKFARRAEGIKSGRMIFKKAREDARTRHHVYVTAALMEYYCSKDKSVA 410

Query: 296 RAIYELAISQPRLDMPELVWKAYIDFEVGQGERDKVRELHERLLER-----TVHVKVWMN 350
             I+EL + +   D+PE    AYID+     E +  R L ER+L           ++W  
Sbjct: 411 FKIFELGLKKY-GDIPEY-VLAYIDYLSHLNEDNNTRVLFERVLTSGSLPPEKSGEIWAR 468

Query: 351 YAQFEMSSGDEDSVSLARRVFERANQALKASSEKEERVMLLEAWKEFEAQHGDDE 405
           +  FE + GD  S     +V +R   A +   E +E  +L++ +K  +       
Sbjct: 469 FLAFESNIGDLAS---ILKVEKRRFTAFREEYEGKETALLVDRYKFMDLYPCSAS 520


>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query521
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 100.0
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.98
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.97
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.93
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.93
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.92
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.92
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.92
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.92
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.9
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.89
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.89
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.89
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.86
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.86
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.85
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.85
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.85
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.85
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.85
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.84
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.84
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.84
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.84
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.84
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.82
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.82
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.78
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.75
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.75
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.73
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.72
3u4t_A272 TPR repeat-containing protein; structural genomics 99.72
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.71
3u4t_A272 TPR repeat-containing protein; structural genomics 99.71
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.71
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.71
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.67
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.67
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.66
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.66
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.64
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.64
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.64
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.63
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.63
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.63
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.62
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.61
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.61
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.61
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.61
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.61
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.6
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.6
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.6
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.59
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.55
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 99.53
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.5
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.5
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.49
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.48
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.48
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.48
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.46
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.44
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.43
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.42
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.42
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.4
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.39
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.39
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.39
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.37
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.37
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.37
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.34
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.3
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.3
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.29
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.29
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.28
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.28
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.27
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.26
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.26
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.26
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.25
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.24
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.23
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.22
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.21
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.21
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.21
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.2
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.2
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.19
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.18
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.16
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.12
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.1
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.08
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.07
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.06
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.06
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.06
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 99.05
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.04
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.03
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.01
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.98
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 98.97
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.97
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.97
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.96
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.95
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 98.94
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.94
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.93
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.93
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.93
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.92
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.92
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.89
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.85
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.85
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.84
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.83
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.83
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.83
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.82
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.81
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.8
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.76
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.76
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.75
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.74
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.73
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.73
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.72
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.72
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.72
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.72
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.72
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.7
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.7
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.7
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.69
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.69
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.68
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.67
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.64
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.64
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.6
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.59
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.58
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.58
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.58
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.58
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.57
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.57
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.56
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.55
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.53
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.53
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.52
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.52
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.51
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.51
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.5
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.49
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.48
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.47
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 98.46
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.46
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.45
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.45
3k9i_A117 BH0479 protein; putative protein binding protein, 98.42
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.39
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.39
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.39
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.38
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.36
3k9i_A117 BH0479 protein; putative protein binding protein, 98.36
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.36
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.35
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.35
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.34
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.32
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.3
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.27
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.26
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.23
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.22
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.21
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.19
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.19
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.15
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.99
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.97
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.93
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.86
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.85
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.81
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.78
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 97.77
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.7
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.66
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.63
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.61
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.57
4aez_C223 MAD3, mitotic spindle checkpoint component MAD3; c 97.52
2wvi_A164 Mitotic checkpoint serine/threonine-protein kinase 97.38
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.33
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.31
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.17
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.13
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.87
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.83
4a1g_A152 Mitotic checkpoint serine/threonine-protein kinas; 96.83
1klx_A138 Cysteine rich protein B; structural genomics, heli 96.82
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.81
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 96.77
4a1g_A152 Mitotic checkpoint serine/threonine-protein kinas; 96.67
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.31
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.26
2wvi_A164 Mitotic checkpoint serine/threonine-protein kinase 96.16
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.16
4aez_C223 MAD3, mitotic spindle checkpoint component MAD3; c 96.02
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.96
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.58
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 94.66
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 93.93
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 93.63
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 92.99
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 92.82
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 90.45
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 88.07
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 86.98
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 86.74
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 86.61
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 85.79
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 85.69
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 83.42
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 81.74
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 80.98
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 80.57
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
Probab=100.00  E-value=1.6e-31  Score=293.09  Aligned_cols=347  Identities=13%  Similarity=0.108  Sum_probs=245.8

Q ss_pred             CCCchhhhhhH-HHHHH--HHHHhcCChhhhhhhcC-----CCcH----------HHhccc---chhhHHH-HhhhccCC
Q psy8681          49 AKPNLKLLEKA-KAWKK--AMEEKQGNKIGEEGANK-----ENEE----------EERDKE---RDREEED-ERKDEGDR  106 (521)
Q Consensus        49 ~~rai~~lP~~-~~W~~--~~e~~~gn~~~Ar~ife-----~P~~----------e~r~g~---~e~Ar~~-eral~~~~  106 (521)
                      ..++|..+|.+ ..|.+  .++...|++..+|.+|+     .|..          |.+.|+   ++.++.+ +|+|  ..
T Consensus        55 lE~~l~~np~d~~~W~~yi~~~~~~~~~~~aR~vyEraL~~fP~~~~lW~~Yi~~E~~~~~~~~~~~v~~lfeRal--~~  132 (679)
T 4e6h_A           55 LNDMIEEQPTDIFLYVKLLKHHVSLKQWKQVYETFDKLHDRFPLMANIWCMRLSLEFDKMEELDAAVIEPVLARCL--SK  132 (679)
T ss_dssp             HHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTC--CCCHHHHHHHHHHHT--CS
T ss_pred             HHHHHHHCcCCHHHHHHHHHHHHhcCcHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHhhCCcchHHHHHHHHHHHH--Hh
Confidence            45778889999 99999  77778899999999999     5765          778888   9999999 9999  88


Q ss_pred             C---CChhhHHHHHHHHHHcCCh--------hHHHHHHHHHHHhcCC-ccccHHHHHHHHHHHHhhhhhccccchhhHHH
Q psy8681         107 D---SDTTYGMRELVFEEQNGFV--------SGARKVYERAVEFFGE-ENLDEKLFIAFAKFEEGQREKYGDRAGIEDVI  174 (521)
Q Consensus       107 ~---P~~~~W~~~a~~e~~~g~~--------~~Ar~vye~Al~~~~~-~~~~~~lw~~~a~~e~~~~~~~~~~~~~~~~~  174 (521)
                      +   |++.+|..|+.+..+.++.        +.++.+|++|+..+|. ++.+..+|..|+.|+..... ..    -+   
T Consensus       133 ~~~~~sv~LW~~Yl~f~~~~~~~~~~~~~~r~~vr~~FErAl~~vG~~d~~s~~iW~~Yi~f~~~~~~-~~----~~---  204 (679)
T 4e6h_A          133 ELGNNDLSLWLSYITYVRKKNDIITGGEEARNIVIQAFQVVVDKCAIFEPKSIQFWNEYLHFLEHWKP-VN----KF---  204 (679)
T ss_dssp             SSCCCCHHHHHHHHHHHHHHSCSTTTHHHHHHHHHHHHHHHHHHTTTTCSSCHHHHHHHHHHHHTCCC-CS----HH---
T ss_pred             cCCCCCHHHHHHHHHHHHHhcccccccchhHHHHHHHHHHHHHHhCcccccchHHHHHHHHHHHhccc-cC----cH---
Confidence            8   8999999999999887654        4567999999999987 77788999999999864320 00    00   


Q ss_pred             HHhhhhhhhhHHHHHHHHHHHHhcCChhhHHHHHHHHHHHHHHcCCh---------------------------------
Q psy8681         175 VSKRKFQYEEHERARVIYKYALDHIPKDRTAEIYKAYTIHEKKYGDR---------------------------------  221 (521)
Q Consensus       175 l~~~~~~~~~~e~Ar~iy~~aL~~~P~~~~~~l~~~~~~~e~~~G~~---------------------------------  221 (521)
                           ...++++++|.+|+++|. .|......+|..|..|++..+..                                 
T Consensus       205 -----eeq~~~~~~R~iy~raL~-iP~~~~~~~w~~Y~~fe~~~~~~~a~~~~~e~~~~y~~Ar~~~~e~~~~~~~l~r~  278 (679)
T 4e6h_A          205 -----EEQQRVQYIRKLYKTLLC-QPMDCLESMWQRYTQWEQDVNQLTARRHIGELSAQYMNARSLYQDWLNITKGLKRN  278 (679)
T ss_dssp             -----HHHHHHHHHHHHHHHHTT-SCCSSHHHHHHHHHHHHHHHCTTTHHHHHHHHHHHHHHHHHHHHHHHHHTTTCCCC
T ss_pred             -----HHHhHHHHHHHHHHHHHh-CccHHHHHHHHHHHHHHHhcCcchHHHHHHHhhHHHHHHHHHHHHHHHHHHhHhhc
Confidence                 000144555555555553 34433334455554444432210                                 


Q ss_pred             --------------------------------------hhHHHHHHhhH-HHHHHHHHhhCCCCHHHHHHHHHHHHHcCC
Q psy8681         222 --------------------------------------AGIEDVIVSKR-KFQYEEEVNSNPNNYDAWFDYLRLLEDEGN  262 (521)
Q Consensus       222 --------------------------------------~~a~~~i~~kr-r~~ye~al~~~P~~~~~W~~y~~~~~~~g~  262 (521)
                                                            ..+.+.+..+| +..|++||..+|.++++|+.|+.++...|+
T Consensus       279 ~p~~~~~~~~~~~p~~~~~~~~ql~lW~~yi~fEk~~~~~l~~~~~~~Rv~~~Ye~aL~~~p~~~~lW~~ya~~~~~~~~  358 (679)
T 4e6h_A          279 LPITLNQATESNLPKPNEYDVQQLLIWLEWIRWESDNKLELSDDLHKARMTYVYMQAAQHVCFAPEIWFNMANYQGEKNT  358 (679)
T ss_dssp             CCSSSTTCCTTTSCCTTCCCHHHHHHHHHHHHHHHTCTTCCCHHHHHHHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHSC
T ss_pred             cccccccchhccCCCCchhHHHHHHHHHHHHHHHHhCCccccchhhHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHhcCc
Confidence                                                  00000011122 467999999999999999999999999999


Q ss_pred             HHHHH-HHHHHHHHcCCchh-----HHHHHHHcCCHHHHHHHHHHHHcCC-----------CCC---------CcHHHHH
Q psy8681         263 ADLIR-ETYERAIANIPPTK-----FAELESLLGDMERARAIYELAISQP-----------RLD---------MPELVWK  316 (521)
Q Consensus       263 ~~~Ar-~~~erAl~~~P~~~-----~a~le~~~g~~e~Ar~ife~al~~~-----------~~~---------~~~~lw~  316 (521)
                      .+.|+ .+|++|+..+|.+.     |+.++...|++++|+.+|++++...           |..         ....+|.
T Consensus       359 ~~~a~r~il~rAi~~~P~s~~Lwl~~a~~ee~~~~~e~aR~iyek~l~~l~~~~~~~~~~~p~~~~~~~~~~~~~~~vWi  438 (679)
T 4e6h_A          359 DSTVITKYLKLGQQCIPNSAVLAFSLSEQYELNTKIPEIETTILSCIDRIHLDLAALMEDDPTNESAINQLKSKLTYVYC  438 (679)
T ss_dssp             CTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHHHHHHHSTTCHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHHHhhhhhhccCcchhhhhhhccchHHHHH
Confidence            88896 99999999999876     7888888899999999999888631           110         0235788


Q ss_pred             HHHHHHHhcCChHHHHHHHHHHHhc------------------------------------CC-CHHHHHHHHHHHHHcC
Q psy8681         317 AYIDFEVGQGERDKVRELHERLLER------------------------------------TV-HVKVWMNYAQFEMSSG  359 (521)
Q Consensus       317 ~yi~~e~~~g~~~~Ar~l~eral~~------------------------------------~~-~~~vwi~ya~~e~~~g  359 (521)
                      .|+.|+.+.|+.+.||.+|.+|++.                                    +| ++.+|+.|+.|+...|
T Consensus       439 ~y~~~erR~~~l~~AR~vf~~A~~~~~~~~~~lyi~~A~lE~~~~~d~e~Ar~ife~~Lk~~p~~~~~w~~y~~fe~~~~  518 (679)
T 4e6h_A          439 VYMNTMKRIQGLAASRKIFGKCRRLKKLVTPDIYLENAYIEYHISKDTKTACKVLELGLKYFATDGEYINKYLDFLIYVN  518 (679)
T ss_dssp             HHHHHHHHHHCHHHHHHHHHHHHHTGGGSCTHHHHHHHHHHHTTTSCCHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHcCCHHHHHHHHHHHHHhcCCCChHHHHHHHHHHHHhCCCHHHHHHHHHHHHHHCCCchHHHHHHHHHHHhCC
Confidence            8888877666655555555555543                                    33 3444555555555555


Q ss_pred             CchhhHHHHHHHHHHHHHhccchhhHHHHHHHHHHHHHHHHcCCHHHHHHHHhhCchh
Q psy8681         360 DEDSVSLARRVFERANQALKASSEKEERVMLLEAWKEFEAQHGDDESRAKLNSKLPRR  417 (521)
Q Consensus       360 ~~~~~~~AR~vferAl~~~~~~~~~~~~~~l~~~~~~fE~~~G~~~~~~~v~~~~p~~  417 (521)
                      +   .++||++|++|+..+|+.   +.+..||..|..||..+|+.+++.+|.+++...
T Consensus       519 ~---~~~AR~lferal~~~~~~---~~~~~lw~~~~~fE~~~G~~~~~~~v~~R~~~~  570 (679)
T 4e6h_A          519 E---ESQVKSLFESSIDKISDS---HLLKMIFQKVIFFESKVGSLNSVRTLEKRFFEK  570 (679)
T ss_dssp             C---HHHHHHHHHHHTTTSSST---THHHHHHHHHHHHHHHTCCSHHHHHHHHHHHHH
T ss_pred             C---HHHHHHHHHHHHHhcCCH---HHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHh
Confidence            4   666666666666655531   246789999999999999999999999888533



>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>4aez_C MAD3, mitotic spindle checkpoint component MAD3; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2wvi_A Mitotic checkpoint serine/threonine-protein kinase BUB1 beta; tumor suppressor, TPR, apoptosis, cell division, cell cycle, kinetochore, transferase; 1.80A {Homo sapiens} PDB: 3si5_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>4a1g_A Mitotic checkpoint serine/threonine-protein kinas; cell cycle, transferase, spindle assembly checkpoint, mitosi repeat, KNL1, KMN network; 2.60A {Homo sapiens} PDB: 2lah_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>4a1g_A Mitotic checkpoint serine/threonine-protein kinas; cell cycle, transferase, spindle assembly checkpoint, mitosi repeat, KNL1, KMN network; 2.60A {Homo sapiens} PDB: 2lah_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2wvi_A Mitotic checkpoint serine/threonine-protein kinase BUB1 beta; tumor suppressor, TPR, apoptosis, cell division, cell cycle, kinetochore, transferase; 1.80A {Homo sapiens} PDB: 3si5_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>4aez_C MAD3, mitotic spindle checkpoint component MAD3; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 521
d2onda1308 a.118.8.7 (A:242-549) Cleavage stimulation factor 3e-10
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: HAT/Suf repeat
domain: Cleavage stimulation factor 77 kDa subunit CSTF3
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 59.2 bits (142), Expect = 3e-10
 Identities = 45/275 (16%), Positives = 90/275 (32%), Gaps = 62/275 (22%)

Query: 206 EIYKAYTIHEKKYGDRAGIEDVIVSKRKFQYEEEVNSNPNNYDAWFDYLRLLEDEGN--- 262
           +++K Y   EK    R   + +I  +  F YE+ +    ++ D W++  + LE       
Sbjct: 9   DMWKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHHPDIWYEAAQYLEQSSKLLA 68

Query: 263 -----------ADLIRETYERAIANIPP------TKFAELESLLGDMERARAIYELAISQ 305
                      +D     YERAI+ +          +A+ E      E+  +IY   ++ 
Sbjct: 69  EKGDMNNAKLFSDEAANIYERAISTLLKKNMLLYFAYADYEESRMKYEKVHSIYNRLLAI 128

Query: 306 PRLDMPELVWKAYIDFEVGQGERDKVRELHERLLER------------------------ 341
             +D P LV+  Y+ F          R + ++  E                         
Sbjct: 129 EDID-PTLVYIQYMKFARRAEGIKSGRMIFKKAREDARTRHHVYVTAALMEYYCSKDKSV 187

Query: 342 ------------TVHVKVWMNYAQFEMSSGDEDSVSLARRVFERANQALKASSEKEERVM 389
                           +  + Y  +     ++++    R +FER   +     EK     
Sbjct: 188 AFKIFELGLKKYGDIPEYVLAYIDYLSHLNEDNNT---RVLFERVLTSGSLPPEKSG--E 242

Query: 390 LLEAWKEFEAQHGDDESRAKLNSKLPRRAKKRVKT 424
           +   +  FE+  GD  S  K+  +     ++  + 
Sbjct: 243 IWARFLAFESNIGDLASILKVEKRRFTAFREEYEG 277


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query521
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.93
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.93
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.89
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.85
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.75
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.73
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.53
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.48
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.47
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.45
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.43
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.32
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.32
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.23
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.88
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.83
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.82
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.79
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.78
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.76
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.74
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.73
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.63
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.63
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.57
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.56
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.53
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.5
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.49
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.44
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.43
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.4
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.37
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.33
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.32
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.31
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.29
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.26
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.24
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.22
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.19
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.18
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.13
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.81
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.79
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.73
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.72
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.72
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.62
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.61
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.54
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.37
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 95.8
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 93.71
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 93.69
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 91.16
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 81.7
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: HAT/Suf repeat
domain: Cleavage stimulation factor 77 kDa subunit CSTF3
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.93  E-value=2.1e-24  Score=213.28  Aligned_cols=248  Identities=19%  Similarity=0.245  Sum_probs=207.3

Q ss_pred             hhhHHHHHHHHHHcC--------ChhHHHHHHHHHHHhcCCccccHHHHHHHHHHHHhhhhhccccchhhHHHHHhhhhh
Q psy8681         110 TTYGMRELVFEEQNG--------FVSGARKVYERAVEFFGEENLDEKLFIAFAKFEEGQREKYGDRAGIEDVIVSKRKFQ  181 (521)
Q Consensus       110 ~~~W~~~a~~e~~~g--------~~~~Ar~vye~Al~~~~~~~~~~~lw~~~a~~e~~~~~~~~~~~~~~~~~l~~~~~~  181 (521)
                      +.+|..|+.++...+        ..++++.+|++|+..+|   ..+.+|+.|+.|+...+......        +.....
T Consensus         8 ~~~W~~yi~~E~~~~~~~~~~~~~~~Rv~~vyerAl~~~~---~~~~lW~~y~~~~~~~~~~~~~~--------~~~~~~   76 (308)
T d2onda1           8 VDMWKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLG---HHPDIWYEAAQYLEQSSKLLAEK--------GDMNNA   76 (308)
T ss_dssp             HHHHHHHHHHHHTCTTCCCCHHHHHHHHHHHHHHHHHHHT---TCHHHHHHHHHHHHHHHHHHHHT--------SCCHHH
T ss_pred             HHHHHHHHHHHHhCcccccccchhHHHHHHHHHHHHHHCC---CCHHHHHHHHHHHHHcCchHHHH--------HHHhhc
Confidence            689999999998764        24678899999999976   47899999999987665100000        000112


Q ss_pred             hhhHHHHHHHHHHHHhc-CChhhHHHHHHHHHHHHHHcCChhhHHHHHHhhHHHHHHHHHhhCCCCH-HHHHHHHHHHHH
Q psy8681         182 YEEHERARVIYKYALDH-IPKDRTAEIYKAYTIHEKKYGDRAGIEDVIVSKRKFQYEEEVNSNPNNY-DAWFDYLRLLED  259 (521)
Q Consensus       182 ~~~~e~Ar~iy~~aL~~-~P~~~~~~l~~~~~~~e~~~G~~~~a~~~i~~krr~~ye~al~~~P~~~-~~W~~y~~~~~~  259 (521)
                      .+.++.|+.+|++|++. .|.+.  .+|..|+.++...|+.+.+..+        |++++...|.+. .+|..|+.++.+
T Consensus        77 ~~~~~~a~~i~~ral~~~~p~~~--~l~~~ya~~~~~~~~~~~a~~i--------~~~~l~~~~~~~~~~w~~~~~~~~~  146 (308)
T d2onda1          77 KLFSDEAANIYERAISTLLKKNM--LLYFAYADYEESRMKYEKVHSI--------YNRLLAIEDIDPTLVYIQYMKFARR  146 (308)
T ss_dssp             HHHHHHHHHHHHHHHTTTTTTCH--HHHHHHHHHHHHTTCHHHHHHH--------HHHHHTSSSSCTHHHHHHHHHHHHH
T ss_pred             ccchHHHHHHHHHHHHHcCCCCH--HHHHHHHHHHHhcccHHHHHHH--------HHHHHHHhcCChHHHHHHHHHHHHH
Confidence            23678999999999986 55554  7999999999999999998877        999999999775 589999999999


Q ss_pred             cCCHHHHHHHHHHHHHcCCchh-----HHHHHHH-cCCHHHHHHHHHHHHcCCCCCCcHHHHHHHHHHHHhcCChHHHHH
Q psy8681         260 EGNADLIRETYERAIANIPPTK-----FAELESL-LGDMERARAIYELAISQPRLDMPELVWKAYIDFEVGQGERDKVRE  333 (521)
Q Consensus       260 ~g~~~~Ar~~~erAl~~~P~~~-----~a~le~~-~g~~e~Ar~ife~al~~~~~~~~~~lw~~yi~~e~~~g~~~~Ar~  333 (521)
                      .|+++.|+.+|++|+...|.+.     ++.++.. .|+.+.|+.+|+.++...|.  ...+|..|++++...|++++||.
T Consensus       147 ~~~~~~ar~i~~~al~~~~~~~~~~~~~a~~e~~~~~~~~~a~~i~e~~l~~~p~--~~~~w~~y~~~~~~~g~~~~aR~  224 (308)
T d2onda1         147 AEGIKSGRMIFKKAREDARTRHHVYVTAALMEYYCSKDKSVAFKIFELGLKKYGD--IPEYVLAYIDYLSHLNEDNNTRV  224 (308)
T ss_dssp             HHCHHHHHHHHHHHHTSTTCCTHHHHHHHHHHHHTSCCHHHHHHHHHHHHHHHTT--CHHHHHHHHHHHHTTCCHHHHHH
T ss_pred             cCChHHHHHHHHHHHHhCCCcHHHHHHHHHHHHHhccCHHHHHHHHHHHHHhhhh--hHHHHHHHHHHHHHcCChHHHHH
Confidence            9999999999999999998766     4555544 58999999999999996554  36899999999999999999999


Q ss_pred             HHHHHHhcCC-----CHHHHHHHHHHHHHcCCchhhHHHHHHHHHHHHHhccchh
Q psy8681         334 LHERLLERTV-----HVKVWMNYAQFEMSSGDEDSVSLARRVFERANQALKASSE  383 (521)
Q Consensus       334 l~eral~~~~-----~~~vwi~ya~~e~~~g~~~~~~~AR~vferAl~~~~~~~~  383 (521)
                      +|++++..+|     ...+|..|+.||..+|+   ++.++++++|+.+.+|....
T Consensus       225 ~fe~ai~~~~~~~~~~~~iw~~~~~fE~~~G~---~~~~~~~~~r~~~~~~~~~~  276 (308)
T d2onda1         225 LFERVLTSGSLPPEKSGEIWARFLAFESNIGD---LASILKVEKRRFTAFREEYE  276 (308)
T ss_dssp             HHHHHHHSSSSCGGGCHHHHHHHHHHHHHHSC---HHHHHHHHHHHHHHTTTTTS
T ss_pred             HHHHHHHhCCCChHHHHHHHHHHHHHHHHcCC---HHHHHHHHHHHHHHCccccc
Confidence            9999999864     35699999999999999   99999999999999997643



>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure