Psyllid ID: psy8836


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
VPDHYKLNPGAVEAIAEQPGSPNHIIVGYSKGLVVLWDRTTNTANQISTMNIVSDRDSFVWKGHARLSVKHTGDSKDKEPSKALLKSVSPGFQPTCLVQLHPPAAVTSLVLHTEWGEY
cccccccccccEEEEEEccccccEEEEEccccEEEEEcccccccEEEEEEEEEcccccEEEcccccEEEEcccccccccccccccccccccccccccccccccHHEEEEEEccccccc
ccccccccccHHEEEEEccccccEEEEEccccEEEEEcccccccEEEEEEEEEEccccEEEcccccccccccccccccccccccccccccccccEEEEEEcccHHHHHHHHHcccccc
vpdhyklnpgaveaiaeqpgspnhiiVGYSKGLVVLWDRttntanqistmnivsdrdsfvwkgharlsvkhtgdskdkepskallksvspgfqptclvqlhppaaVTSLVLHTEWGEY
VPDHYKLNPGAVEaiaeqpgspnHIIVGYSKGLVVLWDRTTNTanqistmnivsdrdsfVWKGHARLSvkhtgdskdkepSKALLKSVSPGFQPTCLVQLHPPAAVTSLVLHTEWGEY
VPDHYKLNPGAVEAIAEQPGSPNHIIVGYSKGLVVLWDRTTNTANQISTMNIVSDRDSFVWKGHARLSVKHTGDSKDKEPSKALLKSVSPGFQPTCLVQLHPPAAVTSLVLHTEWGEY
**********************NHIIVGYSKGLVVLWDRTTNTANQISTMNIVSDRDSFVWKGHARL************************FQPTCLVQLHPPAAVTSLVLHTEW***
VPDHYKLNPGAVEAIAEQPGSPNHIIVGYSKGLVVLWDRTTNTANQISTMNIVSDRDSFVWKGH*****************KALLKSVSPGFQPTCLVQLHPPAAVTSLVLHTEWG**
VPDHYKLNPGAVEAIAEQPGSPNHIIVGYSKGLVVLWDRTTNTANQISTMNIVSDRDSFVWKGHARLS***************LLKSVSPGFQPTCLVQLHPPAAVTSLVLHTEWGEY
*PDHYKLNPGAVEAIAEQPGSPNHIIVGYSKGLVVLWDRTTNTANQISTMNIVSDRDSFVWKGHARLSVKHTGDSKDKEPSKALLKSVSPGFQPTCLVQLHPPAAVTSLVLHTEWGE*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VPDHYKLNPGAVEAIAEQPGSPNHIIVGYSKGLVVLWDRTTNTANQISTMNIVSDRDSFVWKGHARLSVKHTGDSKDKEPSKALLKSVSPGFQPTCLVQLHPPAAVTSLVLHTEWGEY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query118 2.2.26 [Sep-21-2011]
Q08470 1166 Protein lethal(2) giant l yes N/A 0.906 0.091 0.352 6e-10
Q15334 1064 Lethal(2) giant larvae pr yes N/A 0.855 0.094 0.362 5e-09
Q5RCX2 1019 Lethal(2) giant larvae pr no N/A 0.686 0.079 0.343 6e-09
Q6P1M3 1020 Lethal(2) giant larvae pr no N/A 0.686 0.079 0.333 2e-08
P08111 1161 Lethal(2) giant larvae pr yes N/A 0.906 0.092 0.330 2e-08
Q7SZE3 1020 Lethal(2) giant larvae pr yes N/A 0.677 0.078 0.326 2e-08
Q8MKF0 1036 Lethal(2) giant larvae pr no N/A 0.677 0.077 0.347 2e-08
Q80Y17 1036 Lethal(2) giant larvae pr yes N/A 0.677 0.077 0.347 2e-08
Q8K4K5 1036 Lethal(2) giant larvae pr yes N/A 0.483 0.055 0.449 3e-08
Q3TJ91 1027 Lethal(2) giant larvae pr no N/A 0.576 0.066 0.362 2e-07
>sp|Q08470|L2GL_DROPS Protein lethal(2) giant larvae OS=Drosophila pseudoobscura pseudoobscura GN=l(2)gl PE=1 SV=3 Back     alignment and function desciption
 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 63/119 (52%), Gaps = 12/119 (10%)

Query: 3   DHYKLNPG-AVEAIAEQPGSPNHIIVGYSKGLVVLWDRTTNTANQIS----TMNIVSDRD 57
           D Y  +P  AV+ IA  P +   ++VG + G +V+ D  T   +Q S    +MN+VSDRD
Sbjct: 502 DPYSDDPRLAVKKIAFCPKT-GQLVVGGTAGQIVIADFDTAAEDQSSLKYNSMNLVSDRD 560

Query: 58  SFVWKGHARLSVKHTGDSKDKEPSKALLKSVSPGFQPTCLVQLHPPAAVTSLVLHTEWG 116
            FVWKGH +L+V+      +  P          G   T ++Q+ PPA++T + L   WG
Sbjct: 561 GFVWKGHDQLNVRANLLEDNAVP------LTENGVNITGVLQVLPPASITCMALEANWG 613




Essential for the development of polarized epithelia and for cell polarity associated with asymmetric cell division of neuroblasts during development. Could act as a tumor suppressor.
Drosophila pseudoobscura pseudoobscura (taxid: 46245)
>sp|Q15334|L2GL1_HUMAN Lethal(2) giant larvae protein homolog 1 OS=Homo sapiens GN=LLGL1 PE=1 SV=3 Back     alignment and function description
>sp|Q5RCX2|L2GL2_PONAB Lethal(2) giant larvae protein homolog 2 OS=Pongo abelii GN=LLGL2 PE=2 SV=1 Back     alignment and function description
>sp|Q6P1M3|L2GL2_HUMAN Lethal(2) giant larvae protein homolog 2 OS=Homo sapiens GN=LLGL2 PE=1 SV=2 Back     alignment and function description
>sp|P08111|L2GL_DROME Lethal(2) giant larvae protein OS=Drosophila melanogaster GN=l(2)gl PE=1 SV=2 Back     alignment and function description
>sp|Q7SZE3|L2GL2_DANRE Lethal(2) giant larvae protein homolog 2 OS=Danio rerio GN=llgl2 PE=1 SV=1 Back     alignment and function description
>sp|Q8MKF0|L2GL1_BOVIN Lethal(2) giant larvae protein homolog 1 OS=Bos taurus GN=LLGL1 PE=2 SV=1 Back     alignment and function description
>sp|Q80Y17|L2GL1_MOUSE Lethal(2) giant larvae protein homolog 1 OS=Mus musculus GN=Llgl1 PE=1 SV=1 Back     alignment and function description
>sp|Q8K4K5|L2GL1_RAT Lethal(2) giant larvae protein homolog 1 OS=Rattus norvegicus GN=Llgl1 PE=1 SV=1 Back     alignment and function description
>sp|Q3TJ91|L2GL2_MOUSE Lethal(2) giant larvae protein homolog 2 OS=Mus musculus GN=Llgl2 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query118
345487878 1181 PREDICTED: protein lethal(2) giant larva 0.864 0.086 0.384 1e-12
340716449 1172 PREDICTED: protein lethal(2) giant larva 0.864 0.087 0.384 2e-12
350404253 1175 PREDICTED: protein lethal(2) giant larva 0.864 0.086 0.384 2e-12
340716451 1166 PREDICTED: protein lethal(2) giant larva 0.864 0.087 0.384 2e-12
328777996 1154 PREDICTED: lethal(2) giant larvae protei 0.872 0.089 0.373 6e-12
380019667 1123 PREDICTED: protein lethal(2) giant larva 0.872 0.091 0.373 6e-12
383866087 1145 PREDICTED: protein lethal(2) giant larva 0.855 0.088 0.406 6e-12
322785968 459 hypothetical protein SINV_03875 [Solenop 0.864 0.222 0.401 7e-12
307172666 1174 Lethal(2) giant larvae protein-like prot 0.864 0.086 0.384 1e-11
328777994 1128 PREDICTED: lethal(2) giant larvae protei 0.864 0.090 0.376 1e-11
>gi|345487878|ref|XP_001604186.2| PREDICTED: protein lethal(2) giant larvae-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 64/117 (54%), Gaps = 15/117 (12%)

Query: 3   DHYKLNPG-AVEAIAEQPGSPNHIIVGYSKGLVV--LWDRTTNTANQISTMNIVSDRDSF 59
           D Y  +P  AV+ +   P S   +I G +  ++   +     N   +  TMN+V+DRD F
Sbjct: 508 DPYSDDPRLAVKKVLLCPLSSTLVIAGTAGHVITAKISAEAINKEIKSVTMNVVNDRDGF 567

Query: 60  VWKGHARLSVKHTGDSKDKEPSKALLKSVSPGFQPTCLVQLHPPAAVTSLVLHTEWG 116
           VWKGH  L            P++    S + GFQP CL+QL+PPAAVT+L +H+EWG
Sbjct: 568 VWKGHEHL------------PARTASISFAVGFQPHCLLQLYPPAAVTALAMHSEWG 612




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|340716449|ref|XP_003396710.1| PREDICTED: protein lethal(2) giant larvae-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350404253|ref|XP_003487050.1| PREDICTED: protein lethal(2) giant larvae-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340716451|ref|XP_003396711.1| PREDICTED: protein lethal(2) giant larvae-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|328777996|ref|XP_392864.4| PREDICTED: lethal(2) giant larvae protein-like isoform 2 [Apis mellifera] Back     alignment and taxonomy information
>gi|380019667|ref|XP_003693724.1| PREDICTED: protein lethal(2) giant larvae-like isoform 1 [Apis florea] Back     alignment and taxonomy information
>gi|383866087|ref|XP_003708503.1| PREDICTED: protein lethal(2) giant larvae-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|322785968|gb|EFZ12584.1| hypothetical protein SINV_03875 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307172666|gb|EFN64009.1| Lethal(2) giant larvae protein-like protein 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|328777994|ref|XP_003249432.1| PREDICTED: lethal(2) giant larvae protein-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query118
MGI|MGI:1918843 1027 Llgl2 "lethal giant larvae hom 0.449 0.051 0.4 3.6e-14
RGD|1560307 1026 Llgl2 "lethal giant larvae hom 0.449 0.051 0.4 4.5e-14
ZFIN|ZDB-GENE-060825-69 1045 llgl1 "lethal giant larvae hom 0.601 0.067 0.397 2.4e-09
UNIPROTKB|F1NHH2 720 F1NHH2 "Uncharacterized protei 0.576 0.094 0.412 5e-09
UNIPROTKB|Q15334 1064 LLGL1 "Lethal(2) giant larvae 0.855 0.094 0.362 8.3e-09
UNIPROTKB|A1A4K4 1089 LLGL1 "Lethal(2) giant larvae 0.855 0.092 0.347 8.5e-09
UNIPROTKB|E2RPS3 1159 LLGL1 "Uncharacterized protein 0.855 0.087 0.353 1.5e-08
FB|FBgn0002121 1161 l(2)gl "lethal (2) giant larva 0.898 0.091 0.344 1.9e-08
UNIPROTKB|F1N3Z3 1018 LLGL2 "Uncharacterized protein 0.550 0.063 0.371 2.1e-08
RGD|3012 1036 Llgl1 "lethal giant larvae hom 0.855 0.097 0.336 2.7e-08
MGI|MGI:1918843 Llgl2 "lethal giant larvae homolog 2 (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 120 (47.3 bits), Expect = 3.6e-14, Sum P(2) = 3.6e-14
 Identities = 26/65 (40%), Positives = 37/65 (56%)

Query:    51 NIVSDRDSFVWKGHARLSVKHTGDSKDKEPSKALLKSVSPGFQPTCLVQLHPPAAVTSLV 110
             +++ D++ + WKGH RL+ +         P     ++   GFQP  LVQ  PPA VTSL 
Sbjct:   548 DLLQDQEGYRWKGHERLAAR---------PGPVCFEA---GFQPFVLVQCQPPAVVTSLA 595

Query:   111 LHTEW 115
             LH+EW
Sbjct:   596 LHSEW 600


GO:0005737 "cytoplasm" evidence=ISO
GO:0006887 "exocytosis" evidence=IEA
GO:0007049 "cell cycle" evidence=IEA
GO:0007229 "integrin-mediated signaling pathway" evidence=IEA
GO:0030165 "PDZ domain binding" evidence=ISO
GO:0032878 "regulation of establishment or maintenance of cell polarity" evidence=ISO
GO:0051301 "cell division" evidence=IEA
RGD|1560307 Llgl2 "lethal giant larvae homolog 2 (Drosophila)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060825-69 llgl1 "lethal giant larvae homolog 1 (Drosophila)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NHH2 F1NHH2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q15334 LLGL1 "Lethal(2) giant larvae protein homolog 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A1A4K4 LLGL1 "Lethal(2) giant larvae protein homolog 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RPS3 LLGL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
FB|FBgn0002121 l(2)gl "lethal (2) giant larvae" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1N3Z3 LLGL2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|3012 Llgl1 "lethal giant larvae homolog 1 (Drosophila)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 118
KOG1983|consensus 993 98.47
cd00200 289 WD40 WD40 domain, found in a number of eukaryotic 96.93
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 96.91
PTZ00420 568 coronin; Provisional 96.58
PTZ00421 493 coronin; Provisional 96.54
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 96.41
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 96.37
PF08596 395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 96.24
PTZ00420 568 coronin; Provisional 96.08
KOG0305|consensus484 95.95
KOG0278|consensus334 95.9
KOG1587|consensus 555 95.78
smart0032040 WD40 WD40 repeats. Note that these repeats are per 95.48
KOG0286|consensus343 95.46
PTZ00421 493 coronin; Provisional 95.16
KOG1273|consensus 405 95.13
KOG0302|consensus440 94.94
PLN00181 793 protein SPA1-RELATED; Provisional 94.9
KOG0270|consensus463 94.73
KOG0302|consensus440 93.79
KOG1036|consensus323 93.72
PLN00181 793 protein SPA1-RELATED; Provisional 93.67
KOG0318|consensus 603 93.65
KOG1407|consensus 313 93.46
KOG0650|consensus 733 93.15
KOG0268|consensus 433 92.88
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 92.57
KOG0646|consensus 476 92.51
KOG4328|consensus 498 92.49
KOG0303|consensus 472 92.45
KOG1273|consensus 405 92.3
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 92.12
KOG1188|consensus376 91.34
KOG0307|consensus 1049 91.02
KOG0307|consensus 1049 90.75
KOG0973|consensus 942 90.74
KOG0290|consensus364 90.33
KOG0284|consensus464 89.23
KOG0310|consensus 487 89.19
KOG0265|consensus338 89.17
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 89.17
KOG0263|consensus707 88.71
KOG0647|consensus347 88.53
KOG0282|consensus 503 88.29
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 88.15
KOG0273|consensus 524 88.09
KOG0322|consensus323 88.02
KOG0266|consensus 456 87.35
KOG0284|consensus 464 87.07
KOG0321|consensus 720 86.11
KOG0270|consensus 463 85.49
KOG0293|consensus 519 85.05
KOG0269|consensus 839 84.74
KOG0267|consensus 825 84.63
KOG1523|consensus 361 84.58
TIGR03866 300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 84.56
KOG0271|consensus 480 84.36
KOG0264|consensus422 84.36
KOG1034|consensus 385 84.18
KOG0645|consensus 312 83.97
KOG0285|consensus 460 83.84
KOG0772|consensus 641 83.71
KOG1332|consensus 299 83.64
KOG2048|consensus 691 83.07
KOG0264|consensus422 82.81
KOG0272|consensus 459 82.66
KOG1538|consensus 1081 81.85
KOG0282|consensus 503 81.76
KOG1445|consensus 1012 81.67
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 80.85
KOG0772|consensus 641 80.76
KOG0647|consensus 347 80.47
KOG1272|consensus 545 80.27
KOG0305|consensus 484 80.26
KOG0303|consensus 472 80.25
>KOG1983|consensus Back     alignment and domain information
Probab=98.47  E-value=2.3e-07  Score=84.16  Aligned_cols=104  Identities=32%  Similarity=0.424  Sum_probs=94.1

Q ss_pred             CCCCCCCcc-cchhhhhCCCCCCeEEEEeecceEEEE---eCCCCceeeEEeeccccccccccccCCcccccccCCCCCC
Q psy8836           2 PDHYKLNPG-AVEAIAEQPGSPNHIIVGYSKGLVVLW---DRTTNTANQISTMNIVSDRDSFVWKGHARLSVKHTGDSKD   77 (118)
Q Consensus         2 ~~~y~~~p~-aV~~I~~cP~ds~~LlIgg~~G~VVl~---d~~~~~~~~~~~v~l~~~~es~~W~~~~~~~~~~~~d~~~   77 (118)
                      .++|.+|++ .+.++.+|+. ++.+.||+.+|++.+.   +...+..+..+.+++.++...+.|++|..+.....     
T Consensus       482 ~~~~~~~~~~~~~~~~ic~~-~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~-----  555 (993)
T KOG1983|consen  482 FDPYSDDPRLGVQKPALCKK-SGQLAVGGTAGQILTLELTDSIVTGAVSFFCADLNQDVSVFKWKGHDRLSPRSN-----  555 (993)
T ss_pred             CCcccccccccCCcchhccc-ccccccccccceeeeeeecccccccceeeeehhhhhccccccccCchhcccccc-----
Confidence            478888998 9999999998 9999999999999999   44556666788888889999999999999998888     


Q ss_pred             CCCccccceeeCCCCCCeeeeeecCChheeeeeecccccCC
Q psy8836          78 KEPSKALLKSVSPGFQPTCLVQLHPPAAVTSLVLHTEWGEY  118 (118)
Q Consensus        78 ~~p~k~~~~~~p~G~Q~~~v~q~~Pp~~ITala~~s~~gL~  118 (118)
                             ++..|.|+++...+|+.||+.+++.++.+.|.++
T Consensus       556 -------~~~~~~~~~~~~~v~~~~~~~~~~~~~~s~~~~~  589 (993)
T KOG1983|consen  556 -------PLSLPDGFQPFVDVQDRPPAGVTQGTLASGWILV  589 (993)
T ss_pred             -------ccCCCCccccceEEEecCCcceeeeccccceecc
Confidence                   7789999999999999999999999999999874



>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query118
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 5e-06
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Length = 902 Back     alignment and structure
 Score = 42.9 bits (100), Expect = 5e-06
 Identities = 16/92 (17%), Positives = 32/92 (34%), Gaps = 7/92 (7%)

Query: 25  IIVGYSKGLVVLWDRTTNTANQISTMNIVSDRDSFVWKGHARLSVKHTGDSKDKEPSKAL 84
           + V    G VVL+    N    +       D +    +     +     D +D+ P+   
Sbjct: 503 LAVSIETGDVVLFKYEVNQFYSVENRPESGDLEMNFRRFSLNNTNGVLVDVRDRAPTG-- 560

Query: 85  LKSVSPGFQPTCLVQLHPPAAVTSLVLHTEWG 116
              V  GF P+  V  +     +++  ++  G
Sbjct: 561 ---VRQGFMPSTAVHAN-KGKTSAIN-NSNIG 587


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query118
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 97.43
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 97.37
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.34
3lrv_A 343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 97.23
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.21
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 97.13
3odt_A 313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 97.13
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 97.12
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 97.12
4aow_A 340 Guanine nucleotide-binding protein subunit beta-2; 97.11
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 97.11
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 97.1
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 97.08
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 97.08
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 97.06
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.05
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 97.05
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 97.03
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.97
3jrp_A 379 Fusion protein of protein transport protein SEC13 96.97
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 96.96
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 96.95
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 96.92
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.92
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 96.91
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 96.9
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 96.88
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.87
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 96.87
3jrp_A 379 Fusion protein of protein transport protein SEC13 96.85
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 96.85
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 96.83
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 96.77
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 96.77
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 96.77
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 96.76
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 96.76
4g56_B 357 MGC81050 protein; protein arginine methyltransfera 96.73
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 96.69
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 96.68
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 96.67
4g56_B357 MGC81050 protein; protein arginine methyltransfera 96.67
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 96.65
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 96.65
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 96.59
2xyi_A430 Probable histone-binding protein CAF1; transcripti 96.57
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 96.56
4gqb_B 344 Methylosome protein 50; TIM barrel, beta-propeller 96.54
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 96.53
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 96.53
3iz6_a 380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 96.52
2xyi_A 430 Probable histone-binding protein CAF1; transcripti 96.49
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 96.49
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 96.47
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 96.46
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 96.45
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 96.41
1r5m_A 425 SIR4-interacting protein SIF2; transcription corep 96.37
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 96.36
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 96.35
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 96.34
3frx_A 319 Guanine nucleotide-binding protein subunit beta- l 96.34
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.31
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 96.31
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 96.29
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 96.28
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 96.27
3i2n_A 357 WD repeat-containing protein 92; WD40 repeats, str 96.27
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 96.26
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 96.25
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 96.24
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 96.23
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 96.13
2ymu_A 577 WD-40 repeat protein; unknown function, two domain 96.13
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 96.1
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 96.02
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 96.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.98
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 95.97
2pbi_B 354 Guanine nucleotide-binding protein subunit beta 5; 95.94
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 95.83
2pm7_B 297 Protein transport protein SEC13, protein transport 95.83
3jro_A 753 Fusion protein of protein transport protein SEC13 95.81
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 95.8
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 95.75
1r5m_A 425 SIR4-interacting protein SIF2; transcription corep 95.69
3jro_A 753 Fusion protein of protein transport protein SEC13 95.63
2pm7_B 297 Protein transport protein SEC13, protein transport 95.62
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 95.55
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 95.51
2ymu_A577 WD-40 repeat protein; unknown function, two domain 95.44
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 95.41
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 95.34
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 95.25
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 95.21
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 95.14
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 95.06
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 95.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 94.99
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 94.92
4ggc_A 318 P55CDC, cell division cycle protein 20 homolog; ce 94.81
4h5i_A 365 Guanine nucleotide-exchange factor SEC12; copii ve 94.79
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 94.7
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 94.69
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 94.62
4gq1_A 393 NUP37; propeller, transport protein; 2.40A {Schizo 94.37
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 94.13
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 94.04
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 93.82
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 93.8
4gga_A 420 P55CDC, cell division cycle protein 20 homolog; ce 93.77
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 93.64
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 93.63
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 93.57
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 93.11
2j04_B 524 YDR362CP, TAU91; beta propeller, type 2 promoters, 93.07
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 92.51
2ojh_A 297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 92.41
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 92.24
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 92.13
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 91.98
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 90.92
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 90.55
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 90.34
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 89.57
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 89.51
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 89.14
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 87.71
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 87.66
2hqs_A 415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 87.12
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 86.62
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 86.51
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 85.55
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 85.24
3vgz_A 353 Uncharacterized protein YNCE; beta-propeller, prot 84.65
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 84.53
3vgz_A 353 Uncharacterized protein YNCE; beta-propeller, prot 82.39
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 81.49
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=97.43  E-value=0.00033  Score=51.40  Aligned_cols=69  Identities=6%  Similarity=-0.025  Sum_probs=54.5

Q ss_pred             CCCCcccchhhhhCCCCCCeEEEEeecceEEEEeCCCCceeeEEeeccccccccccccCCcccccccCCCC
Q psy8836           5 YKLNPGAVEAIAEQPGSPNHIIVGYSKGLVVLWDRTTNTANQISTMNIVSDRDSFVWKGHARLSVKHTGDS   75 (118)
Q Consensus         5 y~~~p~aV~~I~~cP~ds~~LlIgg~~G~VVl~d~~~~~~~~~~~v~l~~~~es~~W~~~~~~~~~~~~d~   75 (118)
                      ++.|.++|..|+++|. .+.|++|+..|.|.+||..+.+.+..+... ...+.++.|...++...+.+.|+
T Consensus        28 l~~h~~~v~~~~~s~~-~~~l~~~~~dg~i~vwd~~~~~~~~~~~~h-~~~v~~~~~~~~~~~l~s~~~dg   96 (369)
T 3zwl_B           28 LTGHERPLTQVKYNKE-GDLLFSCSKDSSASVWYSLNGERLGTLDGH-TGTIWSIDVDCFTKYCVTGSADY   96 (369)
T ss_dssp             EECCSSCEEEEEECTT-SCEEEEEESSSCEEEEETTTCCEEEEECCC-SSCEEEEEECTTSSEEEEEETTT
T ss_pred             EEEeeceEEEEEEcCC-CCEEEEEeCCCEEEEEeCCCchhhhhhhhc-CCcEEEEEEcCCCCEEEEEeCCC
Confidence            3457789999999996 889999999999999999888877655422 14567788988888887777664



>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query118
d1tbga_ 340 beta1-subunit of the signal-transducing G protein 97.51
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 97.37
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 97.16
d1vyhc1 317 Platelet-activating factor acetylhydrolase IB subu 97.11
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 97.06
d1tbga_340 beta1-subunit of the signal-transducing G protein 96.99
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 96.82
d1nr0a2 299 Actin interacting protein 1 {Nematode (Caenorhabdi 96.62
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 96.61
d1nr0a1 311 Actin interacting protein 1 {Nematode (Caenorhabdi 96.53
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 96.51
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 96.28
d1erja_ 388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 96.07
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 95.75
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 95.5
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 95.5
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 95.41
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 95.03
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 94.96
d1p22a2 293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 94.93
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 94.74
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 94.03
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 93.68
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 93.49
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 93.49
d1nexb2 355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 93.28
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 93.25
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 92.92
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 92.51
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 91.99
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 91.59
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 88.7
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 88.56
d2ovrb2 342 F-box/WD repeat-containing protein 7, FBXW7 {Human 88.24
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 87.86
d1p22a2 293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 85.61
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 84.04
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 81.45
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 80.3
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: beta1-subunit of the signal-transducing G protein heterotrimer
species: Cow (Bos taurus) [TaxId: 9913]
Probab=97.51  E-value=6.4e-05  Score=52.42  Aligned_cols=68  Identities=10%  Similarity=0.105  Sum_probs=53.6

Q ss_pred             CCCcccchhhhhCCCCCCeEEEEeecceEEEEeCCCCceeeEEeeccccccccccccCCcccccccCCCC
Q psy8836           6 KLNPGAVEAIAEQPGSPNHIIVGYSKGLVVLWDRTTNTANQISTMNIVSDRDSFVWKGHARLSVKHTGDS   75 (118)
Q Consensus         6 ~~~p~aV~~I~~cP~ds~~LlIgg~~G~VVl~d~~~~~~~~~~~v~l~~~~es~~W~~~~~~~~~~~~d~   75 (118)
                      +.|-++|..|+++|. ...|+.|+..|.|.|||..+.+.+..+... ...+.++.|...++.....+.|+
T Consensus        52 ~GH~~~I~~l~~s~~-~~~l~sgs~Dg~v~iWd~~~~~~~~~~~~~-~~~v~~v~~~~~~~~l~~~~~d~  119 (340)
T d1tbga_          52 RGHLAKIYAMHWGTD-SRLLVSASQDGKLIIWDSYTTNKVHAIPLR-SSWVMTCAYAPSGNYVACGGLDN  119 (340)
T ss_dssp             CCCSSCEEEEEECTT-SSEEEEEETTTEEEEEETTTTEEEEEEECS-CSCEEEEEECTTSSEEEEEETTC
T ss_pred             CCCCCCEEEEEECCC-CCEEEEEECCCceeeeecccceeEEEEecc-cccEEeeEeeccceeeeeecccc
Confidence            458889999999996 889999999999999999998887665542 13467778888888776665553



>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure