Psyllid ID: psy9159


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------26
MYSKLFVLSLFQFAFVQFGECAELFAVNNSKYPEIDRLLYYGKKDDKAKAYNLTMELNNKQPNDPDVLYRLAKACHCLYDIKRRENDKEASEKYILQGIEYAKKAMELAPNNSNTQKWYGICVGANGQFQSLKEKIKCGVVFRDQMNKAIQMAPKDFTLYSLKGRYQYEISKLSFFERKIAVLIVSDLDEPTAEDAIANCLKAEELAPAPWKENQLLIAKCYIEAGEYAKAVQWLDKAKAIPVVSYESHDLSTTYSYKR
cccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHcHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHcc
cccHHHHHHHHHHHHHHHcccccEEcccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccHHcHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccEHHHHHccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHccccc
MYSKLFVLSLFQFAFVQFGECAELfavnnskypeidRLLYYGKKDDKAKAYNLTMElnnkqpndpDVLYRLAKACHCLYDIKRRENDKEASEKYILQGIEYAKKAMElapnnsntqkwYGICVGANGQFQSLKEKIKCGVVFRDQMNKAIqmapkdftlyslkgRYQYEISKLSFFERKIAVLIVsdldeptaEDAIANCLkaeelapapwkeNQLLIAKCYIEAGEYAKAVQWLdkakaipvvsyeshdlsttysykr
MYSKLFVLSLFQFAFVQFGECAELfavnnskypeIDRLLYYGKKDDKAKAYNLTMelnnkqpndpDVLYRLAKACHCLYdikrrendkeaSEKYILQGIEYAKKAMELAPNNSNTQKWYGICVGANGQFQSLKEKIKCGVVFRDQMNKAIQMAPKDFTLYSLKGRYQYEISKLSFFERKIAVLIVSDLDEPTAEDAIANCLKAeelapapwKENQLLIAKCYIEAGEYAKAVQWLDKAkaipvvsyeshdlsttysykr
MYSKLFVLSLFQFAFVQFGECAELFAVNNSKYPEIDRLLYYGkkddkakaYNLTMELNNKQPNDPDVLYRLAKACHCLYDIKRRENDKEASEKYILQGIEYAKKAMELAPNNSNTQKWYGICVGANGQFQSLKEKIKCGVVFRDQMNKAIQMAPKDFTLYSLKGRYQYEISKLSFFERKIAVLIVSDLDEPTAEDAIANCLKAEELAPAPWKENQLLIAKCYIEAGEYAKAVQWLDKAKAIPVVSYESHDLSTTYSYKR
***KLFVLSLFQFAFVQFGECAELFAVNNSKYPEIDRLLYYGKKDDKAKAYNLTMEL*******PDVLYRLAKACHCLYDIKRR*******EKYILQGIEYAKKAMELAPNNSNTQKWYGICVGANGQFQSLKEKIKCGVVFRDQMNKAIQMAPKDFTLYSLKGRYQYEISKLSFFERKIAVLIVSDLDEPTAEDAIANCLKAEELAPAPWKENQLLIAKCYIEAGEYAKAVQWLDKAKAIPVVSYES***********
***KLFVLSLFQFAFVQFGECAELFAVNNSKYPEIDRLLYYGKKDDKAKAYNLTMELNNKQPNDPDVLYRLAKACHCLYDIKRRENDKEASEKYILQGIEYAKKAMELAPNNSNTQKWYGICVGANGQFQSLKEKIKCGVVFRDQMNKAIQMAPKDFTLYSLKGRYQYEISKLSFFERKIAVLIVSDLDEPTAEDAIANCLKAEELAPAPWKENQLLIAKCYIEAGEYAKAVQWLDKAKAIPVVSYESHDLST**SYK*
MYSKLFVLSLFQFAFVQFGECAELFAVNNSKYPEIDRLLYYGKKDDKAKAYNLTMELNNKQPNDPDVLYRLAKACHCLYDIKRRENDKEASEKYILQGIEYAKKAMELAPNNSNTQKWYGICVGANGQFQSLKEKIKCGVVFRDQMNKAIQMAPKDFTLYSLKGRYQYEISKLSFFERKIAVLIVSDLDEPTAEDAIANCLKAEELAPAPWKENQLLIAKCYIEAGEYAKAVQWLDKAKAIPVVSY*************
MYSKLFVLSLFQFAFVQFGECAELFAVNNSKYPEIDRLLYYGKKDDKAKAYNLTMELNNKQPNDPDVLYRLAKACHCLYDIKRRENDKEASEKYILQGIEYAKKAMELAPNNSNTQKWYGICVGANGQFQSLKEKIKCGVVFRDQMNKAIQMAPKDFTLYSLKGRYQYEISKLSFFERKIAVLIVSDLDEPTAEDAIANCLKAEELAPAPWKENQLLIAKCYIEAGEYAKAVQWLDKAKAIPVVSYESHDLSTTYSY**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYSKLFVLSLFQFAFVQFGECAELFAVNNSKYPEIDRLLYYGKKDDKAKAYNLTMELNNKQPNDPDVLYRLAKACHCLYDIKRRENDKEASEKYILQGIEYAKKAMELAPNNSNTQKWYGICVGANGQFQSLKEKIKCGVVFRDQMNKAIQMAPKDFTLYSLKGRYQYEISKLSFFERKIAVLIVSDLDEPTAEDAIANCLKAEELAPAPWKENQLLIAKCYIEAGEYAKAVQWLDKAKAIPVVSYESHDLSTTYSYKR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query259 2.2.26 [Sep-21-2011]
Q8BSE0410 Regulator of microtubule yes N/A 0.787 0.497 0.333 1e-28
Q498D5412 Regulator of microtubule yes N/A 0.776 0.487 0.328 2e-28
Q0P4W3412 Regulator of microtubule yes N/A 0.795 0.5 0.320 3e-27
Q3UJU9470 Regulator of microtubule no N/A 0.787 0.434 0.322 1e-25
Q66H15471 Regulator of microtubule no N/A 0.787 0.433 0.312 2e-25
Q5EAU9463 Regulator of microtubule N/A N/A 0.814 0.455 0.316 2e-25
Q2TBQ7410 Regulator of microtubule no N/A 0.776 0.490 0.313 7e-25
Q5R6Z1470 Regulator of microtubule yes N/A 0.772 0.425 0.330 2e-24
Q96LZ7410 Regulator of microtubule no N/A 0.764 0.482 0.308 2e-24
Q1JQC5471 Regulator of microtubule no N/A 0.779 0.428 0.328 3e-24
>sp|Q8BSE0|RMD2_MOUSE Regulator of microtubule dynamics protein 2 OS=Mus musculus GN=Rmdn2 PE=2 SV=1 Back     alignment and function desciption
 Score =  127 bits (318), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 114/207 (55%), Gaps = 3/207 (1%)

Query: 44  KDDKAKAYNLTMELNNKQPNDPDVLYRLAKACHCLYDIKRRENDKEASEKYILQGIEYAK 103
           +  K +++ L  +   K   + + L+RLA+A   +YD+     +K+    Y   G    +
Sbjct: 193 ESHKMESFELLCDHKEKFSEETEFLWRLARAYGDMYDLSTSTQEKK---HYANIGKTLGE 249

Query: 104 KAMELAPNNSNTQKWYGICVGANGQFQSLKEKIKCGVVFRDQMNKAIQMAPKDFTLYSLK 163
           +A+  AP N +   WY +  G   +F+ L+ KI CG +F+  +  AIQ+ P++  LY LK
Sbjct: 250 RAITRAPMNGHCHLWYAVLCGYVSEFEGLQNKINCGHLFKKHLEIAIQLLPEEPLLYYLK 309

Query: 164 GRYQYEISKLSFFERKIAVLIVSDLDEPTAEDAIANCLKAEELAPAPWKENQLLIAKCYI 223
           GRY Y +S+LS+ E+K+A  +  ++   T  +A+ N LK EEL P     N +  AKCY+
Sbjct: 310 GRYCYTVSRLSWIEKKMAATLFGEIPYSTVHEALHNFLKTEELQPGYSMSNYMYTAKCYV 369

Query: 224 EAGEYAKAVQWLDKAKAIPVVSYESHD 250
           E GE  +A ++ + A  +PVV+ E  D
Sbjct: 370 ELGEPQEACKFCNLALLLPVVTKEDKD 396





Mus musculus (taxid: 10090)
>sp|Q498D5|RMD2_RAT Regulator of microtubule dynamics protein 2 OS=Rattus norvegicus GN=Rmdn2 PE=2 SV=1 Back     alignment and function description
>sp|Q0P4W3|RMD2_XENTR Regulator of microtubule dynamics protein 2 OS=Xenopus tropicalis GN=rmdn2 PE=2 SV=1 Back     alignment and function description
>sp|Q3UJU9|RMD3_MOUSE Regulator of microtubule dynamics protein 3 OS=Mus musculus GN=Rmdn3 PE=1 SV=2 Back     alignment and function description
>sp|Q66H15|RMD3_RAT Regulator of microtubule dynamics protein 3 OS=Rattus norvegicus GN=Rmdn3 PE=2 SV=1 Back     alignment and function description
>sp|Q5EAU9|RMD3_XENLA Regulator of microtubule dynamics protein 3 OS=Xenopus laevis GN=rmdn3 PE=2 SV=1 Back     alignment and function description
>sp|Q2TBQ7|RMD2_BOVIN Regulator of microtubule dynamics protein 2 OS=Bos taurus GN=RMDN2 PE=2 SV=2 Back     alignment and function description
>sp|Q5R6Z1|RMD3_PONAB Regulator of microtubule dynamics protein 3 OS=Pongo abelii GN=RMDN3 PE=2 SV=1 Back     alignment and function description
>sp|Q96LZ7|RMD2_HUMAN Regulator of microtubule dynamics protein 2 OS=Homo sapiens GN=RMDN2 PE=1 SV=2 Back     alignment and function description
>sp|Q1JQC5|RMD3_BOVIN Regulator of microtubule dynamics protein 3 OS=Bos taurus GN=RMDN3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query259
193671787 378 PREDICTED: regulator of microtubule dyna 0.806 0.552 0.394 2e-37
405952807338 Regulator of microtubule dynamics protei 0.822 0.630 0.359 5e-33
449283210 401 Regulator of microtubule dynamics protei 0.795 0.513 0.349 8e-29
260803826 466 hypothetical protein BRAFLDRAFT_120481 [ 0.872 0.484 0.313 1e-28
449496827 418 PREDICTED: regulator of microtubule dyna 0.795 0.492 0.344 1e-28
148706539 418 expressed sequence AW061290, isoform CRA 0.787 0.488 0.333 5e-27
41235741 410 regulator of microtubule dynamics protei 0.787 0.497 0.333 7e-27
148706540 413 expressed sequence AW061290, isoform CRA 0.787 0.493 0.333 8e-27
149050616 420 similar to hypothetical protein FLJ32954 0.776 0.478 0.328 1e-26
81295355 412 regulator of microtubule dynamics protei 0.776 0.487 0.328 1e-26
>gi|193671787|ref|XP_001949158.1| PREDICTED: regulator of microtubule dynamics protein 1-like isoform 1 [Acyrthosiphon pisum] gi|328720239|ref|XP_003246983.1| PREDICTED: regulator of microtubule dynamics protein 1-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  162 bits (409), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 138/213 (64%), Gaps = 4/213 (1%)

Query: 32  YPEIDRLLYYGKKDDKAKAYNLTMELNNKQPNDPDVLYRLAKACHCL--YDIKRRENDKE 89
           + ++D L + G  +DK KAY + ++LN ++ +D +VL+RLAK+C  +  Y I  ++N  E
Sbjct: 142 FDQVDEL-FEGSDEDKLKAYEILLQLNEERTDDIEVLWRLAKSCQFVSKYYIAAKKN-LE 199

Query: 90  ASEKYILQGIEYAKKAMELAPNNSNTQKWYGICVGANGQFQSLKEKIKCGVVFRDQMNKA 149
            S+  I +G++++K A+E+ P N N  KW+ IC GA GQ  S KEKI+ G +F++ +N+A
Sbjct: 200 KSKSVIDEGVKWSKHALEMYPGNCNAHKWFAICSGARGQLGSTKEKIEGGYIFQNHINEA 259

Query: 150 IQMAPKDFTLYSLKGRYQYEISKLSFFERKIAVLIVSDLDEPTAEDAIANCLKAEELAPA 209
           I++  +D TLY LKG+ +YE++ LS F+R+IA  +  ++ + T  +AI   LK +  +P 
Sbjct: 260 IKINSRDPTLYYLKGKLEYEVAVLSSFDRRIASWLYGEVPKGTIPEAIELFLKFQRESPI 319

Query: 210 PWKENQLLIAKCYIEAGEYAKAVQWLDKAKAIP 242
             K+  L +AKCYI   EY  AV WL+++  +P
Sbjct: 320 QLKDCHLHLAKCYIAKNEYETAVNWLEQSLQLP 352




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|405952807|gb|EKC20574.1| Regulator of microtubule dynamics protein 2 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|449283210|gb|EMC89891.1| Regulator of microtubule dynamics protein 2, partial [Columba livia] Back     alignment and taxonomy information
>gi|260803826|ref|XP_002596790.1| hypothetical protein BRAFLDRAFT_120481 [Branchiostoma floridae] gi|229282050|gb|EEN52802.1| hypothetical protein BRAFLDRAFT_120481 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|449496827|ref|XP_002191354.2| PREDICTED: regulator of microtubule dynamics protein 2 [Taeniopygia guttata] Back     alignment and taxonomy information
>gi|148706539|gb|EDL38486.1| expressed sequence AW061290, isoform CRA_a [Mus musculus] Back     alignment and taxonomy information
>gi|41235741|ref|NP_958749.1| regulator of microtubule dynamics protein 2 [Mus musculus] gi|81874985|sp|Q8BSE0.1|RMD2_MOUSE RecName: Full=Regulator of microtubule dynamics protein 2; Short=RMD-2; Short=mRMD-2; AltName: Full=Protein FAM82A1 gi|26330065|dbj|BAC28771.1| unnamed protein product [Mus musculus] gi|74228224|dbj|BAE23985.1| unnamed protein product [Mus musculus] Back     alignment and taxonomy information
>gi|148706540|gb|EDL38487.1| expressed sequence AW061290, isoform CRA_b [Mus musculus] Back     alignment and taxonomy information
>gi|149050616|gb|EDM02789.1| similar to hypothetical protein FLJ32954 [Rattus norvegicus] Back     alignment and taxonomy information
>gi|81295355|ref|NP_001032277.1| regulator of microtubule dynamics protein 2 [Rattus norvegicus] gi|123795667|sp|Q498D5.1|RMD2_RAT RecName: Full=Regulator of microtubule dynamics protein 2; Short=RMD-2; AltName: Full=Protein FAM82A1 gi|71682218|gb|AAI00262.1| Family with sequence similarity 82, member A [Rattus norvegicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query259
RGD|1559836412 Rmdn2 "regulator of microtubul 0.760 0.478 0.33 9.1e-29
UNIPROTKB|Q2TBQ7410 RMDN2 "Regulator of microtubul 0.760 0.480 0.315 1.5e-26
UNIPROTKB|Q96LZ7410 RMDN2 "Regulator of microtubul 0.760 0.480 0.305 1.4e-25
MGI|MGI:1913552305 Rmdn1 "regulator of microtubul 0.764 0.649 0.313 2.2e-25
UNIPROTKB|Q32KL4317 RMDN1 "Regulator of microtubul 0.737 0.602 0.302 3.6e-25
UNIPROTKB|F1P0I6478 FAM82A2 "Uncharacterized prote 0.737 0.399 0.326 9.8e-25
RGD|1308697471 Rmdn3 "regulator of microtubul 0.725 0.399 0.321 1.5e-24
UNIPROTKB|F1NBF8264 FAM82B "Uncharacterized protei 0.752 0.738 0.314 1.6e-24
RGD|1563085310 Rmdn1 "regulator of microtubul 0.737 0.616 0.317 1.6e-24
UNIPROTKB|Q5R6Z1470 RMDN3 "Regulator of microtubul 0.725 0.4 0.331 2.5e-24
RGD|1559836 Rmdn2 "regulator of microtubule dynamics 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 320 (117.7 bits), Expect = 9.1e-29, P = 9.1e-29
 Identities = 66/200 (33%), Positives = 111/200 (55%)

Query:    51 YNLTMELNNKQPNDPDVLYRLAKACHCLYDIKRRENDKEASEKYILQGIEYAKKAMELAP 110
             + L  +   K   + + L+RL +A   +YD+     +K+    Y   G    ++A+  AP
Sbjct:   202 FELLCDHKEKFSEEIEFLWRLVRAYGDMYDLSTNTQEKK---HYANVGKTLGERAITRAP 258

Query:   111 NNSNTQKWYGICVGANGQFQSLKEKIKCGVVFRDQMNKAIQMAPKDFTLYSLKGRYQYEI 170
              N +   WY +  G   +F+ L+ KI CG +F+  ++ AIQ+ P++  LY LKGRY Y +
Sbjct:   259 MNGHCHLWYALLCGYVSEFEGLQNKINCGHLFKKHLDIAIQLLPEEPVLYYLKGRYCYTV 318

Query:   171 SKLSFFERKIAVLIVSDLDEPTAEDAIANCLKAEELAPAPWKENQLLIAKCYIEAGEYAK 230
             SKLS+ E+K+A  +  ++   T  +A+ N LK EEL P     N + +AKCY++ GE  +
Sbjct:   319 SKLSWIEKKMAATLFGEIPSSTVHEALHNFLKTEELQPGYSVSNYMYVAKCYVDLGESRE 378

Query:   231 AVQWLDKAKAIPVVSYESHD 250
             A ++ + A  +P+V+ E  D
Sbjct:   379 AWKFCNLALLLPIVTKEDKD 398




GO:0000922 "spindle pole" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISO
GO:0005874 "microtubule" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
UNIPROTKB|Q2TBQ7 RMDN2 "Regulator of microtubule dynamics protein 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q96LZ7 RMDN2 "Regulator of microtubule dynamics protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1913552 Rmdn1 "regulator of microtubule dynamics 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q32KL4 RMDN1 "Regulator of microtubule dynamics protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1P0I6 FAM82A2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1308697 Rmdn3 "regulator of microtubule dynamics 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NBF8 FAM82B "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1563085 Rmdn1 "regulator of microtubule dynamics 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R6Z1 RMDN3 "Regulator of microtubule dynamics protein 3" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 259
KOG4626|consensus 966 99.88
KOG4626|consensus 966 99.87
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.83
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.83
KOG1125|consensus579 99.82
PRK12370553 invasion protein regulator; Provisional 99.81
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.8
PRK11189296 lipoprotein NlpI; Provisional 99.8
KOG1155|consensus559 99.79
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.79
PRK12370553 invasion protein regulator; Provisional 99.78
KOG1126|consensus638 99.77
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.77
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.77
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.76
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.76
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.75
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.74
PRK15359144 type III secretion system chaperone protein SscB; 99.74
PRK15359144 type III secretion system chaperone protein SscB; 99.74
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.72
PLN02789320 farnesyltranstransferase 99.72
KOG1155|consensus559 99.72
PRK10370198 formate-dependent nitrite reductase complex subuni 99.71
KOG1173|consensus611 99.71
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.71
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.7
KOG1126|consensus638 99.7
PRK10370198 formate-dependent nitrite reductase complex subuni 99.69
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.69
KOG0547|consensus606 99.68
KOG2076|consensus 895 99.67
PLN02789320 farnesyltranstransferase 99.66
KOG0547|consensus606 99.66
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.66
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.66
PRK11788389 tetratricopeptide repeat protein; Provisional 99.66
PRK11788389 tetratricopeptide repeat protein; Provisional 99.65
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.64
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.63
KOG0624|consensus 504 99.59
KOG1125|consensus579 99.59
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.58
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.57
PRK14574 822 hmsH outer membrane protein; Provisional 99.57
PRK11189296 lipoprotein NlpI; Provisional 99.57
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.55
KOG1174|consensus564 99.54
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.54
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.53
KOG0553|consensus304 99.53
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.52
KOG2002|consensus 1018 99.52
KOG0553|consensus 304 99.52
KOG0550|consensus 486 99.52
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.49
KOG1129|consensus478 99.49
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 99.48
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.48
KOG2003|consensus 840 99.47
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.47
KOG0550|consensus 486 99.47
PRK10153517 DNA-binding transcriptional activator CadC; Provis 99.46
PRK11906458 transcriptional regulator; Provisional 99.45
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.45
PRK11906458 transcriptional regulator; Provisional 99.44
KOG3060|consensus289 99.43
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.42
KOG2002|consensus 1018 99.41
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.4
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.39
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.38
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.38
KOG0548|consensus539 99.38
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.36
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.36
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.36
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.35
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.34
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 99.32
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.32
KOG0495|consensus913 99.32
KOG3060|consensus289 99.3
KOG4162|consensus799 99.27
PF06552186 TOM20_plant: Plant specific mitochondrial import r 99.27
PRK10153517 DNA-binding transcriptional activator CadC; Provis 99.27
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.26
KOG2076|consensus 895 99.25
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.24
KOG1174|consensus 564 99.24
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.22
PRK14574 822 hmsH outer membrane protein; Provisional 99.22
KOG1173|consensus 611 99.2
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.2
KOG0548|consensus539 99.19
KOG1156|consensus 700 99.19
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.18
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.17
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.17
KOG4162|consensus799 99.16
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.16
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.14
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.14
KOG0624|consensus 504 99.13
KOG1129|consensus478 99.13
PF06552186 TOM20_plant: Plant specific mitochondrial import r 99.13
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.12
KOG1840|consensus508 99.12
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.12
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.1
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.09
KOG1127|consensus 1238 99.08
KOG0495|consensus 913 99.07
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.05
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.05
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.03
KOG1128|consensus 777 99.03
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.01
KOG1156|consensus 700 98.96
KOG4648|consensus 536 98.94
KOG1840|consensus508 98.94
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.91
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.91
PRK10803263 tol-pal system protein YbgF; Provisional 98.9
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.9
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.89
KOG0543|consensus397 98.88
KOG2003|consensus 840 98.87
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.87
PRK15331165 chaperone protein SicA; Provisional 98.86
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.85
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.85
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.84
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.84
KOG1127|consensus 1238 98.82
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.82
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.8
PF1337173 TPR_9: Tetratricopeptide repeat 98.8
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.79
KOG0543|consensus397 98.77
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.76
PRK10803263 tol-pal system protein YbgF; Provisional 98.74
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.73
KOG1128|consensus 777 98.73
PRK15331165 chaperone protein SicA; Provisional 98.68
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.67
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.63
KOG3785|consensus 557 98.63
PF12688120 TPR_5: Tetratrico peptide repeat 98.62
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.62
PF1337173 TPR_9: Tetratricopeptide repeat 98.62
KOG1130|consensus 639 98.61
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.57
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.55
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.53
KOG2610|consensus 491 98.51
PLN03218 1060 maturation of RBCL 1; Provisional 98.5
KOG4340|consensus 459 98.49
PF12688120 TPR_5: Tetratrico peptide repeat 98.48
KOG2376|consensus 652 98.48
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.47
PF1343134 TPR_17: Tetratricopeptide repeat 98.45
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.44
COG4700251 Uncharacterized protein conserved in bacteria cont 98.44
KOG4234|consensus271 98.39
KOG4234|consensus271 98.38
KOG4648|consensus 536 98.38
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.36
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 98.35
PLN03218 1060 maturation of RBCL 1; Provisional 98.34
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.32
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 98.32
PF13512142 TPR_18: Tetratricopeptide repeat 98.29
KOG4642|consensus 284 98.28
PF1343134 TPR_17: Tetratricopeptide repeat 98.27
PF1342844 TPR_14: Tetratricopeptide repeat 98.24
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.24
PLN03077 857 Protein ECB2; Provisional 98.23
PLN03077857 Protein ECB2; Provisional 98.2
PF1342844 TPR_14: Tetratricopeptide repeat 98.17
KOG1915|consensus 677 98.16
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 98.12
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.11
KOG4642|consensus284 98.1
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.08
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.06
KOG2796|consensus366 98.04
KOG1915|consensus 677 98.04
KOG3785|consensus 557 98.04
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 98.02
KOG0376|consensus 476 98.0
KOG4555|consensus175 98.0
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.96
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.94
KOG0376|consensus 476 97.94
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.9
PF13512142 TPR_18: Tetratricopeptide repeat 97.9
PRK04841 903 transcriptional regulator MalT; Provisional 97.89
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.88
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.87
KOG1130|consensus 639 97.87
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.85
KOG0545|consensus329 97.83
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.83
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 97.77
KOG2053|consensus 932 97.75
KOG4555|consensus175 97.75
PRK04841 903 transcriptional regulator MalT; Provisional 97.74
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.71
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.7
KOG2796|consensus366 97.69
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.64
KOG3081|consensus299 97.6
KOG2376|consensus 652 97.49
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.48
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.46
COG4700251 Uncharacterized protein conserved in bacteria cont 97.4
KOG1308|consensus 377 97.38
COG3898 531 Uncharacterized membrane-bound protein [Function u 97.37
KOG0530|consensus318 97.34
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.32
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 97.31
KOG1308|consensus377 97.28
KOG0530|consensus318 97.28
KOG1070|consensus1710 97.26
KOG2053|consensus 932 97.24
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 97.23
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.23
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 97.23
KOG0545|consensus329 97.22
PF10300 468 DUF3808: Protein of unknown function (DUF3808); In 97.18
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 97.17
COG3898 531 Uncharacterized membrane-bound protein [Function u 97.16
KOG1070|consensus1710 97.14
KOG1550|consensus 552 97.13
KOG0551|consensus390 97.13
KOG2610|consensus 491 97.08
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 97.07
KOG0551|consensus 390 97.06
KOG1586|consensus288 97.05
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.05
KOG3081|consensus299 97.05
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 97.01
KOG1585|consensus308 96.93
KOG0529|consensus 421 96.92
KOG1941|consensus 518 96.87
KOG3824|consensus 472 96.87
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.83
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 96.78
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 96.73
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 96.71
KOG2047|consensus 835 96.69
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.69
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 96.66
KOG1550|consensus 552 96.66
KOG4340|consensus 459 96.63
KOG1941|consensus 518 96.57
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.55
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 96.55
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 96.54
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 96.42
KOG3824|consensus 472 96.37
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 96.36
COG4976 287 Predicted methyltransferase (contains TPR repeat) 96.34
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 96.33
KOG2396|consensus 568 96.27
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.25
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 96.11
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.02
KOG4507|consensus 886 96.01
KOG2047|consensus 835 95.92
KOG2396|consensus 568 95.87
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.73
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 95.73
KOG0529|consensus 421 95.72
PRK10941269 hypothetical protein; Provisional 95.66
KOG3364|consensus149 95.48
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 95.38
KOG2471|consensus 696 95.37
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 95.36
PF09986214 DUF2225: Uncharacterized protein conserved in bact 95.35
KOG1586|consensus288 95.33
KOG1310|consensus 758 95.33
KOG0985|consensus 1666 95.32
COG2976207 Uncharacterized protein conserved in bacteria [Fun 94.96
KOG3617|consensus 1416 94.95
PF09986214 DUF2225: Uncharacterized protein conserved in bact 94.88
KOG4507|consensus 886 94.87
KOG1310|consensus 758 94.81
COG5191 435 Uncharacterized conserved protein, contains HAT (H 94.75
COG4976287 Predicted methyltransferase (contains TPR repeat) 94.47
COG5191 435 Uncharacterized conserved protein, contains HAT (H 94.34
PRK10941269 hypothetical protein; Provisional 94.3
KOG3617|consensus 1416 94.27
KOG2471|consensus 696 94.17
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 94.16
KOG1839|consensus1236 94.15
KOG1585|consensus 308 93.61
PF1286294 Apc5: Anaphase-promoting complex subunit 5 93.4
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 93.35
KOG1914|consensus 656 93.31
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 93.1
KOG1258|consensus577 93.06
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 92.93
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 92.73
KOG4279|consensus 1226 92.51
KOG1914|consensus 656 92.45
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 92.4
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 92.29
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 92.17
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 92.06
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 92.02
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 91.89
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 91.83
KOG3364|consensus149 91.83
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 91.55
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 91.38
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 90.86
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 90.71
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 90.7
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 90.39
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 89.92
KOG4814|consensus 872 89.62
COG3947361 Response regulator containing CheY-like receiver a 89.37
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 89.2
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 89.12
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 88.71
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 88.32
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 87.76
PF1285434 PPR_1: PPR repeat 87.7
PF11846193 DUF3366: Domain of unknown function (DUF3366); Int 87.68
PF12753404 Nro1: Nuclear pore complex subunit Nro1; InterPro: 87.48
COG3629280 DnrI DNA-binding transcriptional activator of the 87.47
KOG2422|consensus 665 87.47
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 87.18
KOG2300|consensus629 86.54
KOG4014|consensus248 86.15
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 85.6
PF1286294 Apc5: Anaphase-promoting complex subunit 5 85.6
COG5536328 BET4 Protein prenyltransferase, alpha subunit [Pos 85.57
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 84.76
COG2912269 Uncharacterized conserved protein [Function unknow 84.52
KOG2300|consensus 629 83.98
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 82.42
COG3629280 DnrI DNA-binding transcriptional activator of the 81.53
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 81.43
KOG4014|consensus248 81.4
COG2912269 Uncharacterized conserved protein [Function unknow 81.03
COG5536328 BET4 Protein prenyltransferase, alpha subunit [Pos 80.61
KOG0890|consensus 2382 80.43
KOG4814|consensus 872 80.26
>KOG4626|consensus Back     alignment and domain information
Probab=99.88  E-value=2.6e-21  Score=172.99  Aligned_cols=171  Identities=19%  Similarity=0.170  Sum_probs=129.6

Q ss_pred             CCcCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHHHHhhchhcccCcHHHHHHHHHHHHHHHHHHHHhCCCChHHHHHHHH
Q psy9159          42 GKKDDKAKAYNLTMELNNKQPNDPDVLYRLAKACHCLYDIKRRENDKEASEKYILQGIEYAKKAMELAPNNSNTQKWYGI  121 (259)
Q Consensus        42 ~~~~~~~~A~~~~~~~~~~~p~~~~~~~~la~~~~~~g~~~~~~~~~~~~~~~~~~A~~~~~kal~~~P~~~~~~~~la~  121 (259)
                      .. |..+-||.-|+++++.+|+-++++.+||.++...|+..              +|...|.+||.+.|+++++.+++|.
T Consensus       298 eq-G~ldlAI~~Ykral~~~P~F~~Ay~NlanALkd~G~V~--------------ea~~cYnkaL~l~p~hadam~NLgn  362 (966)
T KOG4626|consen  298 EQ-GLLDLAIDTYKRALELQPNFPDAYNNLANALKDKGSVT--------------EAVDCYNKALRLCPNHADAMNNLGN  362 (966)
T ss_pred             cc-ccHHHHHHHHHHHHhcCCCchHHHhHHHHHHHhccchH--------------HHHHHHHHHHHhCCccHHHHHHHHH
Confidence            44 78888888888888888888888888888888777765              6666666666666666666666666


Q ss_pred             HHHHhhchhhHHH------------------------HHhcHHHHHHHHHHHHccCCCChhHHHHHHHHHHHhhccchHH
Q psy9159         122 CVGANGQFQSLKE------------------------KIKCGVVFRDQMNKAIQMAPKDFTLYSLKGRYQYEISKLSFFE  177 (259)
Q Consensus       122 ~~~~~~~~~~~~~------------------------~~~~~~~a~~~~~kAl~l~P~~~~~~~~lG~~~~~~~~~~~~~  177 (259)
                      ++...|.++.+..                        +-++..+|+.+|++||+++|+.+.++.++|..|.++       
T Consensus       363 i~~E~~~~e~A~~ly~~al~v~p~~aaa~nNLa~i~kqqgnl~~Ai~~YkealrI~P~fAda~~NmGnt~ke~-------  435 (966)
T KOG4626|consen  363 IYREQGKIEEATRLYLKALEVFPEFAAAHNNLASIYKQQGNLDDAIMCYKEALRIKPTFADALSNMGNTYKEM-------  435 (966)
T ss_pred             HHHHhccchHHHHHHHHHHhhChhhhhhhhhHHHHHHhcccHHHHHHHHHHHHhcCchHHHHHHhcchHHHHh-------
Confidence            6665555442211                        011122566777777777777777777777777665       


Q ss_pred             HHHHHHHhcCCCCCcHHHHHHHHHHHHhhCCCCcHHhHHHHHHHHHHhCCHHHHHHHHHHHhcCCCCCccc
Q psy9159         178 RKIAVLIVSDLDEPTAEDAIANCLKAEELAPAPWKENQLLIAKCYIEAGEYAKAVQWLDKAKAIPVVSYES  248 (259)
Q Consensus       178 ~~~~~~~~~~~~~g~~~eAi~~~~kAi~l~P~~~~~~~~~la~~~~~~g~~~eA~~~~~kal~l~p~~~~~  248 (259)
                                   |+...|+.+|.+||.++| -..+++.+||.+|...|+..+|+..|+.++.++|+.++.
T Consensus       436 -------------g~v~~A~q~y~rAI~~nP-t~AeAhsNLasi~kDsGni~~AI~sY~~aLklkPDfpdA  492 (966)
T KOG4626|consen  436 -------------GDVSAAIQCYTRAIQINP-TFAEAHSNLASIYKDSGNIPEAIQSYRTALKLKPDFPDA  492 (966)
T ss_pred             -------------hhHHHHHHHHHHHHhcCc-HHHHHHhhHHHHhhccCCcHHHHHHHHHHHccCCCCchh
Confidence                         789999999999999999 679999999999999999999999999999999998873



>KOG4626|consensus Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1174|consensus Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG1129|consensus Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG3060|consensus Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG0495|consensus Back     alignment and domain information
>KOG3060|consensus Back     alignment and domain information
>KOG4162|consensus Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG1174|consensus Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>KOG1156|consensus Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4162|consensus Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>KOG1129|consensus Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG1127|consensus Back     alignment and domain information
>KOG0495|consensus Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG1128|consensus Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1156|consensus Back     alignment and domain information
>KOG4648|consensus Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG1127|consensus Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG1128|consensus Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG3785|consensus Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG1130|consensus Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG2610|consensus Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG4340|consensus Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG2376|consensus Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG4234|consensus Back     alignment and domain information
>KOG4234|consensus Back     alignment and domain information
>KOG4648|consensus Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG4642|consensus Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1915|consensus Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4642|consensus Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2796|consensus Back     alignment and domain information
>KOG1915|consensus Back     alignment and domain information
>KOG3785|consensus Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG0376|consensus Back     alignment and domain information
>KOG4555|consensus Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG0376|consensus Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1130|consensus Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0545|consensus Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG2053|consensus Back     alignment and domain information
>KOG4555|consensus Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG2796|consensus Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG3081|consensus Back     alignment and domain information
>KOG2376|consensus Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG1308|consensus Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG0530|consensus Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG1308|consensus Back     alignment and domain information
>KOG0530|consensus Back     alignment and domain information
>KOG1070|consensus Back     alignment and domain information
>KOG2053|consensus Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG0545|consensus Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG1070|consensus Back     alignment and domain information
>KOG1550|consensus Back     alignment and domain information
>KOG0551|consensus Back     alignment and domain information
>KOG2610|consensus Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG0551|consensus Back     alignment and domain information
>KOG1586|consensus Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3081|consensus Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>KOG1585|consensus Back     alignment and domain information
>KOG0529|consensus Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>KOG3824|consensus Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG2047|consensus Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG1550|consensus Back     alignment and domain information
>KOG4340|consensus Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG3824|consensus Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG2396|consensus Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG4507|consensus Back     alignment and domain information
>KOG2047|consensus Back     alignment and domain information
>KOG2396|consensus Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG0529|consensus Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG3364|consensus Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG2471|consensus Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG1586|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG0985|consensus Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG4507|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG2471|consensus Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG1839|consensus Back     alignment and domain information
>KOG1585|consensus Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG1914|consensus Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>KOG1258|consensus Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>KOG4279|consensus Back     alignment and domain information
>KOG1914|consensus Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG3364|consensus Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>KOG4814|consensus Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised Back     alignment and domain information
>PF12753 Nro1: Nuclear pore complex subunit Nro1; InterPro: IPR024318 In fission yeast, Nro1 is a positive regulator of the stability of Sre1N, the sterol regulatory element-binding protein, which is an ER membrane-bound transcription factor that controls adaptation to low oxygen-growth [] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2422|consensus Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG2300|consensus Back     alignment and domain information
>KOG4014|consensus Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>COG5536 BET4 Protein prenyltransferase, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2300|consensus Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG4014|consensus Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5536 BET4 Protein prenyltransferase, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0890|consensus Back     alignment and domain information
>KOG4814|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query259
4g1t_A472 Interferon-induced protein with tetratricopeptide 3e-06
4g1t_A 472 Interferon-induced protein with tetratricopeptide 6e-04
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-05
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 1e-04
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 2e-04
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-04
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 7e-04
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
 Score = 46.9 bits (111), Expect = 3e-06
 Identities = 35/219 (15%), Positives = 74/219 (33%), Gaps = 25/219 (11%)

Query: 37  RLLYYGKKDDKAKAYNLTMELNNKQPNDPDVLYRLAKACHCLYDIKRRENDKEASEKYIL 96
           RL  +    +        + LN   P++  +   LA     L+ ++    ++   EK + 
Sbjct: 184 RLDNWPPSQNAIDPLRQAIRLN---PDNQYLKVLLALK---LHKMREEGEEEGEGEKLV- 236

Query: 97  QGIEYAKKAMELAPNNSNTQKWYGICVGANGQFQSLKEKIKCGVVFRDQMNKAIQMAPKD 156
                 ++A+E AP  ++  +          +     + I+        + KA++  P +
Sbjct: 237 ------EEALEKAPGVTDVLRSAAKFYRRKDEPD---KAIEL-------LKKALEYIPNN 280

Query: 157 FTLYSLKGRYQYEISKLSFFERKIAVLIVSDLDEPTAEDAIANCLKAEELAPAPWKENQL 216
             L+   G             R+  +     L E     A+A+  KA+E           
Sbjct: 281 AYLHCQIGCCYRAKVFQVMNLRENGMYGKRKLLELIGH-AVAHLKKADEANDN-LFRVCS 338

Query: 217 LIAKCYIEAGEYAKAVQWLDKAKAIPVVSYESHDLSTTY 255
           ++A  +  A +Y +A  +  K  +  +       L   Y
Sbjct: 339 ILASLHALADQYEEAEYYFQKEFSKELTPVAKQLLHLRY 377


>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query259
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.94
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.94
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.91
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.91
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.91
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.91
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.9
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.88
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.88
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.88
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.88
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.88
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.88
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.87
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.87
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.87
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.87
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.86
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.86
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.86
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.86
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.86
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.86
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.86
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.86
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.86
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.85
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.85
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.85
3u4t_A272 TPR repeat-containing protein; structural genomics 99.85
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.85
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.85
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.85
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.84
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.84
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.84
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.83
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.83
3u4t_A272 TPR repeat-containing protein; structural genomics 99.83
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.83
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.83
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.83
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.83
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.83
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.82
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.82
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.82
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.82
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.81
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.81
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.8
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.8
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.8
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.8
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.8
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.8
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.79
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.79
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.79
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.79
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.78
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.78
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.78
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.78
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.77
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.76
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.76
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.76
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.76
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.76
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.75
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.75
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.75
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.73
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.72
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.72
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.71
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.71
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.71
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.7
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.7
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.7
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.7
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.7
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.7
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.7
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.69
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.69
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.69
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.68
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.68
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.68
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.68
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.68
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.68
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.68
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.67
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.67
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.67
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.66
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.66
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 99.66
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.66
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.66
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.66
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.65
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.65
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.65
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.65
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.65
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.65
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.65
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.65
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.64
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.64
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.64
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.64
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.64
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.63
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 99.63
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.63
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.63
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.62
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.62
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.61
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.61
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.61
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.6
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.6
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.6
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.6
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.6
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.6
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.59
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.59
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.58
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.58
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.58
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.57
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.57
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.56
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.56
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.56
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.56
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.55
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.55
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.55
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.54
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.54
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.54
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.53
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.53
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.52
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.52
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.52
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.52
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.51
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.51
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.5
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.5
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.49
3k9i_A117 BH0479 protein; putative protein binding protein, 99.49
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.49
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.47
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.46
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 99.45
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 99.45
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.45
3k9i_A117 BH0479 protein; putative protein binding protein, 99.44
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.43
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 99.42
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.41
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.41
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.41
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 99.38
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.35
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.35
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.35
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.34
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.32
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.31
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.31
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.25
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.24
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.23
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 99.21
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.21
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.19
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.17
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.17
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.13
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.13
1klx_A138 Cysteine rich protein B; structural genomics, heli 99.11
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.11
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.09
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.08
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.07
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 99.06
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 99.06
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.06
1klx_A138 Cysteine rich protein B; structural genomics, heli 99.01
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.97
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.89
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.83
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 98.83
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.79
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.77
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 98.76
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.71
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.69
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.68
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.6
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.42
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.37
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.36
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.3
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 98.19
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.17
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.04
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.98
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.9
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.83
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.75
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.58
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 97.54
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.45
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 97.4
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 97.29
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.23
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 97.21
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 96.71
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 96.46
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 95.81
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 95.57
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 94.51
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 94.28
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 94.21
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 94.19
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 91.44
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 91.0
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 90.43
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 87.29
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 87.24
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 86.07
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 85.15
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 80.69
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
Probab=99.94  E-value=1.5e-25  Score=176.98  Aligned_cols=166  Identities=19%  Similarity=0.122  Sum_probs=153.5

Q ss_pred             hHHHHHhhcCCcCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHHHHhhchhcccCcHHHHHHHHHHHHHHHHHHHHhCCCC
Q psy9159          33 PEIDRLLYYGKKDDKAKAYNLTMELNNKQPNDPDVLYRLAKACHCLYDIKRRENDKEASEKYILQGIEYAKKAMELAPNN  112 (259)
Q Consensus        33 ~~~~~l~~~~~~~~~~~A~~~~~~~~~~~p~~~~~~~~la~~~~~~g~~~~~~~~~~~~~~~~~~A~~~~~kal~~~P~~  112 (259)
                      ..+..+.  .. |++++|++.|+++++.+|+++++++.+|.+|...|++.              +|+..+++++..+|++
T Consensus        10 ~lG~~~~--~~-g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~~~~~--------------~a~~~~~~~~~~~~~~   72 (184)
T 3vtx_A           10 DIGDKKR--TK-GDFDGAIRAYKKVLKADPNNVETLLKLGKTYMDIGLPN--------------DAIESLKKFVVLDTTS   72 (184)
T ss_dssp             HHHHHHH--HH-TCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHH--------------HHHHHHHHHHHHCCCC
T ss_pred             HHHHHHH--Hc-CCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHCCCHH--------------HHHHHHHHHHhcCchh
Confidence            3455555  55 99999999999999999999999999999999999875              9999999999999999


Q ss_pred             hHHHHHHHHHHHHhhchhhHHHHHhcHHHHHHHHHHHHccCCCChhHHHHHHHHHHHhhccchHHHHHHHHHhcCCCCCc
Q psy9159         113 SNTQKWYGICVGANGQFQSLKEKIKCGVVFRDQMNKAIQMAPKDFTLYSLKGRYQYEISKLSFFERKIAVLIVSDLDEPT  192 (259)
Q Consensus       113 ~~~~~~la~~~~~~~~~~~~~~~~~~~~~a~~~~~kAl~l~P~~~~~~~~lG~~~~~~~~~~~~~~~~~~~~~~~~~~g~  192 (259)
                      +.++..+|.++...+++.          .+...++++++++|+++.++..+|.++...                    |+
T Consensus        73 ~~~~~~~~~~~~~~~~~~----------~a~~~~~~a~~~~~~~~~~~~~lg~~~~~~--------------------g~  122 (184)
T 3vtx_A           73 AEAYYILGSANFMIDEKQ----------AAIDALQRAIALNTVYADAYYKLGLVYDSM--------------------GE  122 (184)
T ss_dssp             HHHHHHHHHHHHHTTCHH----------HHHHHHHHHHHHCTTCHHHHHHHHHHHHHT--------------------TC
T ss_pred             HHHHHHHHHHHHHcCCHH----------HHHHHHHHHHHhCccchHHHHHHHHHHHHh--------------------CC
Confidence            999999999999888876          467889999999999999999999999885                    88


Q ss_pred             HHHHHHHHHHHHhhCCCCcHHhHHHHHHHHHHhCCHHHHHHHHHHHhcCCCCCc
Q psy9159         193 AEDAIANCLKAEELAPAPWKENQLLIAKCYIEAGEYAKAVQWLDKAKAIPVVSY  246 (259)
Q Consensus       193 ~~eAi~~~~kAi~l~P~~~~~~~~~la~~~~~~g~~~eA~~~~~kal~l~p~~~  246 (259)
                      +++|+++|+++++++| +++.++.++|.+|..+|++++|++.|++|++++|.++
T Consensus       123 ~~~A~~~~~~~l~~~p-~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~a  175 (184)
T 3vtx_A          123 HDKAIEAYEKTISIKP-GFIRAYQSIGLAYEGKGLRDEAVKYFKKALEKEEKKA  175 (184)
T ss_dssp             HHHHHHHHHHHHHHCT-TCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTTHHHH
T ss_pred             chhHHHHHHHHHHhcc-hhhhHHHHHHHHHHHCCCHHHHHHHHHHHHhCCccCH
Confidence            9999999999999999 7899999999999999999999999999999998764



>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query259
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.92
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.89
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.89
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.88
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.87
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.82
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.8
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.78
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.77
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.76
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.73
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.73
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.73
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.71
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.71
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.69
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.68
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.67
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.62
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.58
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.57
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.54
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.54
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.54
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.53
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.52
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.51
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.51
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.49
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.49
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.49
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.47
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.46
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.46
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.44
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.4
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.34
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.34
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.32
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.23
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.13
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.13
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 99.11
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.11
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 99.07
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.02
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.98
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 98.94
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.71
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.53
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.36
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.36
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.36
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.09
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 89.05
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 87.99
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.92  E-value=8.7e-24  Score=178.99  Aligned_cols=203  Identities=15%  Similarity=0.109  Sum_probs=165.1

Q ss_pred             cCCchhHHHHHhhcCCcCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHHHHhhchhcccCcHHHHHHHHHHHHHHHHHHHH
Q psy9159          28 NNSKYPEIDRLLYYGKKDDKAKAYNLTMELNNKQPNDPDVLYRLAKACHCLYDIKRRENDKEASEKYILQGIEYAKKAME  107 (259)
Q Consensus        28 ~~~~~~~~~~l~~~~~~~~~~~A~~~~~~~~~~~p~~~~~~~~la~~~~~~g~~~~~~~~~~~~~~~~~~A~~~~~kal~  107 (259)
                      .+..++++..++  .. |++++|+..|+++++.+|+++++|+.+|.+|...|++.              +|+..++++++
T Consensus        19 ~~~~~~~g~~~~--~~-g~~~~A~~~~~~al~~~P~~~~a~~~lg~~~~~~~~~~--------------~A~~~~~~al~   81 (323)
T d1fcha_          19 HPQPFEEGLRRL--QE-GDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQEL--------------LAISALRRCLE   81 (323)
T ss_dssp             CSSHHHHHHHHH--HT-TCHHHHHHHHHHHHHSCTTCHHHHHHHHHHHHHTTCHH--------------HHHHHHHHHHH
T ss_pred             hHHHHHHHHHHH--Hc-CCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCChH--------------HHHHHHHhhhc
Confidence            345688898888  67 99999999999999999999999999999999999875              99999999999


Q ss_pred             hCCCChHHHHHHHHHHHHhhchhhHHHHHh---------------------------------------cHHHHHHHHHH
Q psy9159         108 LAPNNSNTQKWYGICVGANGQFQSLKEKIK---------------------------------------CGVVFRDQMNK  148 (259)
Q Consensus       108 ~~P~~~~~~~~la~~~~~~~~~~~~~~~~~---------------------------------------~~~~a~~~~~k  148 (259)
                      ++|+++.+|..+|.++...|++..+.....                                       ...++...+++
T Consensus        82 ~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~  161 (323)
T d1fcha_          82 LKPDNQTALMALAVSFTNESLQRQACEILRDWLRYTPAYAHLVTPAEEGAGGAGLGPSKRILGSLLSDSLFLEVKELFLA  161 (323)
T ss_dssp             HCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTSTTTGGGCC---------------CTTHHHHHHHHHHHHHHHHHH
T ss_pred             cccccccccccccccccccccccccccchhhHHHhccchHHHHHhhhhhhhhcccccchhhHHHHHHhhHHHHHHHHHHH
Confidence            999999999999999999888765433211                                       12245677888


Q ss_pred             HHccCCCC--hhHHHHHHHHHHHhhccchHHHHHHHHHhcC--------------CCCCcHHHHHHHHHHHHhhCCCCcH
Q psy9159         149 AIQMAPKD--FTLYSLKGRYQYEISKLSFFERKIAVLIVSD--------------LDEPTAEDAIANCLKAEELAPAPWK  212 (259)
Q Consensus       149 Al~l~P~~--~~~~~~lG~~~~~~~~~~~~~~~~~~~~~~~--------------~~~g~~~eAi~~~~kAi~l~P~~~~  212 (259)
                      +++++|++  +.++..+|.++...++.+.....+..++-..              ...|++++|+++|+++++++| +++
T Consensus       162 al~~~p~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p-~~~  240 (323)
T d1fcha_         162 AVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQP-GYI  240 (323)
T ss_dssp             HHHHSTTSCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCT-TCH
T ss_pred             HHHHhhcccccccchhhHHHHHHHHHHhhhhcccccccccccccccchhhhhhcccccccchhHHHHHHHHHHHhh-ccH
Confidence            99999885  4667888988888777543322222111111              126999999999999999999 789


Q ss_pred             HhHHHHHHHHHHhCCHHHHHHHHHHHhcCCCCCccc
Q psy9159         213 ENQLLIAKCYIEAGEYAKAVQWLDKAKAIPVVSYES  248 (259)
Q Consensus       213 ~~~~~la~~~~~~g~~~eA~~~~~kal~l~p~~~~~  248 (259)
                      .+++.+|.+|..+|++++|++.|++|++++|.+...
T Consensus       241 ~a~~~lg~~~~~~g~~~~A~~~~~~al~l~p~~~~~  276 (323)
T d1fcha_         241 RSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGP  276 (323)
T ss_dssp             HHHHHHHHHHHHHTCHHHHHHHHHHHHHHHHTC---
T ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHHHHHhCCcChhh
Confidence            999999999999999999999999999999987653



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure