Psyllid ID: psy9433


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-----
ITSVLSITHRGTGVALTAYALGLAGVGLTTDINSVVSFVDALNLSAPILLAGKFILAFPVSYHTANGIRHLIWDTGRALTIKKVYTTGYAMLGAAILTNLVLTLL
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHc
ccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHEHcccccccHHHHHHHHHHHHHHHHHHHHHHHc
ITSVLSITHRGTGVALTAYALGLAgvglttdiNSVVSFVDalnlsapiLLAGKFILAFPVSYHTANGIRHLIWDTGRALTIKKVYTTGYAMLGAAILTNLVLTLL
itsvlsithrgtgVALTAYALGLAGVGLTTDINSVVSFVDALNLSAPILLAGKFILAFPVSYHTANGIRHLIWDTGRALTIKKVYTTGYAMLGAAILTNLVLTLL
ITSVLSITHRGTGVALTAYALGLAGVGLTTDINSVVSFVDALNLSAPILLAGKFILAFPVSYHTANGIRHLIWDTGRALTIKKVYTTGYAMLGAAILTNLVLTLL
****LSITHRGTGVALTAYALGLAGVGLTTDINSVVSFVDALNLSAPILLAGKFILAFPVSYHTANGIRHLIWDTGRALTIKKVYTTGYAMLGAAILTNLVLTL*
ITSVLSITHRGTGVALTAYALGLAGVGLTTDINSVVSFVDALNLSAPILLAGKFILAFPVSYHTANGIRHLIWDTGRALTIKKVYTTGYAMLGAAILTNLVLTLL
ITSVLSITHRGTGVALTAYALGLAGVGLTTDINSVVSFVDALNLSAPILLAGKFILAFPVSYHTANGIRHLIWDTGRALTIKKVYTTGYAMLGAAILTNLVLTLL
ITSVLSITHRGTGVALTAYALGLAGVGLTTDINSVVSFVDALNLSAPILLAGKFILAFPVSYHTANGIRHLIWDTGRALTIKKVYTTGYAMLGAAILTNLVLTLL
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoo
iiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHo
iiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoo
iiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ITSVLSITHRGTGVALTAYALGLAGVGLTTDINSVVSFVDALNLSAPILLAGKFILAFPVSYHTANGIRHLIWDTGRALTIKKVYTTGYAMLGAAILTNLVLTLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query105 2.2.26 [Sep-21-2011]
P70097169 Succinate dehydrogenase c yes N/A 0.914 0.568 0.448 5e-18
P35720169 Succinate dehydrogenase c yes N/A 0.914 0.568 0.418 2e-15
Q99643169 Succinate dehydrogenase c no N/A 0.8 0.497 0.430 1e-14
Q9CZB0169 Succinate dehydrogenase c yes N/A 0.8 0.497 0.418 2e-14
D0VWV4169 Succinate dehydrogenase c no N/A 0.904 0.562 0.412 6e-14
O74882180 Succinate dehydrogenase c yes N/A 0.895 0.522 0.403 5e-12
P80481144 Succinate dehydrogenase c N/A N/A 0.961 0.701 0.396 3e-10
Q8T2T5192 Succinate dehydrogenase c yes N/A 0.990 0.541 0.327 5e-10
Q4UKC1124 Succinate dehydrogenase c yes N/A 0.923 0.782 0.359 2e-07
P41085124 Succinate dehydrogenase c yes N/A 0.923 0.782 0.330 3e-07
>sp|P70097|C560_CRIGR Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Cricetulus griseus GN=SDHC PE=2 SV=1 Back     alignment and function desciption
 Score = 89.7 bits (221), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 66/98 (67%), Gaps = 2/98 (2%)

Query: 4   VLSITHRGTGVALTA--YALGLAGVGLTTDINSVVSFVDALNLSAPILLAGKFILAFPVS 61
           V+SI HRGTGVAL+      GL+ + L  +  S + F+ +L L   ++ + KF+L FP+ 
Sbjct: 66  VMSICHRGTGVALSGGVSLFGLSALLLPGNFESYLMFIKSLCLGPALIHSAKFVLVFPLM 125

Query: 62  YHTANGIRHLIWDTGRALTIKKVYTTGYAMLGAAILTN 99
           YH+ NGIRHLIWD G+ L+I +VY +G A+L  A+L++
Sbjct: 126 YHSLNGIRHLIWDLGKGLSISQVYQSGVAVLMLAVLSS 163




Membrane-anchoring subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).
Cricetulus griseus (taxid: 10029)
>sp|P35720|C560_BOVIN Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Bos taurus GN=SDHC PE=1 SV=2 Back     alignment and function description
>sp|Q99643|C560_HUMAN Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Homo sapiens GN=SDHC PE=1 SV=1 Back     alignment and function description
>sp|Q9CZB0|C560_MOUSE Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Mus musculus GN=Sdhc PE=2 SV=1 Back     alignment and function description
>sp|D0VWV4|C560_PIG Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Sus scrofa GN=SDHC PE=1 SV=2 Back     alignment and function description
>sp|O74882|SDH3_SCHPO Succinate dehydrogenase cytochrome B subunit, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sdh3 PE=3 SV=1 Back     alignment and function description
>sp|P80481|C560_RECAM Succinate dehydrogenase cytochrome b560 subunit OS=Reclinomonas americana GN=SDH3 PE=3 SV=1 Back     alignment and function description
>sp|Q8T2T5|C560_DICDI Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Dictyostelium discoideum GN=sdhC PE=3 SV=1 Back     alignment and function description
>sp|Q4UKC1|DHSC_RICFE Succinate dehydrogenase cytochrome b556 subunit OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=sdhC PE=3 SV=1 Back     alignment and function description
>sp|P41085|DHSC_RICPR Succinate dehydrogenase cytochrome b556 subunit OS=Rickettsia prowazekii (strain Madrid E) GN=sdhC PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query105
195452088174 GK13274 [Drosophila willistoni] gi|19416 1.0 0.603 0.560 1e-23
194743886152 GF18258 [Drosophila ananassae] gi|190627 1.0 0.690 0.551 1e-23
195038233171 GH19420 [Drosophila grimshawi] gi|193894 1.0 0.614 0.542 2e-23
390179514171 GA19764 [Drosophila pseudoobscura pseudo 1.0 0.614 0.532 6e-23
195157732152 GL12041 [Drosophila persimilis] gi|19411 1.0 0.690 0.532 7e-23
195389516170 GJ23871 [Drosophila virilis] gi|19415150 1.0 0.617 0.532 1e-22
289742767173 succinate dehydrogenase cytochrome b sub 0.923 0.560 0.525 2e-21
289742765173 succinate dehydrogenase cytochrome b sub 1.0 0.606 0.495 2e-21
21064663171 RH04289p [Drosophila melanogaster] 1.0 0.614 0.532 4e-21
45550736171 succinate dehydrogenase C, isoform A [Dr 1.0 0.614 0.532 5e-21
>gi|195452088|ref|XP_002073207.1| GK13274 [Drosophila willistoni] gi|194169292|gb|EDW84193.1| GK13274 [Drosophila willistoni] Back     alignment and taxonomy information
 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 79/107 (73%), Gaps = 2/107 (1%)

Query: 1   ITSVLSITHRGTGVALTA--YALGLAGVGLTTDINSVVSFVDALNLSAPILLAGKFILAF 58
           +TS+LSITHRGTG+AL    +ALGL  +  + DI+  V+ V+ L LS   L A KFI+A+
Sbjct: 68  LTSILSITHRGTGMALGVGVWALGLGALISSHDISHYVTIVEGLQLSDAQLTAIKFIIAY 127

Query: 59  PVSYHTANGIRHLIWDTGRALTIKKVYTTGYAMLGAAILTNLVLTLL 105
           P  +HTANGIRHL+WDTGR L IK+VY+TGYAML A+ + + +L LL
Sbjct: 128 PAGFHTANGIRHLLWDTGRFLKIKEVYSTGYAMLAASFVLSGILALL 174




Source: Drosophila willistoni

Species: Drosophila willistoni

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|194743886|ref|XP_001954429.1| GF18258 [Drosophila ananassae] gi|190627466|gb|EDV42990.1| GF18258 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195038233|ref|XP_001990564.1| GH19420 [Drosophila grimshawi] gi|193894760|gb|EDV93626.1| GH19420 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|390179514|ref|XP_003736918.1| GA19764 [Drosophila pseudoobscura pseudoobscura] gi|388859883|gb|EIM52991.1| GA19764 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195157732|ref|XP_002019750.1| GL12041 [Drosophila persimilis] gi|194116341|gb|EDW38384.1| GL12041 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|195389516|ref|XP_002053422.1| GJ23871 [Drosophila virilis] gi|194151508|gb|EDW66942.1| GJ23871 [Drosophila virilis] Back     alignment and taxonomy information
>gi|289742767|gb|ADD20131.1| succinate dehydrogenase cytochrome b subunit [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|289742765|gb|ADD20130.1| succinate dehydrogenase cytochrome b subunit [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|21064663|gb|AAM29561.1| RH04289p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|45550736|ref|NP_650047.3| succinate dehydrogenase C, isoform A [Drosophila melanogaster] gi|442618548|ref|NP_001262472.1| succinate dehydrogenase C, isoform B [Drosophila melanogaster] gi|195329931|ref|XP_002031662.1| GM26120 [Drosophila sechellia] gi|17946639|gb|AAL49350.1| RH44771p [Drosophila melanogaster] gi|45446453|gb|AAF54602.2| succinate dehydrogenase C, isoform A [Drosophila melanogaster] gi|194120605|gb|EDW42648.1| GM26120 [Drosophila sechellia] gi|440217315|gb|AGB95854.1| succinate dehydrogenase C, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query105
FB|FBgn0037873171 SdhC "Succinate dehydrogenase 1.0 0.614 0.532 9.7e-25
UNIPROTKB|P70097169 SDHC "Succinate dehydrogenase 0.971 0.603 0.432 1.7e-18
ZFIN|ZDB-GENE-040801-26169 sdhc "succinate dehydrogenase 1.0 0.621 0.411 7.5e-18
UNIPROTKB|P35720169 SDHC "Succinate dehydrogenase 0.961 0.597 0.407 1.8e-16
UNIPROTKB|E2R9X3135 SDHC "Uncharacterized protein" 0.961 0.748 0.417 2.3e-16
MGI|MGI:1913302169 Sdhc "succinate dehydrogenase 0.904 0.562 0.402 2.3e-16
UNIPROTKB|E2R9X4168 SDHC "Uncharacterized protein" 0.933 0.583 0.43 2.9e-16
UNIPROTKB|Q99643169 SDHC "Succinate dehydrogenase 0.961 0.597 0.388 9.8e-16
UNIPROTKB|D0VWV4169 SDHC "Succinate dehydrogenase 0.961 0.597 0.398 3.3e-15
RGD|1359454169 Sdhc "succinate dehydrogenase 0.961 0.597 0.359 4.2e-15
FB|FBgn0037873 SdhC "Succinate dehydrogenase C" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 282 (104.3 bits), Expect = 9.7e-25, P = 9.7e-25
 Identities = 57/107 (53%), Positives = 76/107 (71%)

Query:     1 ITSVLSITHRGTGVALTA--YALGLAGVGLTTDINSVVSFVDALNLSAPILLAGKFILAF 58
             +TS+LSI HRGTG+AL    + LGL  +  + DI+  V+ V+ L LS   L A KFI+A+
Sbjct:    65 LTSMLSICHRGTGLALGVGVWGLGLGALISSHDISHYVTMVEGLQLSGATLTALKFIIAY 124

Query:    59 PVSYHTANGIRHLIWDTGRALTIKKVYTTGYAMLGAAILTNLVLTLL 105
             P  YHTANGIRHL+WDTGR L IK+VY+TGYAM+  + + + +L LL
Sbjct:   125 PAGYHTANGIRHLLWDTGRFLKIKEVYSTGYAMVATSFVLSAILALL 171




GO:0006105 "succinate metabolic process" evidence=ISS
GO:0000104 "succinate dehydrogenase activity" evidence=ISS
GO:0005749 "mitochondrial respiratory chain complex II" evidence=ISS
GO:0006099 "tricarboxylic acid cycle" evidence=ISS
GO:0006121 "mitochondrial electron transport, succinate to ubiquinone" evidence=ISS;IMP
GO:0008177 "succinate dehydrogenase (ubiquinone) activity" evidence=ISS
GO:0009055 "electron carrier activity" evidence=IEA
GO:0006979 "response to oxidative stress" evidence=IMP
GO:0008340 "determination of adult lifespan" evidence=IMP
UNIPROTKB|P70097 SDHC "Succinate dehydrogenase cytochrome b560 subunit, mitochondrial" [Cricetulus griseus (taxid:10029)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040801-26 sdhc "succinate dehydrogenase complex, subunit C, integral membrane protein" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P35720 SDHC "Succinate dehydrogenase cytochrome b560 subunit, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R9X3 SDHC "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1913302 Sdhc "succinate dehydrogenase complex, subunit C, integral membrane protein" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2R9X4 SDHC "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q99643 SDHC "Succinate dehydrogenase cytochrome b560 subunit, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|D0VWV4 SDHC "Succinate dehydrogenase cytochrome b560 subunit, mitochondrial" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1359454 Sdhc "succinate dehydrogenase complex, subunit C, integral membrane protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q92J99DHSC_RICCNNo assigned EC number0.33000.92380.7822yesN/A
Q1RHB5DHSC_RICBRNo assigned EC number0.35290.94280.792yesN/A
Q68XP1DHSC_RICTYNo assigned EC number0.32030.92380.7822yesN/A
Q4UKC1DHSC_RICFENo assigned EC number0.35920.92380.7822yesN/A
P41085DHSC_RICPRNo assigned EC number0.33000.92380.7822yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query105
cd03499117 cd03499, SQR_TypeC_SdhC, Succinate:quinone oxidore 3e-21
PLN00127178 PLN00127, PLN00127, succinate dehydrogenase (ubiqu 1e-13
pfam01127123 pfam01127, Sdh_cyt, Succinate dehydrogenase/Fumara 2e-13
TIGR02970120 TIGR02970, succ_dehyd_cytB, succinate dehydrogenas 2e-11
COG2009132 COG2009, SdhC, Succinate dehydrogenase/fumarate re 2e-09
cd0349398 cd03493, SQR_QFR_TM, Succinate:quinone oxidoreduct 1e-07
PRK09487129 PRK09487, sdhC, succinate dehydrogenase cytochrome 0.001
>gnl|CDD|239579 cd03499, SQR_TypeC_SdhC, Succinate:quinone oxidoreductase (SQR) Type C subfamily, Succinate dehydrogenase C (SdhC) subunit; composed of bacterial SdhC and eukaryotic large cytochrome b binding (CybL) proteins Back     alignment and domain information
 Score = 80.7 bits (200), Expect = 3e-21
 Identities = 38/106 (35%), Positives = 57/106 (53%), Gaps = 4/106 (3%)

Query: 1   ITSVLSITHRGTGVAL--TAYALGLAGVGLTTDINSVVSFVDALNLSAPILLAGKFILAF 58
           +T++LSI HR TGVAL      L    +   +   S  S    L   + +     F L +
Sbjct: 14  LTAILSILHRITGVALFLGLPLLLWWLLASLSSPESFESVSALL--GSWLGKLVLFGLTW 71

Query: 59  PVSYHTANGIRHLIWDTGRALTIKKVYTTGYAMLGAAILTNLVLTL 104
            + YH  NGIRHLIWD G+ L +K VY +GYA+L  +++  ++L +
Sbjct: 72  ALFYHLLNGIRHLIWDLGKGLELKTVYKSGYAVLVLSVVLTVLLGI 117


SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol. Members of this family reduce high potential quinones such as ubiquinone. SQR is also called succinate dehydrogenase or Complex II, and is part of the citric acid cycle and the aerobic respiratory chain. SQR is composed of a flavoprotein catalytic subunit, an iron-sulfur protein and one or two hydrophobic transmembrane subunits. Proteins in this subfamily are classified as Type C SQRs because they contain two transmembrane subunits and one heme group. The heme and quinone binding sites reside in the transmembrane subunits. The SdhC or CybL protein is one of the two transmembrane subunits of bacterial and eukaryotic SQRs. The two-electron oxidation of succinate in the flavoprotein active site is coupled to the two-electron reduction of quinone in the membrane anchor subunits via electron transport through FAD and three iron-sulfur centers. The reversible reduction of quinone is an essential feature of respiration, allowing transfer of electrons between respiratory complexes. Length = 117

>gnl|CDD|177738 PLN00127, PLN00127, succinate dehydrogenase (ubiquinone) cytochrome b subunit; Provisional Back     alignment and domain information
>gnl|CDD|216313 pfam01127, Sdh_cyt, Succinate dehydrogenase/Fumarate reductase transmembrane subunit Back     alignment and domain information
>gnl|CDD|234076 TIGR02970, succ_dehyd_cytB, succinate dehydrogenase, cytochrome b556 subunit Back     alignment and domain information
>gnl|CDD|224920 COG2009, SdhC, Succinate dehydrogenase/fumarate reductase, cytochrome b subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|239573 cd03493, SQR_QFR_TM, Succinate:quinone oxidoreductase (SQR) and Quinol:fumarate reductase (QFR) family, transmembrane subunits; SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol, while QFR catalyzes the reverse reaction Back     alignment and domain information
>gnl|CDD|181900 PRK09487, sdhC, succinate dehydrogenase cytochrome b556 large membrane subunit; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 105
PRK09487129 sdhC succinate dehydrogenase cytochrome b556 large 99.97
PLN00127178 succinate dehydrogenase (ubiquinone) cytochrome b 99.97
cd03499117 SQR_TypeC_SdhC Succinate:quinone oxidoreductase (S 99.96
TIGR02970120 succ_dehyd_cytB succinate dehydrogenase, cytochrom 99.96
KOG0449|consensus168 99.95
COG2009132 SdhC Succinate dehydrogenase/fumarate reductase, c 99.85
cd03501101 SQR_TypeA_SdhC_like Succinate:quinone oxidoreducta 99.79
cd0349398 SQR_QFR_TM Succinate:quinone oxidoreductase (SQR) 99.78
PF01127121 Sdh_cyt: Succinate dehydrogenase/Fumarate reductas 99.74
TIGR02968105 succ_dehyd_anc succinate dehydrogenase, hydrophobi 99.72
cd03500106 SQR_TypeA_SdhD_like Succinate:quinone oxidoreducta 99.55
PLN00130213 succinate dehydrogenase (SDH3); Provisional 99.43
cd0349499 SQR_TypeC_SdhD Succinate:quinone oxidoreductase (S 99.42
COG2142117 SdhD Succinate dehydrogenase, hydrophobic anchor s 99.18
cd03495100 SQR_TypeC_SdhD_like Succinate:quinone oxidoreducta 99.1
cd03497207 SQR_TypeB_1_TM Succinate:quinone oxidoreductase (S 98.73
PRK09488115 sdhD succinate dehydrogenase cytochrome b556 small 98.67
cd03498209 SQR_TypeB_2_TM Succinate:quinone oxidoreductase (S 98.14
cd03526199 SQR_QFR_TypeB_TM Succinate:quinone oxidoreductase 97.64
PLN00126129 succinate dehydrogenase, cytochrome b subunit fami 97.57
cd00581206 QFR_TypeB_TM Quinol:fumarate reductase (QFR) Type 97.38
TIGR02046214 sdhC_b558_fam succinate dehydrogenase (or fumarate 97.26
cd00581206 QFR_TypeB_TM Quinol:fumarate reductase (QFR) Type 97.03
cd03497207 SQR_TypeB_1_TM Succinate:quinone oxidoreductase (S 96.84
cd03526199 SQR_QFR_TypeB_TM Succinate:quinone oxidoreductase 96.78
cd03498 209 SQR_TypeB_2_TM Succinate:quinone oxidoreductase (S 96.54
PRK13554 241 fumarate reductase cytochrome b-556 subunit; Provi 96.53
PRK13553258 fumarate reductase cytochrome b-556 subunit; Provi 96.03
TIGR02046 214 sdhC_b558_fam succinate dehydrogenase (or fumarate 96.01
PRK13553 258 fumarate reductase cytochrome b-556 subunit; Provi 95.97
PRK13554241 fumarate reductase cytochrome b-556 subunit; Provi 95.59
PRK04987130 fumarate reductase subunit C; Provisional 94.71
PF02313118 Fumarate_red_D: Fumarate reductase subunit D; Inte 93.94
PF02300129 Fumarate_red_C: Fumarate reductase subunit C; Inte 91.48
cd00547115 QFR_TypeD_subunitD Quinol:fumarate reductase (QFR) 90.82
cd00546124 QFR_TypeD_subunitC Quinol:fumarate reductase (QFR) 89.18
PRK05470118 fumarate reductase subunit D; Provisional 88.95
cd03496104 SQR_TypeC_CybS SQR catalyzes the oxidation of succ 83.83
PRK13603126 fumarate reductase subunit C; Provisional 82.16
PF07950110 DUF1691: Protein of unknown function (DUF1691); In 81.89
>PRK09487 sdhC succinate dehydrogenase cytochrome b556 large membrane subunit; Provisional Back     alignment and domain information
Probab=99.97  E-value=4.4e-31  Score=178.87  Aligned_cols=98  Identities=20%  Similarity=0.248  Sum_probs=86.6

Q ss_pred             ChHHHHHHHHHHHHHHHHH-H---HHHHh-hcChhhHHHHHHHHHhccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Q psy9433           1 ITSVLSITHRGTGVALTAY-A---LGLAG-VGLTTDINSVVSFVDALNLSAPILLAGKFILAFPVSYHTANGIRHLIWDT   75 (105)
Q Consensus         1 it~~~SI~HRiTGv~L~~~-~---~~l~~-l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~yH~~nGiRHl~wD~   75 (105)
                      +||++||+||+||++|+++ .   +.+.. +.+|+.|+.+.+..++     +++|+++++++++++||++|||||++||.
T Consensus        22 ~t~~~SIlHRiSGv~L~~~~~~~~~~l~~~~~~p~~f~~~~~~~~~-----~~~k~~~~~~~~al~yH~~nGIRHL~wD~   96 (129)
T PRK09487         22 ITAIASILHRVSGVITFVAVGILLWLLGTSLSSPEGFEQAAAIMDS-----FFVKFIMWGILTALAYHVVVGIRHLLMDF   96 (129)
T ss_pred             hhHHHHHHHHhHhHHHHHHHHHHHHHHHHHccCHHHHHHHHHHHhH-----HHHHHHHHHHHHHHHHHHHhhHHHHHHHc
Confidence            5899999999999999987 2   33332 4799999999876655     48899999999999999999999999999


Q ss_pred             ccccc-HHHHHHHHHHHHHHHHHHHHHHH
Q psy9433          76 GRALT-IKKVYTTGYAMLGAAILTNLVLT  103 (105)
Q Consensus        76 g~g~~-~~~~~~~~~~v~~~s~v~t~~~~  103 (105)
                      |+|+| +|+.+++++.+++++++++++.+
T Consensus        97 g~g~~~~~~~~~sa~~v~~~s~vlt~~~g  125 (129)
T PRK09487         97 GYLEETLEAGKRSAKISFVITVVLSLLAG  125 (129)
T ss_pred             cccchhHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999 99999999999999999998764



>PLN00127 succinate dehydrogenase (ubiquinone) cytochrome b subunit; Provisional Back     alignment and domain information
>cd03499 SQR_TypeC_SdhC Succinate:quinone oxidoreductase (SQR) Type C subfamily, Succinate dehydrogenase C (SdhC) subunit; composed of bacterial SdhC and eukaryotic large cytochrome b binding (CybL) proteins Back     alignment and domain information
>TIGR02970 succ_dehyd_cytB succinate dehydrogenase, cytochrome b556 subunit Back     alignment and domain information
>KOG0449|consensus Back     alignment and domain information
>COG2009 SdhC Succinate dehydrogenase/fumarate reductase, cytochrome b subunit [Energy production and conversion] Back     alignment and domain information
>cd03501 SQR_TypeA_SdhC_like Succinate:quinone oxidoreductase (SQR) Type A subfamily, Succinate dehydrogenase C (SdhC)-like subunit; SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol Back     alignment and domain information
>cd03493 SQR_QFR_TM Succinate:quinone oxidoreductase (SQR) and Quinol:fumarate reductase (QFR) family, transmembrane subunits; SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol, while QFR catalyzes the reverse reaction Back     alignment and domain information
>PF01127 Sdh_cyt: Succinate dehydrogenase/Fumarate reductase transmembrane subunit; InterPro: IPR000701 This entry includes the transmembrane subunit from both succinate dehydrogenase and fumarate reductase complexes Back     alignment and domain information
>TIGR02968 succ_dehyd_anc succinate dehydrogenase, hydrophobic membrane anchor protein Back     alignment and domain information
>cd03500 SQR_TypeA_SdhD_like Succinate:quinone oxidoreductase (SQR) Type A subfamily, Succinate dehydrogenase D (SdhD)-like subunit; SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol Back     alignment and domain information
>PLN00130 succinate dehydrogenase (SDH3); Provisional Back     alignment and domain information
>cd03494 SQR_TypeC_SdhD Succinate:quinone oxidoreductase (SQR) Type C subfamily, Succinate dehydrogenase D (SdhD) subunit; SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol Back     alignment and domain information
>COG2142 SdhD Succinate dehydrogenase, hydrophobic anchor subunit [Energy production and conversion] Back     alignment and domain information
>cd03495 SQR_TypeC_SdhD_like Succinate:quinone oxidoreductase (SQR) Type C subfamily, Succinate dehydrogenase D (SdhD) subunit-like; composed of predominantly uncharacterized bacterial proteins with similarity to the E Back     alignment and domain information
>cd03497 SQR_TypeB_1_TM Succinate:quinone oxidoreductase (SQR) Type B subfamily 1, transmembrane subunit; composed of proteins similar to Bacillus subtilis SQR Back     alignment and domain information
>PRK09488 sdhD succinate dehydrogenase cytochrome b556 small membrane subunit; Provisional Back     alignment and domain information
>cd03498 SQR_TypeB_2_TM Succinate:quinone oxidoreductase (SQR)-like Type B subfamily 2, transmembrane subunit; composed of proteins with similarity to the SQRs of Geobacter metallireducens and Corynebacterium glutamicum Back     alignment and domain information
>cd03526 SQR_QFR_TypeB_TM Succinate:quinone oxidoreductase (SQR) and Quinol:fumarate reductase (QFR) Type B subfamily, transmembrane subunit; SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol, while QFR catalyzes the reverse reaction Back     alignment and domain information
>PLN00126 succinate dehydrogenase, cytochrome b subunit family; Provisional Back     alignment and domain information
>cd00581 QFR_TypeB_TM Quinol:fumarate reductase (QFR) Type B subfamily, transmembrane subunit; QFR couples the reduction of fumarate to succinate to the oxidation of quinol to quinone, the opposite reaction to that catalyzed by the related protein, succinate:quinone oxidoreductase (SQR) Back     alignment and domain information
>TIGR02046 sdhC_b558_fam succinate dehydrogenase (or fumarate reductase) cytochrome b subunit, b558 family Back     alignment and domain information
>cd00581 QFR_TypeB_TM Quinol:fumarate reductase (QFR) Type B subfamily, transmembrane subunit; QFR couples the reduction of fumarate to succinate to the oxidation of quinol to quinone, the opposite reaction to that catalyzed by the related protein, succinate:quinone oxidoreductase (SQR) Back     alignment and domain information
>cd03497 SQR_TypeB_1_TM Succinate:quinone oxidoreductase (SQR) Type B subfamily 1, transmembrane subunit; composed of proteins similar to Bacillus subtilis SQR Back     alignment and domain information
>cd03526 SQR_QFR_TypeB_TM Succinate:quinone oxidoreductase (SQR) and Quinol:fumarate reductase (QFR) Type B subfamily, transmembrane subunit; SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol, while QFR catalyzes the reverse reaction Back     alignment and domain information
>cd03498 SQR_TypeB_2_TM Succinate:quinone oxidoreductase (SQR)-like Type B subfamily 2, transmembrane subunit; composed of proteins with similarity to the SQRs of Geobacter metallireducens and Corynebacterium glutamicum Back     alignment and domain information
>PRK13554 fumarate reductase cytochrome b-556 subunit; Provisional Back     alignment and domain information
>PRK13553 fumarate reductase cytochrome b-556 subunit; Provisional Back     alignment and domain information
>TIGR02046 sdhC_b558_fam succinate dehydrogenase (or fumarate reductase) cytochrome b subunit, b558 family Back     alignment and domain information
>PRK13553 fumarate reductase cytochrome b-556 subunit; Provisional Back     alignment and domain information
>PRK13554 fumarate reductase cytochrome b-556 subunit; Provisional Back     alignment and domain information
>PRK04987 fumarate reductase subunit C; Provisional Back     alignment and domain information
>PF02313 Fumarate_red_D: Fumarate reductase subunit D; InterPro: IPR003418 Fumarate reductase is a membrane-bound flavoenzyme consisting of four subunits, A-B Back     alignment and domain information
>PF02300 Fumarate_red_C: Fumarate reductase subunit C; InterPro: IPR003510 Fumarate reductase is a membrane-bound flavoenzyme consisting of four subunits, A-B Back     alignment and domain information
>cd00547 QFR_TypeD_subunitD Quinol:fumarate reductase (QFR) Type D subfamily, 13kD hydrophobic subunit D; QFR couples the reduction of fumarate to succinate to the oxidation of quinol to quinone, the opposite reaction to that catalyzed by the related protein, succinate:quinine oxidoreductase (SQR) Back     alignment and domain information
>cd00546 QFR_TypeD_subunitC Quinol:fumarate reductase (QFR) Type D subfamily, 15kD hydrophobic subunit C; QFR couples the reduction of fumarate to succinate to the oxidation of quinol to quinone, the opposite reaction to that catalyzed by the related protein, succinate:quinine oxidoreductase (SQR) Back     alignment and domain information
>PRK05470 fumarate reductase subunit D; Provisional Back     alignment and domain information
>cd03496 SQR_TypeC_CybS SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol Back     alignment and domain information
>PRK13603 fumarate reductase subunit C; Provisional Back     alignment and domain information
>PF07950 DUF1691: Protein of unknown function (DUF1691); InterPro: IPR012472 This family of fungal proteins is uncharacterised Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query105
2fbw_C141 Avian Respiratory Complex Ii With Carboxin Bound Le 6e-16
1zoy_C140 Crystal Structure Of Mitochondrial Respiratory Comp 5e-15
2h88_C140 Avian Mitochondrial Respiratory Complex Ii At 1.8 A 1e-14
1yq3_C141 Avian Respiratory Complex Ii With Oxaloacetate And 1e-14
3vr8_C188 Mitochondrial Rhodoquinol-Fumarate Reductase From T 2e-10
>pdb|2FBW|C Chain C, Avian Respiratory Complex Ii With Carboxin Bound Length = 141 Back     alignment and structure

Iteration: 1

Score = 79.0 bits (193), Expect = 6e-16, Method: Compositional matrix adjust. Identities = 39/90 (43%), Positives = 56/90 (62%), Gaps = 2/90 (2%) Query: 5 LSITHRGTGVALT--AYALGLAGVGLTTDINSVVSFVDALNLSAPILLAGKFILAFPVSY 62 +SITHRGTGVAL+ +A + L V+ V +L+LS ++ + KF L FP+SY Sbjct: 38 MSITHRGTGVALSLGVSLFSVAALLLPEQFPHYVAVVKSLSLSPALIYSAKFALVFPLSY 97 Query: 63 HTANGIRHLIWDTGRALTIKKVYTTGYAML 92 HT NGIRHL+WD G+ + +V +G +L Sbjct: 98 HTWNGIRHLVWDMGKGFKLSQVEQSGVVVL 127
>pdb|1ZOY|C Chain C, Crystal Structure Of Mitochondrial Respiratory Complex Ii From Porcine Heart At 2.4 Angstroms Length = 140 Back     alignment and structure
>pdb|2H88|C Chain C, Avian Mitochondrial Respiratory Complex Ii At 1.8 Angstrom Resolution Length = 140 Back     alignment and structure
>pdb|1YQ3|C Chain C, Avian Respiratory Complex Ii With Oxaloacetate And Ubiquinone Length = 141 Back     alignment and structure
>pdb|3VR8|C Chain C, Mitochondrial Rhodoquinol-Fumarate Reductase From The Parasitic Nematode Ascaris Suum Length = 188 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query105
1zoy_C140 Large cytochrome binding protein, FAD-binding prot 3e-21
2h88_C140 Succinate dehydrogenase cytochrome B, large subun; 2e-20
3vr8_C188 Cytochrome B-large subunit; membrane protein, redu 3e-18
2wdq_C129 Succinate dehydrogenase cytochrome B556 subunit; s 3e-18
>1zoy_C Large cytochrome binding protein, FAD-binding protein; succinate, ubiquinone oxidoreductase, mitochondrial respiratory complex II; HET: FAD HEM EPH UQ1; 2.40A {Sus scrofa} PDB: 1zp0_C* 3abv_C* 3ae1_C* 3ae2_C* 3ae3_C* 3ae4_C* 3ae5_C* 3ae6_C* 3ae7_C* 3ae8_C* 3ae9_C* 3aea_C* 3aeb_C* 3aec_C* 3aed_C* 3aee_C* 3aef_C* 3aeg_C* 3sfd_C* 3sfe_C* Length = 140 Back     alignment and structure
 Score = 81.1 bits (200), Expect = 3e-21
 Identities = 40/107 (37%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 1   ITSVLSITHRGTGVALT--AYALGLAGVGLTTDINSVVSFVDALNLSAPILLAGKFILAF 58
           +   +SI HRGTG+AL+      GL+ + L  +  S +  V +L L   ++   KF + F
Sbjct: 34  LPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVF 93

Query: 59  PVSYHTANGIRHLIWDTGRALTIKKVYTTGYAMLGAAILTNLVLTLL 105
           P+ YHT NGIRHLIWD G+ LTI ++  +G  +L   +L+++ L  +
Sbjct: 94  PLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM 140


>2h88_C Succinate dehydrogenase cytochrome B, large subun; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 2h89_C* 1yq3_C* 1yq4_C* 2fbw_C* 2wqy_C* Length = 140 Back     alignment and structure
>3vr8_C Cytochrome B-large subunit; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_C* Length = 188 Back     alignment and structure
>2wdq_C Succinate dehydrogenase cytochrome B556 subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_C* 2acz_C* 1nek_C* 2wdr_C* 2wdv_C* 2wp9_C* 2ws3_C* 2wu5_C* 2wu2_C* Length = 129 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query105
3vr8_C188 Cytochrome B-large subunit; membrane protein, redu 100.0
1zoy_C140 Large cytochrome binding protein, FAD-binding prot 99.98
2h88_C140 Succinate dehydrogenase cytochrome B, large subun; 99.98
2wdq_C129 Succinate dehydrogenase cytochrome B556 subunit; s 99.97
2wdq_D115 Succinate dehydrogenase hydrophobic membrane ANCH 99.64
2bs2_C256 Quinol-fumarate reductase diheme cytochrome B subu 96.9
2bs2_C 256 Quinol-fumarate reductase diheme cytochrome B subu 93.83
1kf6_D119 Fumarate reductase 13 kDa hydrophobic protein; res 92.21
1kf6_C130 Fumarate reductase 15 kDa hydrophobic protein; res 87.1
2h88_D103 Succinate dehydrogenase cytochrome B, small subun; 81.02
>3vr8_C Cytochrome B-large subunit; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_C* Back     alignment and structure
Probab=100.00  E-value=1.2e-32  Score=195.25  Aligned_cols=104  Identities=35%  Similarity=0.531  Sum_probs=94.5

Q ss_pred             ChHHHHHHHHHHHHHHHHH--HHHHHhhcChhhHHHHHHHHHhccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccc
Q psy9433           1 ITSVLSITHRGTGVALTAY--ALGLAGVGLTTDINSVVSFVDALNLSAPILLAGKFILAFPVSYHTANGIRHLIWDTGRA   78 (105)
Q Consensus         1 it~~~SI~HRiTGv~L~~~--~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~yH~~nGiRHl~wD~g~g   78 (105)
                      +||++||+|||||++|+++  ++.+..+.+|++|+.+.+.++++..|.++.++++++++++++||++|||||++||+|+|
T Consensus        67 lt~~~SIlHRITGv~L~~~l~l~~la~l~sp~~f~~~~~~~~s~~lp~~i~~lvk~~l~~a~~yH~~nGIRHLiwD~G~g  146 (188)
T 3vr8_C           67 MTWMVSGLHRVTGCAMAGTLLIGGVGFSVLPLDFTTFVEFIRGLGIPWVILDTFKFIIAFPIAFHTLNGIRFIGFDMAKG  146 (188)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHhCccchHHHHHHHHHHHHHHHHHHHHhhHHHHHHHhccc
Confidence            4899999999999999988  34445578999999999988876567778899999999999999999999999999999


Q ss_pred             ccHHHHHHHHHHHHHHHHHHHHHHHh
Q psy9433          79 LTIKKVYTTGYAMLGAAILTNLVLTL  104 (105)
Q Consensus        79 ~~~~~~~~~~~~v~~~s~v~t~~~~~  104 (105)
                      +|+|+++++||+++++|+++++++++
T Consensus       147 l~l~~~~~sg~~vl~lSvvltl~la~  172 (188)
T 3vr8_C          147 TDIPSIYRGAYLVLGLAALISLAVVV  172 (188)
T ss_pred             ccHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999875



>1zoy_C Large cytochrome binding protein, FAD-binding protein; succinate, ubiquinone oxidoreductase, mitochondrial respiratory complex II; HET: FAD HEM EPH UQ1; 2.40A {Sus scrofa} PDB: 1zp0_C* 3abv_C* 3ae1_C* 3ae2_C* 3ae3_C* 3ae4_C* 3ae5_C* 3ae6_C* 3ae7_C* 3ae8_C* 3ae9_C* 3aea_C* 3aeb_C* 3aec_C* 3aed_C* 3aee_C* 3aef_C* 3aeg_C* 3sfd_C* 3sfe_C* Back     alignment and structure
>2h88_C Succinate dehydrogenase cytochrome B, large subun; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 2h89_C* 1yq3_C* 1yq4_C* 2fbw_C* 2wqy_C* Back     alignment and structure
>2wdq_C Succinate dehydrogenase cytochrome B556 subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_C* 2acz_C* 1nek_C* 2wdr_C* 2wdv_C* 2wp9_C* 2ws3_C* 2wu5_C* 2wu2_C* Back     alignment and structure
>2wdq_D Succinate dehydrogenase hydrophobic membrane ANCH subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_D* 2acz_D* 1nek_D* 2wdr_D* 2wdv_D* 2wp9_D* 2wu2_D* 2ws3_D* 2wu5_D* Back     alignment and structure
>2bs2_C Quinol-fumarate reductase diheme cytochrome B subunit C; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: f.21.2.1 PDB: 1qlb_C* 1e7p_C* 2bs3_C* 2bs4_C* Back     alignment and structure
>2bs2_C Quinol-fumarate reductase diheme cytochrome B subunit C; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: f.21.2.1 PDB: 1qlb_C* 1e7p_C* 2bs3_C* 2bs4_C* Back     alignment and structure
>1kf6_D Fumarate reductase 13 kDa hydrophobic protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: f.21.2.2 PDB: 1kfy_D* 1l0v_D* 2b76_D* 3cir_D* 3p4p_D* 3p4q_D* 3p4r_D* 3p4s_D* Back     alignment and structure
>1kf6_C Fumarate reductase 15 kDa hydrophobic protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: f.21.2.2 PDB: 1kfy_C* 1l0v_C* 2b76_C* 3cir_C* 3p4p_C* 3p4q_C* 3p4r_C* 3p4s_C* Back     alignment and structure
>2h88_D Succinate dehydrogenase cytochrome B, small subun; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_D* 1yq3_D* 2fbw_D* 2h89_D* 2wqy_D* 1zoy_D* 1zp0_D* 3abv_D* 3ae1_D* 3ae2_D* 3ae3_D* 3ae4_D* 3ae5_D* 3ae6_D* 3ae7_D* 3ae8_D* 3ae9_D* 3aea_D* 3aeb_D* 3aec_D* ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 105
d1nekc_129 f.21.2.2 (C:) Succinate dehydrogenase subunit SdhC 1e-14
>d1nekc_ f.21.2.2 (C:) Succinate dehydrogenase subunit SdhC {Escherichia coli [TaxId: 562]} Length = 129 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Heme-binding four-helical bundle
superfamily: Fumarate reductase respiratory complex transmembrane subunits
family: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD)
domain: Succinate dehydrogenase subunit SdhC
species: Escherichia coli [TaxId: 562]
 Score = 62.6 bits (152), Expect = 1e-14
 Identities = 21/106 (19%), Positives = 44/106 (41%), Gaps = 1/106 (0%)

Query: 1   ITSVLSITHRGTGVALTAYALGLAGVGLTTDINSVVSFVDALNLSAPILLAGKFILAFPV 60
           IT++ SI HR +GV        L  +  T+  +       +  + +  +    + +   +
Sbjct: 22  ITAIASILHRVSGVITFVAVGILLWLLGTSLSSPEGFEQASAIMGSFFVKFIMWGILTAL 81

Query: 61  SYHTANGIRHLIWDTGRAL-TIKKVYTTGYAMLGAAILTNLVLTLL 105
           +YH   GIRH++ D G    T +    +        ++ +L+  +L
Sbjct: 82  AYHVVVGIRHMMMDFGYLEETFEAGKRSAKISFVITVVLSLLAGVL 127


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query105
d1nekc_129 Succinate dehydrogenase subunit SdhC {Escherichia 99.97
d1nekd_113 Succinate dehydrogenase subunit SdhD {Escherichia 99.09
d2bs2c1254 Fumarate reductase respiratory complex cytochrome 97.82
d2bs2c1 254 Fumarate reductase respiratory complex cytochrome 96.05
d1kf6d_119 Fumarate reductase subunit FrdD {Escherichia coli 92.85
d1kf6c_130 Fumarate reductase subunit FrdC {Escherichia coli 92.47
>d1nekc_ f.21.2.2 (C:) Succinate dehydrogenase subunit SdhC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Heme-binding four-helical bundle
superfamily: Fumarate reductase respiratory complex transmembrane subunits
family: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD)
domain: Succinate dehydrogenase subunit SdhC
species: Escherichia coli [TaxId: 562]
Probab=99.97  E-value=1.9e-30  Score=172.86  Aligned_cols=99  Identities=19%  Similarity=0.237  Sum_probs=83.6

Q ss_pred             ChHHHHHHHHHHHHHHHHH-H-HH--HHh-hcChhhHHHHHHHHHhccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Q psy9433           1 ITSVLSITHRGTGVALTAY-A-LG--LAG-VGLTTDINSVVSFVDALNLSAPILLAGKFILAFPVSYHTANGIRHLIWDT   75 (105)
Q Consensus         1 it~~~SI~HRiTGv~L~~~-~-~~--l~~-l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~yH~~nGiRHl~wD~   75 (105)
                      +||++||+||+||++++++ . ..  +.. ..+|+.|+...+...     .++.|++++++.++++||.+|||||++||.
T Consensus        22 ~t~~~SI~HRisGv~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~yH~~nGIRHL~wD~   96 (129)
T d1nekc_          22 ITAIASILHRVSGVITFVAVGILLWLLGTSLSSPEGFEQASAIMG-----SFFVKFIMWGILTALAYHVVVGIRHMMMDF   96 (129)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHTT-----SHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccchHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHHHhHHHHHHHc
Confidence            4899999999999999998 2 22  222 367788877766543     347899999999999999999999999999


Q ss_pred             ccccc-HHHHHHHHHHHHHHHHHHHHHHHh
Q psy9433          76 GRALT-IKKVYTTGYAMLGAAILTNLVLTL  104 (105)
Q Consensus        76 g~g~~-~~~~~~~~~~v~~~s~v~t~~~~~  104 (105)
                      |+|+| +++.+++++++++++++.++.++.
T Consensus        97 G~g~~~~~~~~~s~~~~~~~si~~s~~~~~  126 (129)
T d1nekc_          97 GYLEETFEAGKRSAKISFVITVVLSLLAGV  126 (129)
T ss_dssp             TSSCCSHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ccchhhHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99986 899999999999999999998764



>d1nekd_ f.21.2.2 (D:) Succinate dehydrogenase subunit SdhD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2c1 f.21.2.1 (C:1-254) Fumarate reductase respiratory complex cytochrome b subunit, FrdC {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d2bs2c1 f.21.2.1 (C:1-254) Fumarate reductase respiratory complex cytochrome b subunit, FrdC {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1kf6d_ f.21.2.2 (D:) Fumarate reductase subunit FrdD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kf6c_ f.21.2.2 (C:) Fumarate reductase subunit FrdC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure