Psyllid ID: psy9488

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110----
MDNLICQLEIIITYLTLLYDKRPRYHKGITKVPPKDQKLFNKDNREMEEGNLLQEYGLTSAVAKAQSPALVGLAFRQENGEFEPLELTPYSSPPDLPYVMKASEQANGQENITS
ccccEEEEEEEEEccccHHHHHHcccccccccccccccccccccccccccccHHHcccccccccccccEEEEEEEEcccccccccEEEcccccccccccccccccccccccccc
ccccEEEEEEEEEcHHHHHHHHHHHHHHHHccccHHcEHEccccHHccccccHHHccccccccccccccEEEEEEEccccccccccEccccccccccHHHcccccccccccccc
MDNLICQLEIIITYLTLlydkrpryhkgitkvppkdqklfnkdnremeEGNLLQEYGLTSAVAKAQSPALVGLAFrqengefepleltpyssppdlpyvmkaseqangqenits
MDNLICQLEIIITYLTLLYDKRpryhkgitkvppkdqklfnKDNREMEEGNLLQEYGLTSAVAKAQSPALVGLAFRQENGEFEPLELTPYSSPPDLPYVMKASeqangqenits
MDNLICQLEiiityltllyDKRPRYHKGITKVPPKDQKLFNKDNREMEEGNLLQEYGLTSAVAKAQSPALVGLAFRQENGEFEPLELTPYSSPPDLPYVMKASEQANGQENITS
***LICQLEIIITYLTLLYDKRPRYHKGIT************************EYGLTSAVA*****ALVGLAF***************************************
***LICQLEIIITYLTLLYDKRPRYHKGITKVPPKDQKLFNKDNREMEEGNLLQEYGLTSAVAKAQSPALVGLAFRQENGEFEPLELTPYSSPPDL******************
MDNLICQLEIIITYLTLLYDKRPRYHKGITKVPPKDQKLFNKDNREMEEGNLLQEYGLTSAVAKAQSPALVGLAFRQENGEFEPLELTPYSSPPDLPYVMKASE**********
*DNLICQLEIIITYLTLLYDKRPRYHKGITKVPPKDQKLFNKDNREMEEGNLLQEYGLTSAVAKAQSPALVGLAFRQENGEFEPLELTPYSSPPDLPY****************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDNLICQLEIIITYLTLLYDKRPRYHKGITKVPPKDQKLFNKDNREMEEGNLLQEYGLTSAVAKAQSPALVGLAFRQENGEFEPLELTPYSSPPDLPYVMKASEQANGQENITS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query114 2.2.26 [Sep-21-2011]
P62870118 Transcription elongation no N/A 0.710 0.686 0.477 4e-14
P62869118 Transcription elongation yes N/A 0.710 0.686 0.477 4e-14
Q15370118 Transcription elongation no N/A 0.719 0.694 0.464 1e-13
>sp|P62870|ELOB_RAT Transcription elongation factor B polypeptide 2 OS=Rattus norvegicus GN=Tceb2 PE=1 SV=1 Back     alignment and function desciption
 Score = 76.6 bits (187), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 43/90 (47%), Positives = 61/90 (67%), Gaps = 9/90 (10%)

Query: 24  RYHKGITKVPPKDQKLFNKDNREMEEGNLLQEYGLTSAVAKAQSPALVGLAFRQENGEFE 83
           R  +GI K PP++Q+L+ KD++ +++G  L E G TS  A+ Q+PA VGLAFR ++  FE
Sbjct: 29  RIVEGILKRPPEEQRLY-KDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADD-TFE 86

Query: 84  PLELTPYSSPPDLPYVMK-------ASEQA 106
            L + P+SSPP+LP VMK       A+EQA
Sbjct: 87  ALRIEPFSSPPELPDVMKPQDSGGSANEQA 116
The elongin BC complex seems to be involved as an adapter protein in the proteasomal degradation of target proteins via different E3 ubiquitin ligase complexes, including the von Hippel-Lindau ubiquitination complex CBC(VHL). By binding to BC-box motifs it seems to link target recruitment subunits, like VHL and members of the SOCS box family, to Cullin/RBX1 modules that activate E2 ubiquitination enzymes.
Rattus norvegicus (taxid: 10116)
>sp|P62869|ELOB_MOUSE Transcription elongation factor B polypeptide 2 OS=Mus musculus GN=Tceb2 PE=1 SV=1 Back     alignment and function description
>sp|Q15370|ELOB_HUMAN Transcription elongation factor B polypeptide 2 OS=Homo sapiens GN=TCEB2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query114
189234128117 PREDICTED: similar to elongin b [Triboli 0.728 0.709 0.690 3e-25
307199861106 Transcription elongation factor B polype 0.754 0.811 0.655 6e-25
332373726117 unknown [Dendroctonus ponderosae] 0.728 0.709 0.654 7e-25
340713162117 PREDICTED: transcription elongation fact 0.754 0.735 0.655 8e-25
383865999114 PREDICTED: transcription elongation fact 0.754 0.754 0.632 4e-24
350417093117 PREDICTED: transcription elongation fact 0.754 0.735 0.643 4e-24
332024064112 Transcription elongation factor B polype 0.754 0.767 0.643 5e-24
357627167114 hypothetical protein KGM_08943 [Danaus p 0.745 0.745 0.662 2e-23
66507736117 PREDICTED: transcription elongation fact 0.754 0.735 0.620 2e-23
17738069118 elongin B [Drosophila melanogaster] gi|1 0.780 0.754 0.573 4e-23
>gi|189234128|ref|XP_969235.2| PREDICTED: similar to elongin b [Tribolium castaneum] gi|270002530|gb|EEZ98977.1| hypothetical protein TcasGA2_TC004834 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 69/84 (82%), Gaps = 1/84 (1%)

Query: 27  KGITKVPPKDQKLFNKDNREMEEGNLLQEYGLTSAVAKAQSPALVGLAFRQENGEFEPLE 86
           +GI K+PP+DQ+LFNKDN  ME+  +LQ+YGLTSA AKAQSPA VGLA R+    FE LE
Sbjct: 32  EGILKIPPQDQQLFNKDNTIMEDDRMLQDYGLTSATAKAQSPATVGLAVRESVDTFEHLE 91

Query: 87  LTPYSSPPDLPYVMKASEQANGQE 110
           LTPYS+PPDLP VMK S++ANGQE
Sbjct: 92  LTPYSAPPDLPDVMK-SQEANGQE 114

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307199861|gb|EFN80258.1| Transcription elongation factor B polypeptide 2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332373726|gb|AEE62004.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|340713162|ref|XP_003395116.1| PREDICTED: transcription elongation factor B polypeptide 2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|383865999|ref|XP_003708459.1| PREDICTED: transcription elongation factor B polypeptide 2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350417093|ref|XP_003491253.1| PREDICTED: transcription elongation factor B polypeptide 2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|332024064|gb|EGI64281.1| Transcription elongation factor B polypeptide 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|357627167|gb|EHJ76942.1| hypothetical protein KGM_08943 [Danaus plexippus] Back     alignment and taxonomy information
>gi|66507736|ref|XP_623908.1| PREDICTED: transcription elongation factor B polypeptide 2 [Apis mellifera] gi|380020921|ref|XP_003694324.1| PREDICTED: transcription elongation factor B polypeptide 2-like [Apis florea] Back     alignment and taxonomy information
>gi|17738069|ref|NP_524416.1| elongin B [Drosophila melanogaster] gi|194899742|ref|XP_001979417.1| GG15357 [Drosophila erecta] gi|195353959|ref|XP_002043469.1| GM23182 [Drosophila sechellia] gi|195569429|ref|XP_002102712.1| GD20055 [Drosophila simulans] gi|2780363|dbj|BAA24286.1| Elongin B [Drosophila melanogaster] gi|10726654|gb|AAG22163.1| elongin B [Drosophila melanogaster] gi|190651120|gb|EDV48375.1| GG15357 [Drosophila erecta] gi|194127610|gb|EDW49653.1| GM23182 [Drosophila sechellia] gi|194198639|gb|EDX12215.1| GD20055 [Drosophila simulans] gi|220952218|gb|ACL88652.1| Elongin-B-PA [synthetic construct] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query114
MGI|MGI:1914923118 Tceb2 "transcription elongatio 0.745 0.720 0.465 3.3e-15
RGD|621200118 Tceb2 "transcription elongatio 0.745 0.720 0.465 3.3e-15
UNIPROTKB|Q3SZ32118 TCEB2 "Transcription elongatio 0.719 0.694 0.464 8.8e-15
UNIPROTKB|B8ZZU8113 TCEB2 "Transcription elongatio 0.719 0.725 0.464 2.3e-14
UNIPROTKB|Q15370118 TCEB2 "Transcription elongatio 0.719 0.694 0.464 2.3e-14
WB|WBGene00001235118 elb-1 [Caenorhabditis elegans 0.657 0.635 0.357 0.00027
UNIPROTKB|G5ECR7118 elb-1 "RNA polymerase II trans 0.657 0.635 0.357 0.00027
MGI|MGI:1914923 Tceb2 "transcription elongation factor B (SIII), polypeptide 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 192 (72.6 bits), Expect = 3.3e-15, P = 3.3e-15
 Identities = 41/88 (46%), Positives = 60/88 (68%)

Query:    24 RYHKGITKVPPKDQKLFNKDNREMEEGNLLQEYGLTSAVAKAQSPALVGLAFRQENGEFE 83
             R  +GI K PP++Q+L+ KD++ +++G  L E G TS  A+ Q+PA VGLAFR ++  FE
Sbjct:    29 RIVEGILKRPPEEQRLY-KDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADD-TFE 86

Query:    84 PLELTPYSSPPDLPYVMKASEQANGQEN 111
              L + P+SSPP+LP VMK  + + G  N
Sbjct:    87 ALRIEPFSSPPELPDVMKPQD-SGGSAN 113
GO:0001076 "RNA polymerase II transcription factor binding transcription factor activity" evidence=ISO
GO:0005515 "protein binding" evidence=IPI
GO:0005634 "nucleus" evidence=IEA
GO:0005667 "transcription factor complex" evidence=ISO
GO:0006351 "transcription, DNA-dependent" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0006366 "transcription from RNA polymerase II promoter" evidence=ISO
GO:0030891 "VCB complex" evidence=ISO
GO:0031462 "Cul2-RING ubiquitin ligase complex" evidence=ISO
GO:0031466 "Cul5-RING ubiquitin ligase complex" evidence=ISO
GO:0031625 "ubiquitin protein ligase binding" evidence=ISO
GO:0032403 "protein complex binding" evidence=ISO
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=ISO
RGD|621200 Tceb2 "transcription elongation factor B (SIII), polypeptide 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SZ32 TCEB2 "Transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B)" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|B8ZZU8 TCEB2 "Transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B), isoform CRA_b" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q15370 TCEB2 "Transcription elongation factor B polypeptide 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00001235 elb-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|G5ECR7 elb-1 "RNA polymerase II transcription factor SIII p18 subunit" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P62869ELOB_MOUSENo assigned EC number0.47770.71050.6864yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
cd01788119 cd01788, ElonginB, Ubiquitin-like domain of Elongi 6e-21
>gnl|CDD|176383 cd01788, ElonginB, Ubiquitin-like domain of Elongin B Back     alignment and domain information 
 Score = 80.5 bits (198), Expect = 6e-21
 Identities = 44/90 (48%), Positives = 61/90 (67%), Gaps = 8/90 (8%)

Query: 24  RYHKGITKVPPKDQKLFNKDNREMEEGNLLQEYGLTSAVAKAQSPALVGLAFRQENGEFE 83
           R  +GI K PP+DQ+L+ KD++ +++G  L + G TS  A+ Q+PA VGLAFR  +  FE
Sbjct: 29  RIVEGILKRPPEDQRLY-KDDQLLDDGKTLGDCGFTSQTARPQAPATVGLAFRSSDDTFE 87

Query: 84  PLELTPYSSPPDLPYVMK-------ASEQA 106
           PL + P+SSPP+LP VMK       A+EQA
Sbjct: 88  PLRIEPFSSPPELPDVMKPQDSGSSANEQA 117

Elongin B is part of an E3 ubiquitin ligase complex called VEC that activates ubiquitylation by the E2 ubiquitin-conjugating enzyme Ubc5. VEC is composed of von Hippel-Lindau tumor suppressor protein (pVHL), elongin C, cullin 2, NEDD8, and Rbx1. ElonginB binds elonginC to form the elonginBC complex which is a positive regulator of RNA polymerase II elongation factor Elongin A. The BC complex then binds VHL (von Hippel-Lindau) tumour suppressor protein to form a VCB ternary complex. Elongin B has a ubiquitin-llike domain. Length = 119

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 114
cd01788119 ElonginB Ubiquitin-like domain of Elongin B. Elong 100.0
KOG4495|consensus110 100.0
PF0024069 ubiquitin: Ubiquitin family; InterPro: IPR000626 U 98.63
cd0180376 Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 98.63
cd0180774 GDX_N ubiquitin-like domain of GDX. GDX contains a 98.41
cd0179374 Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui 98.4
cd0179975 Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO 98.39
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 98.36
cd0181074 ISG15_repeat2 ISG15 ubiquitin-like protein, second 98.34
PTZ0004476 ubiquitin; Provisional 98.3
cd0180972 Scythe_N Ubiquitin-like domain of Scythe protein. 98.27
cd0180076 SF3a120_C Ubiquitin-like domain of Mammalian splic 98.24
cd0179778 NIRF_N amino-terminal ubiquitin-like domain of Np9 98.23
cd0180577 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo 98.18
cd0181271 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter 98.17
smart0021364 UBQ Ubiquitin homologues. Ubiquitin-mediated prote 98.16
cd0179470 DC_UbP_C dendritic cell derived ubiquitin-like pro 98.15
cd0180871 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC 98.15
cd0179870 parkin_N amino-terminal ubiquitin-like of parkin p 98.15
cd01795107 USP48_C USP ubiquitin-specific protease. The USP ( 98.13
cd0179280 ISG15_repeat1 ISG15 ubiquitin-like protein, first 98.12
cd0179173 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know 98.1
cd0179671 DDI1_N DNA damage inducible protein 1 ubiquitin-li 97.96
cd0180478 midnolin_N Ubiquitin-like domain of midnolin. midn 97.94
cd01802103 AN1_N ubiquitin-like domain of AN1. AN1 (also know 97.9
PF1456087 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K 97.79
cd0178984 Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol 97.7
cd0176969 UBL Ubiquitin-like domain of UBL. UBLs function by 97.69
cd0181374 UBP_N UBP ubiquitin processing protease. The UBP ( 97.62
cd0181575 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC 97.61
KOG0004|consensus156 97.24
cd01814113 NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT 97.13
TIGR00601 378 rad23 UV excision repair protein Rad23. All protei 97.06
cd0179079 Herp_N Homocysteine-responsive endoplasmic reticul 96.99
cd0180177 Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- 96.71
KOG0003|consensus128 96.23
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 95.87
KOG0001|consensus75 95.8
PLN02560 308 enoyl-CoA reductase 95.79
PF13881111 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB 94.54
KOG0011|consensus 340 94.38
PF1154380 UN_NPL4: Nuclear pore localisation protein NPL4; I 93.97
KOG0010|consensus 493 93.57
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 92.66
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 91.4
KOG4248|consensus 1143 83.53
KOG0005|consensus70 80.78
>cd01788 ElonginB Ubiquitin-like domain of Elongin B Back     alignment and domain information 
Probab=100.00  E-value=4.8e-55  Score=320.71  Aligned_cols=108  Identities=39%  Similarity=0.661  Sum_probs=105.2

Q ss_pred             ceeehhhhhhhh--hhhhhccchhhccccCCCCccceeccccccccccchhhhccccccccccCCCceeeeEeecCCCcc
Q psy9488           5 ICQLEIIITYLT--LLYDKRPRYHKGITKVPPKDQKLFNKDNREMEEGNLLQEYGLTSAVAKAQSPALVGLAFRQENGEF   82 (114)
Q Consensus         5 ~~~~~~i~t~~~--~~~~~LK~iIeGIlK~pP~dQrL~~kd~qlLdD~KTL~dcG~tsqtAkaQ~PA~vGLA~r~~~~~F   82 (114)
                      -.|||+|||++|  ++|.|||||||||+|+||++|||| |++++|||+|||+|||||||+||||+||+||||||.++|+|
T Consensus         8 rR~KTTiF~dakes~tVlelK~~iegI~k~pp~dQrL~-kd~qvLeD~kTL~d~g~t~~~akaq~pA~vgLa~r~~d~~f   86 (119)
T cd01788           8 RRHKTTIFTDAKESTTVYELKRIVEGILKRPPEDQRLY-KDDQLLDDGKTLGDCGFTSQTARPQAPATVGLAFRSSDDTF   86 (119)
T ss_pred             EecceEEEeecCCcccHHHHHHHHHHHhcCChhHheee-cCceeecccccHHHcCccccccccCCCCeEEEEEecCCCCc
Confidence            479999999999  999999999999999999999999 99999999999999999999999999999999999989999


Q ss_pred             cceeeecCCCCCCCccccccccccCCccccC
Q psy9488          83 EPLELTPYSSPPDLPYVMKASEQANGQENIT  113 (114)
Q Consensus        83 E~L~I~P~SsPP~LPdvMk~q~s~~~~~~~~  113 (114)
                      |+|+|+|||+|||||||||||++++++++++
T Consensus        87 E~l~I~p~S~pp~lPdvmk~q~~~~~~~~~~  117 (119)
T cd01788          87 EPLRIEPFSSPPELPDVMKPQDSGSSANEQA  117 (119)
T ss_pred             cceeeeeCCCCCCchhhhccccCCCcccccc
Confidence            9999999999999999999999999998875

Elongin B is part of an E3 ubiquitin ligase complex called VEC that activates ubiquitylation by the E2 ubiquitin-conjugating enzyme Ubc5. VEC is composed of von Hippel-Lindau tumor suppressor protein (pVHL), elongin C, cullin 2, NEDD8, and Rbx1. ElonginB binds elonginC to form the elonginBC complex which is a positive regulator of RNA polymerase II elongation factor Elongin A. The BC complex then binds VHL (von Hippel-Lindau) tumour suppressor protein to form a VCB ternary complex. Elongin B has a ubiquitin-llike domain.
>KOG4495|consensus Back     alignment and domain information
>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade Back     alignment and domain information
>cd01803 Ubiquitin Ubiquitin Back     alignment and domain information
>cd01807 GDX_N ubiquitin-like domain of GDX Back     alignment and domain information
>cd01793 Fubi Fubi ubiquitin-like protein Back     alignment and domain information
>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 Back     alignment and domain information
>PTZ00044 ubiquitin; Provisional Back     alignment and domain information
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 Back     alignment and domain information
>cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF Back     alignment and domain information
>cd01805 RAD23_N Ubiquitin-like domain of RAD23 Back     alignment and domain information
>cd01812 BAG1_N Ubiquitin-like domain of BAG1 Back     alignment and domain information
>smart00213 UBQ Ubiquitin homologues Back     alignment and domain information
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein Back     alignment and domain information
>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 Back     alignment and domain information
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein Back     alignment and domain information
>cd01795 USP48_C USP ubiquitin-specific protease Back     alignment and domain information
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 Back     alignment and domain information
>cd01791 Ubl5 UBL5 ubiquitin-like modifier Back     alignment and domain information
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>cd01804 midnolin_N Ubiquitin-like domain of midnolin Back     alignment and domain information
>cd01802 AN1_N ubiquitin-like domain of AN1 Back     alignment and domain information
>PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A Back     alignment and domain information
>cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B Back     alignment and domain information
>cd01769 UBL Ubiquitin-like domain of UBL Back     alignment and domain information
>cd01813 UBP_N UBP ubiquitin processing protease Back     alignment and domain information
>cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP Back     alignment and domain information
>KOG0004|consensus Back     alignment and domain information
>cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein Back     alignment and domain information
>cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 Back     alignment and domain information
>KOG0003|consensus Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>KOG0001|consensus Back     alignment and domain information
>PLN02560 enoyl-CoA reductase Back     alignment and domain information
>PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A Back     alignment and domain information
>KOG0011|consensus Back     alignment and domain information
>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway Back     alignment and domain information
>KOG0010|consensus Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>KOG4248|consensus Back     alignment and domain information
>KOG0005|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
2fnj_B118 Crystal Structure Of A B30.2SPRY DOMAIN-Containing 5e-15
4b9k_A104 Pvhl-Elob-Eloc Complex_(2s,4r)-1-(3-Amino-2-Methylb 9e-15
1vcb_A118 The Vhl-Elonginc-Elonginb Structure Length = 118 1e-14
>pdb|2FNJ|B Chain B, Crystal Structure Of A B30.2SPRY DOMAIN-Containing Protein Gustavus In Complex With Elongin B And Elongin C Length = 118 Back     alignment and structure 
Iteration: 1

 Score = 75.9 bits (185), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 56/78 (71%), Gaps = 2/78 (2%)
Query: 24  RYHKGITKVPPKDQKLFNKDNREMEEGNLLQEYGLTSAVAKAQSPALVGLAFRQENGEFE 83
           R  +GI K PP++Q+L+ KD++ +++G  L E G TS  A+ Q+PA VGLAFR ++  FE
Sbjct: 29  RIVEGILKRPPEEQRLY-KDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADD-TFE 86
Query: 84  PLELTPYSSPPDLPYVMK 101
            L + P+SSPP+LP VMK
Sbjct: 87  ALRIEPFSSPPELPDVMK 104
>pdb|4B9K|A Chain A, Pvhl-Elob-Eloc Complex_(2s,4r)-1-(3-Amino-2-Methylbenzoyl)-4- Hydroxy-N-(4-(4-Methylthiazol-5-Yl)benzyl) Pyrrolidine-2-Carboxamide Bound Length = 104 Back     alignment and structure
>pdb|1VCB|A Chain A, The Vhl-Elonginc-Elonginb Structure Length = 118 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
2fnj_B118 Transcription elongation factor B polypeptide 2; b 2e-25
>2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A Length = 118 Back     alignment and structure
 Score = 91.6 bits (227), Expect = 2e-25
 Identities = 38/83 (45%), Positives = 55/83 (66%), Gaps = 2/83 (2%)

Query: 28  GITKVPPKDQKLFNKDNREMEEGNLLQEYGLTSAVAKAQSPALVGLAFRQENGEFEPLEL 87
           GI K PP++Q+L+ KD++ +++G  L E G TS  A+ Q+PA VGLAFR ++  FE L +
Sbjct: 33  GILKRPPEEQRLY-KDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADD-TFEALRI 90

Query: 88  TPYSSPPDLPYVMKASEQANGQE 110
            P+SSPP+LP VMK  +      
Sbjct: 91  EPFSSPPELPDVMKPQDSGGSAN 113

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query114
4ajy_B118 Transcription elongation factor B polypeptide 2; E 100.0
2fnj_B118 Transcription elongation factor B polypeptide 2; b 100.0
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 98.65
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 98.64
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 98.58
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 98.57
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 98.55
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 98.55
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 98.55
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 98.54
2kjr_A95 CG11242; UBL, ubiquitin, ubiquitin-like, structura 98.54
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 98.53
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 98.53
3v6c_B91 Ubiquitin; structural genomics, structural genomic 98.53
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 98.52
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 98.51
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 98.51
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 98.5
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 98.5
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 98.48
1v6e_A95 Cytoskeleton-associated protein 1; tubulin-specifi 98.47
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 98.46
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 98.46
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 98.46
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 98.45
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 98.45
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 98.44
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 98.43
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 98.41
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 98.41
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 98.4
1we6_A111 Splicing factor, putative; structural genomics, ub 98.39
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 98.39
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 98.39
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 97.74
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 98.38
2lxa_A87 Ubiquitin-like protein MDY2; ubiquitin-like domain 98.36
1t0y_A122 Tubulin folding cofactor B; ubiquitin-like, cytosk 98.36
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 98.36
3m62_B106 UV excision repair protein RAD23; armadillo-like r 98.35
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 98.35
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 98.35
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 98.34
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 98.34
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 98.33
4b6w_A86 Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik 98.33
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 98.32
3vdz_A111 Ubiquitin-40S ribosomal protein S27A; gadolinium, 98.32
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 98.31
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 98.31
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 98.31
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 98.28
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 98.27
2kj6_A97 Tubulin folding cofactor B; methods development, N 98.27
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 98.26
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 98.25
1x1m_A107 Ubiquitin-like protein SB132; structural genomics, 98.22
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 98.21
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 98.21
1wju_A100 NEDD8 ultimate buster-1; ubiquitin-like domain, st 98.15
1wf9_A107 NPL4 family protein; beta-grAsp fold like domain, 98.14
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 98.12
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 98.11
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 98.09
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 98.08
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 98.05
3u5c_f152 40S ribosomal protein S31; translation, ribosome, 98.04
4a20_A98 Ubiquitin-like protein MDY2; protein binding, GET- 98.03
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 98.0
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 97.98
1wjn_A97 Tubulin-folding protein TBCE; ubiquitin-like domai 97.97
2daf_A118 FLJ35834 protein; hypothetical protein FLJ35834, u 97.96
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 97.94
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 97.93
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 97.91
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 97.85
2dzj_A88 Synaptic glycoprotein SC2; ubiquitin-like fold, st 97.82
1wgh_A116 Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo 97.77
3ai5_A307 Yeast enhanced green fluorescent protein, ubiquit; 97.75
2dzm_A100 FAS-associated factor 1; ubiquitin-like domain, HF 97.74
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 97.74
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 97.64
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 97.6
1se9_A126 Ubiquitin family; ubiquitin-like, cell-free, wheat 97.58
1oqy_A 368 HHR23A, UV excision repair protein RAD23 homolog A 97.45
2kzr_A86 Ubiquitin thioesterase OTU1; structural genomics, 97.1
2xzm_9189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 97.09
3shq_A 320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 96.91
3ivf_A 371 Talin-1; FERM domain, cell membrane, cell projecti 91.31
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 90.73
1wm3_A72 Ubiquitin-like protein SMT3B; ubiquitin fold, half 89.93
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 89.47
4a3p_A217 Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {H 89.41
3a4r_A79 Nfatc2-interacting protein; ubiquitin fold, coiled 88.79
2pjh_A80 Protein NPL4, nuclear protein localization protein 88.62
3jyu_A231 Ubiquitin carboxyl-terminal hydrolase; domain in u 87.92
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 86.74
2d07_B93 Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho 84.22
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 83.57
2bps_A81 YUKD protein; ubiquitin-like protein, ubiquitin; 2 82.19
>4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* Back     alignment and structure
Probab=100.00  E-value=2.6e-42  Score=250.39  Aligned_cols=108  Identities=38%  Similarity=0.622  Sum_probs=94.0

Q ss_pred             cceeehhhhhhhh--hhhhhccchhhccccCCCCccceeccccccccccchhhhccccccccccCCCceeeeEeecCCCc
Q psy9488           4 LICQLEIIITYLT--LLYDKRPRYHKGITKVPPKDQKLFNKDNREMEEGNLLQEYGLTSAVAKAQSPALVGLAFRQENGE   81 (114)
Q Consensus         4 ~~~~~~~i~t~~~--~~~~~LK~iIeGIlK~pP~dQrL~~kd~qlLdD~KTL~dcG~tsqtAkaQ~PA~vGLA~r~~~~~   81 (114)
                      +-+||++|+.+++  .||.+||++|+++.++||+.|||+ ..|.+|+|.+||+|||++++|||||+||+|+|+||. +|+
T Consensus         7 Ikr~ktTI~ldve~sdTV~~lK~kI~~~~giPp~qQrLI-~~Gk~LeD~kTL~dy~I~~~ta~~q~~atl~Lvlr~-~~~   84 (118)
T 4ajy_B            7 IRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLY-KDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRA-DDT   84 (118)
T ss_dssp             EEEBTEEEEEEEETTSBHHHHHHHHHHHHCCCGGGEEEE-ETTEECCTTSBTTTTTCCGGGSBTTBCEEEEEEECC-SSC
T ss_pred             EecCCEEEEEEcCCCChHHHHHHHHHHHHCCCHHHeEEE-eCCeECCCcCCHHHcCCCcCcccCCCCCEEEEEEec-CCC
Confidence            4589999999888  899999999999999999999999 999999999999999999999999999999999998 799


Q ss_pred             ccceeeecCCCCCCCccccccccccCCccccC
Q psy9488          82 FEPLELTPYSSPPDLPYVMKASEQANGQENIT  113 (114)
Q Consensus        82 FE~L~I~P~SsPP~LPdvMk~q~s~~~~~~~~  113 (114)
                      ||+|+|+|||+|||||||||||+++++++++|
T Consensus        85 fE~l~i~p~s~pp~lp~~~~~~~~~~~~~~~~  116 (118)
T 4ajy_B           85 FEALCIEPFSSPPELPDVMKPQDSGSSANEQA  116 (118)
T ss_dssp             CCCCCBCCCCCCCCCCGGGCC-----------
T ss_pred             ccceEEecCCCCCCccccccccccCCCccccc
Confidence            99999999999999999999999988888876
>2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Back     alignment and structure
>2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f Back     alignment and structure
>4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* Back     alignment and structure
>2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Back     alignment and structure
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Back     alignment and structure
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Back     alignment and structure
>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4a3p_A Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {Homo sapiens} PDB: 4a3o_A 3pv1_A 3ppa_A* 3t9l_A 3lmn_A Back     alignment and structure
>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Back     alignment and structure
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Back     alignment and structure
>3jyu_A Ubiquitin carboxyl-terminal hydrolase; domain in ubiquitin-specific peptidases (DUSP), proto- oncogene, ubiquitin-fold, UBL, protease, thioesterase; HET: 1PS; 2.37A {Mus musculus} Back     alignment and structure
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Back     alignment and structure
>2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 114
d2c9wb1103 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) 4e-22
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: Elongin B
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 81.4 bits (201), Expect = 4e-22
 Identities = 39/78 (50%), Positives = 54/78 (69%), Gaps = 2/78 (2%)

Query: 24  RYHKGITKVPPKDQKLFNKDNREMEEGNLLQEYGLTSAVAKAQSPALVGLAFRQENGEFE 83
           R  +GI K PP +Q+L+ KD++ +++G  L E G TS  A+ Q+PA VGLAFR +   FE
Sbjct: 28  RIVEGILKRPPDEQRLY-KDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRAD-DTFE 85

Query: 84  PLELTPYSSPPDLPYVMK 101
            L + P+SSPP+LP VMK
Sbjct: 86  ALCIEPFSSPPELPDVMK 103

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query114
d2c9wb1103 Elongin B {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 98.68
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 98.63
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 98.63
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 98.61
d1wy8a176 Ubiquitin-like PHD and RING finger domain-containi 98.58
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 98.57
d2bwfa173 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 98.57
d1ttna180 Dendritic cell-derived ubiquitin-like protein {Hum 98.56
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 98.56
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 98.56
d1yqba184 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 98.52
d1wx8a183 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 98.5
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 98.47
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 98.46
d1zkha186 Splicing factor 3 subunit 1, C-terminal domain {Hu 98.46
d2faza176 Ubiquitin-like PHD and RING finger domain-containi 98.45
d1wx9a173 Large proline-rich protein BAT3 {Human (Homo sapie 98.42
d1we6a_111 Splicing factor 3 subunit 1, C-terminal domain {Th 98.37
d1v5oa_102 1700011n24rik protein {Mouse (Mus musculus) [TaxId 98.33
d1oqya477 Ubiquitin-like domain of Rad23 homolog A (Hhr23a) 98.32
d1wxva181 Bag-family molecular chaperone regulator-1 {Human 98.3
d1wjua_100 NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens 98.24
d1uela_95 Ubiquitin-like domain of Rad23 homolog B (Hhr23B) 98.21
d1t0ya_90 Ubiquitin-like domain of tubulin folding cofactor 98.18
d1v5ta_90 8430435i17rik protein {Mouse (Mus musculus) [TaxId 98.17
d1v86a_95 hypothetical D7wsu128e protein {Mouse (Mus musculu 98.11
d1v6ea_95 Ubiquitin-like domain of tubulin folding cofactor 98.1
d1wjna_97 Tubulin-folding protein TbcE {Mouse (Mus musculus) 98.06
d1wgga_96 Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M 98.03
d1wiaa_95 Ubiquitin-like protein bab25500 (2010008E23Rik) {M 97.99
d1x1ma194 Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta 97.94
d1wgda_93 Homocysteine-responsive endoplasmic reticulum-resi 97.91
d1wgha_116 Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu 97.85
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 97.76
d1se9a_101 Hypothetical protein At3g01050 {Thale cress (Arabi 97.73
d1euvb_79 SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy 96.53
d1wf9a194 NPL4-like protein 1 {Thale cress (Arabidopsis thal 96.4
d2uyzb177 SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax 90.97
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: Elongin B
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.94  E-value=9.6e-29  Score=172.72  Aligned_cols=94  Identities=44%  Similarity=0.693  Sum_probs=87.5

Q ss_pred             eeehhhhhhhh--hhhhhccchhhccccCCCCccceeccccccccccchhhhccccccccccCCCceeeeEeecCCCccc
Q psy9488           6 CQLEIIITYLT--LLYDKRPRYHKGITKVPPKDQKLFNKDNREMEEGNLLQEYGLTSAVAKAQSPALVGLAFRQENGEFE   83 (114)
Q Consensus         6 ~~~~~i~t~~~--~~~~~LK~iIeGIlK~pP~dQrL~~kd~qlLdD~KTL~dcG~tsqtAkaQ~PA~vGLA~r~~~~~FE   83 (114)
                      .|+++|+-++.  .+|.+||.+|+....+||+.|||+ -.|+.|+|.+||+|||++++++++|+||+++|+||. +|+|+
T Consensus         8 ~~k~Ti~l~v~~~~TV~~lK~~I~~~~gip~~~QrLi-~~Gk~L~D~~TL~dYgI~~~~~~~~~~~~~~l~~~~-~~~~~   85 (103)
T d2c9wb1           8 RHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLY-KDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRA-DDTFE   85 (103)
T ss_dssp             EBTEEEEEEECTTSBHHHHHHHHHHHHCCCGGGEEEE-ETTEECCTTSBHHHHTCCTTTSBTTBCEEEEEEEEE-TTEEC
T ss_pred             CCCEEEEEEeCCCCcHHHHHHHHHHHhCCCcccEEEE-ECCEEcCCCCCHHHcCCCcccccccCCcEEEEEEec-CCCcc
Confidence            45556665555  899999999999999999999999 999999999999999999999999999999999997 89999


Q ss_pred             ceeeecCCCCCCCccccc
Q psy9488          84 PLELTPYSSPPDLPYVMK  101 (114)
Q Consensus        84 ~L~I~P~SsPP~LPdvMk  101 (114)
                      .+.|+|||+||++|||||
T Consensus        86 ~~~~~p~~~p~~~p~~~~  103 (103)
T d2c9wb1          86 ALCIEPFSSPPELPDVMK  103 (103)
T ss_dssp             CCCBCCCCCCCCCCGGGC
T ss_pred             ccccccCCCCCCchhhcC
Confidence            999999999999999997
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Back     information, alignment and structure
>d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure