Psyllid ID: psy9819
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 377 | ||||||
| 307200226 | 3025 | Multiple epidermal growth factor-like do | 0.822 | 0.102 | 0.551 | 5e-93 | |
| 383864510 | 3039 | PREDICTED: LOW QUALITY PROTEIN: multiple | 0.822 | 0.102 | 0.551 | 3e-92 | |
| 322792677 | 2797 | hypothetical protein SINV_14129 [Solenop | 0.822 | 0.110 | 0.542 | 3e-92 | |
| 380013693 | 3035 | PREDICTED: multiple epidermal growth fac | 0.822 | 0.102 | 0.542 | 1e-91 | |
| 350401390 | 3022 | PREDICTED: multiple epidermal growth fac | 0.822 | 0.102 | 0.548 | 2e-91 | |
| 340729098 | 3028 | PREDICTED: multiple epidermal growth fac | 0.822 | 0.102 | 0.548 | 2e-91 | |
| 307181027 | 3047 | Multiple epidermal growth factor-like do | 0.822 | 0.101 | 0.542 | 3e-90 | |
| 345483939 | 3046 | PREDICTED: multiple epidermal growth fac | 0.822 | 0.101 | 0.526 | 6e-87 | |
| 157104723 | 2895 | hypothetical protein AaeL_AAEL014347 [Ae | 0.814 | 0.106 | 0.515 | 1e-86 | |
| 170046046 | 2862 | laminin subunit gamma-3 [Culex quinquefa | 0.809 | 0.106 | 0.514 | 6e-84 |
| >gi|307200226|gb|EFN80520.1| Multiple epidermal growth factor-like domains 8 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
Score = 347 bits (890), Expect = 5e-93, Method: Compositional matrix adjust.
Identities = 177/321 (55%), Positives = 217/321 (67%), Gaps = 11/321 (3%)
Query: 34 CYNKCIYGYCKGPPDYSCQCELGWTGVDCSVNCLCNNHSTCVHGIGICDECHDWTTGDHC 93
CY C+ GYC P+Y C+C LGWTG DC NC C NHSTC+ G+GICDEC DWTTGD C
Sbjct: 1337 CYEICVNGYCSEAPEYKCECNLGWTGSDCRNNCGCFNHSTCLQGVGICDECQDWTTGDFC 1396
Query: 94 QYCRAGSYGNATTQEGCRKCDCNSHGNSVLGVCDSITGECICQDNTQGKNCERCLPGYYG 153
+ C+AGSYGNATT GCR+C+CN HG+ LGVCD TG C C+DNT+G C+RC GYYG
Sbjct: 1397 EECKAGSYGNATTPLGCRECNCNGHGDVELGVCDRQTGVCFCRDNTEGDTCQRCKRGYYG 1456
Query: 154 DPTDGGTCYYQCMARGML--TGPGPQGLGSGLAERNAWEGK--DTPSRECLWIIG--QSL 207
DP +GG CYY CM+RGML G G QGLGS ++ + W D+P+RECLWI+ +L
Sbjct: 1457 DPRNGGMCYYGCMSRGMLGGVGNGKQGLGSRHSQSSLWGNHMGDSPTRECLWIVSPETNL 1516
Query: 208 DSNSTAPA--DIILLRLQPDINVPCNENAVYIYDGLPDFVTSVGGTHQSTTLGVFCTEDM 265
S++T P +I + DINV C EN+VY+YDGLP+FV+S GG HQS LGV+CTE
Sbjct: 1517 SSDATTPTIQSVIQFTIHDDINVSCQENSVYVYDGLPEFVSSSGG-HQSQLLGVYCTEST 1575
Query: 266 HRGYEVLEAKSGVMTIHYKQGKPSEGFNATYQIFSCPDKCPENRTCINNQCVCPPRRTGP 325
V EAKSG +T+HYKQ EGFNA+Y + +C + CPENR C N C+C P G
Sbjct: 1576 DYPVTV-EAKSGFLTVHYKQLDEVEGFNASYVVMTC-NNCPENRECRNGNCLCKPGFFGI 1633
Query: 326 DCQEEICPNECHEFLNHGTCD 346
+C EICP+ C G CD
Sbjct: 1634 ECNVEICPDNCTAAKKRGVCD 1654
|
Source: Harpegnathos saltator Species: Harpegnathos saltator Genus: Harpegnathos Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|383864510|ref|XP_003707721.1| PREDICTED: LOW QUALITY PROTEIN: multiple epidermal growth factor-like domains protein 8-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|322792677|gb|EFZ16551.1| hypothetical protein SINV_14129 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|380013693|ref|XP_003690884.1| PREDICTED: multiple epidermal growth factor-like domains protein 8 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|350401390|ref|XP_003486136.1| PREDICTED: multiple epidermal growth factor-like domains protein 8-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340729098|ref|XP_003402845.1| PREDICTED: multiple epidermal growth factor-like domains protein 8-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|307181027|gb|EFN68801.1| Multiple epidermal growth factor-like domains 8 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|345483939|ref|XP_001604319.2| PREDICTED: multiple epidermal growth factor-like domains protein 8-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|157104723|ref|XP_001648539.1| hypothetical protein AaeL_AAEL014347 [Aedes aegypti] gi|108869145|gb|EAT33370.1| AAEL014347-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|170046046|ref|XP_001850596.1| laminin subunit gamma-3 [Culex quinquefasciatus] gi|167868958|gb|EDS32341.1| laminin subunit gamma-3 [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 377 | ||||||
| FB|FBgn0031981 | 2898 | CG7466 [Drosophila melanogaste | 0.801 | 0.104 | 0.478 | 3e-83 | |
| ZFIN|ZDB-GENE-090730-1 | 2774 | megf8 "multiple EGF-like-domai | 0.806 | 0.109 | 0.381 | 7.3e-61 | |
| UNIPROTKB|E1BPS6 | 2772 | MEGF8 "Uncharacterized protein | 0.732 | 0.099 | 0.383 | 7.7e-57 | |
| UNIPROTKB|F1RGK2 | 2789 | MEGF8 "Uncharacterized protein | 0.732 | 0.098 | 0.383 | 1e-56 | |
| UNIPROTKB|Q7Z7M0 | 2845 | MEGF8 "Multiple epidermal grow | 0.732 | 0.097 | 0.379 | 1.1e-56 | |
| UNIPROTKB|E2RM39 | 2787 | MEGF8 "Uncharacterized protein | 0.732 | 0.099 | 0.386 | 1.6e-56 | |
| RGD|621190 | 2788 | Megf8 "multiple EGF-like-domai | 0.732 | 0.098 | 0.383 | 2.7e-56 | |
| MGI|MGI:2446294 | 2789 | Megf8 "multiple EGF-like-domai | 0.732 | 0.098 | 0.379 | 9e-56 | |
| MGI|MGI:99909 | 3333 | Lama3 "laminin, alpha 3" [Mus | 0.397 | 0.045 | 0.410 | 1.9e-21 | |
| UNIPROTKB|F1MDD5 | 3242 | Bt.12589 "Uncharacterized prot | 0.395 | 0.045 | 0.395 | 1.4e-18 |
| FB|FBgn0031981 CG7466 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 835 (299.0 bits), Expect = 3.0e-83, Sum P(3) = 3.0e-83
Identities = 153/320 (47%), Positives = 190/320 (59%)
Query: 34 CYNKCIYGYCKGPPDYSCQCELGWTGVDCSVNCLCNNHSTCVHGIGICDECHDWTTGDHC 93
CY C G C GPPDY+C+C LGWTG DC ++C CNNHSTC +G CD+C DW+ G+ C
Sbjct: 1232 CYELCQNGNCSGPPDYTCRCALGWTGADCGLSCGCNNHSTCNERLGKCDQCQDWSEGEKC 1291
Query: 94 QYCRAGSYGNATTQEGCRKCDCNSHGNSVLGVCDSITGECICQDNTQGKNCERCLPGYYG 153
+ CR GSYGNAT GC C+CN HGN LGVC+ GEC C+DNTQG NCE C PGYYG
Sbjct: 1292 ERCRQGSYGNATAPHGCLPCECNGHGNQDLGVCNVSNGECYCKDNTQGLNCELCAPGYYG 1351
Query: 154 DPTDGGTCYYQCMARGMLTGPGPQGLGSGLAERNAWEGKDTPSRECLWIIGQSLDSNSTA 213
DP GG CYYQC +RG+LT G +GS + R+ W G +ECLWI+ T
Sbjct: 1352 DPRGGGKCYYQCESRGILTNIGKSAIGSYQSYRSPW-GASLEVKECLWIL-----QPKTL 1405
Query: 214 PADIILLRLQ---PDINVPCNENAVYIYDGLPDFVTSVGGTHQSTTLGVFCTEDMHRGYE 270
A+ LL+L+ + + C+ENAVYIYD LPD G T Q+ L V C +
Sbjct: 1406 QAEKSLLQLEFQWQSLAMDCDENAVYIYDSLPDLT---GATQQNQLLAVVCAP--YSSPR 1460
Query: 271 VLEAKSGVMTIHYKQGKPSE--GFNATYQIFSC-PDKCPENRTCINNQ-CVCPPRRTGPD 326
++EA+S +T+HYKQG GFNA Y + +C C C Q CVCP G
Sbjct: 1461 IIEARSSHVTVHYKQGSERRHFGFNALYSVMNCVAGSCISPHICDAQQRCVCPAGYVGAS 1520
Query: 327 CQEEICPNECHEFLNHGTCD 346
C+ EICP+ C+ G CD
Sbjct: 1521 CEIEICPSNCNAKRMQGFCD 1540
|
|
| ZFIN|ZDB-GENE-090730-1 megf8 "multiple EGF-like-domains 8" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BPS6 MEGF8 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RGK2 MEGF8 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7Z7M0 MEGF8 "Multiple epidermal growth factor-like domains protein 8" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RM39 MEGF8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|621190 Megf8 "multiple EGF-like-domains 8" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2446294 Megf8 "multiple EGF-like-domains 8" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:99909 Lama3 "laminin, alpha 3" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MDD5 Bt.12589 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 377 | |||
| cd00055 | 50 | cd00055, EGF_Lam, Laminin-type epidermal growth fa | 1e-12 | |
| pfam00053 | 49 | pfam00053, Laminin_EGF, Laminin EGF-like (Domains | 7e-11 | |
| smart00180 | 46 | smart00180, EGF_Lam, Laminin-type epidermal growth | 1e-09 |
| >gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies | Back alignment and domain information |
|---|
Score = 61.2 bits (149), Expect = 1e-12
Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
Query: 113 CDCNSHGNSVLGVCDSITGECICQDNTQGKNCERCLPGYYGDPTDGGTCY 162
CDCN HG S+ G CD TG+C C+ NT G+ C+RC PGYYG P+ GG C
Sbjct: 2 CDCNGHG-SLSGQCDPGTGQCECKPNTTGRRCDRCAPGYYGLPSQGGGCQ 50
|
Length = 50 |
| >gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) | Back alignment and domain information |
|---|
| >gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 377 | |||
| KOG0994|consensus | 1758 | 99.76 | ||
| KOG0994|consensus | 1758 | 99.73 | ||
| KOG1225|consensus | 525 | 99.39 | ||
| KOG1225|consensus | 525 | 99.32 | ||
| KOG1836|consensus | 1705 | 99.3 | ||
| KOG3512|consensus | 592 | 99.11 | ||
| KOG1219|consensus | 4289 | 98.99 | ||
| KOG1836|consensus | 1705 | 98.86 | ||
| KOG1226|consensus | 783 | 98.7 | ||
| KOG3512|consensus | 592 | 98.65 | ||
| KOG4289|consensus | 2531 | 98.58 | ||
| KOG1226|consensus | 783 | 98.54 | ||
| KOG4289|consensus | 2531 | 98.47 | ||
| KOG1219|consensus | 4289 | 98.3 | ||
| KOG1217|consensus | 487 | 98.27 | ||
| KOG4260|consensus | 350 | 98.25 | ||
| KOG4260|consensus | 350 | 98.0 | ||
| cd00055 | 50 | EGF_Lam Laminin-type epidermal growth factor-like | 97.83 | |
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 97.73 | |
| cd00055 | 50 | EGF_Lam Laminin-type epidermal growth factor-like | 97.66 | |
| smart00180 | 46 | EGF_Lam Laminin-type epidermal growth factor-like | 97.6 | |
| PF00053 | 49 | Laminin_EGF: Laminin EGF-like (Domains III and V); | 97.51 | |
| PF00053 | 49 | Laminin_EGF: Laminin EGF-like (Domains III and V); | 97.44 | |
| cd00041 | 113 | CUB CUB domain; extracellular domain; present in p | 97.43 | |
| smart00180 | 46 | EGF_Lam Laminin-type epidermal growth factor-like | 97.34 | |
| KOG4586|consensus | 156 | 97.27 | ||
| PF00431 | 110 | CUB: CUB domain CUB domain entry Spermadhesins fam | 97.14 | |
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 97.05 | |
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 97.05 | |
| smart00051 | 63 | DSL delta serrate ligand. | 97.0 | |
| KOG1217|consensus | 487 | 96.99 | ||
| smart00042 | 102 | CUB Domain first found in C1r, C1s, uEGF, and bone | 96.8 | |
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 96.7 | |
| PF12661 | 13 | hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E | 96.7 | |
| PF12661 | 13 | hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E | 96.51 | |
| smart00051 | 63 | DSL delta serrate ligand. | 96.18 | |
| KOG1214|consensus | 1289 | 96.14 | ||
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 96.12 | |
| KOG1388|consensus | 217 | 96.04 | ||
| KOG3509|consensus | 964 | 95.87 | ||
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 95.65 | |
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 95.56 | |
| KOG1214|consensus | 1289 | 95.48 | ||
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 95.16 | |
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 95.1 | |
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 94.87 | |
| PF14670 | 36 | FXa_inhibition: Coagulation Factor Xa inhibitory s | 94.38 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 94.35 | |
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 94.26 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 92.98 | |
| PHA02887 | 126 | EGF-like protein; Provisional | 92.96 | |
| KOG1218|consensus | 316 | 92.84 | ||
| PF01414 | 63 | DSL: Delta serrate ligand; InterPro: IPR001774 Lig | 92.33 | |
| PHA03099 | 139 | epidermal growth factor-like protein (EGF-like pro | 92.1 | |
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 90.94 | |
| KOG3509|consensus | 964 | 90.46 | ||
| PHA02887 | 126 | EGF-like protein; Provisional | 88.69 | |
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 88.48 | |
| PF12662 | 24 | cEGF: Complement Clr-like EGF-like | 87.98 | |
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 87.27 | |
| KOG1218|consensus | 316 | 85.89 | ||
| PF01414 | 63 | DSL: Delta serrate ligand; InterPro: IPR001774 Lig | 85.11 | |
| PF09064 | 34 | Tme5_EGF_like: Thrombomodulin like fifth domain, E | 82.71 | |
| PF04863 | 56 | EGF_alliinase: Alliinase EGF-like domain; InterPro | 82.25 | |
| PHA03099 | 139 | epidermal growth factor-like protein (EGF-like pro | 80.24 |
| >KOG0994|consensus | Back alignment and domain information |
|---|
Probab=99.76 E-value=4.3e-18 Score=172.67 Aligned_cols=147 Identities=35% Similarity=0.683 Sum_probs=113.2
Q ss_pred CCeeeecCCCCccCCCCC------------CCCCCCCc-eeecCCCcccCCCCCCCCCCCCCCCCCcccCCCCC--CCcc
Q psy9819 47 PDYSCQCELGWTGVDCSV------------NCLCNNHS-TCVHGIGICDECHDWTTGDHCQYCRAGSYGNATTQ--EGCR 111 (377)
Q Consensus 47 ~~~~C~C~~G~~G~~C~~------------~C~C~~~g-~C~~~~~~C~~C~~g~~G~~C~~C~~g~~g~~c~~--~~C~ 111 (377)
.+++|.|.+|.+|..|.+ +|.|++|+ +|++.+|.|+.|...++|.+|+.|.+||+|+.--. ..|.
T Consensus 828 ~tGQC~C~~g~ygrqCnqCqpG~WgFPeCr~CqCNgHA~~Cd~~tGaCi~CqD~T~G~~CdrCl~GyyGdP~lg~g~~Cr 907 (1758)
T KOG0994|consen 828 ITGQCQCRPGTYGRQCNQCQPGYWGFPECRPCQCNGHADTCDPITGACIDCQDSTTGHSCDRCLDGYYGDPRLGSGIGCR 907 (1758)
T ss_pred cccceeeccccchhhccccCCCccCCCcCccccccCcccccCccccccccccccccccchhhhhccccCCcccCCCCCCC
Confidence 356888888888888874 57899998 89999999999999999999999999999997543 6899
Q ss_pred CCCCCCCCCc---CcccccCCC----cceecCCCCccCCCccCCCCccCCCCCCCCCCC-CCCCCCC--CCCCCCCCCCC
Q psy9819 112 KCDCNSHGNS---VLGVCDSIT----GECICQDNTQGKNCERCLPGYYGDPTDGGTCYY-QCMARGM--LTGPGPQGLGS 181 (377)
Q Consensus 112 ~~~C~~~g~~---~~g~C~~~~----g~C~C~~g~~G~~C~~C~~G~~g~~~~~~~C~~-~C~~~g~--~~~~~~~~~g~ 181 (377)
+|+|..+... ...+|...+ -.|+|.+||+|.+|+.|.++|+|+|.++++|.. +|+++.. -...|...+|.
T Consensus 908 PCpCP~gp~Sg~~~A~sC~~d~~t~~ivC~C~~GY~G~RCe~CA~~~fGnP~~GGtCq~CeC~~NiD~~d~~aCD~~TG~ 987 (1758)
T KOG0994|consen 908 PCPCPDGPASGRQHADSCYLDTRTQQIVCHCQEGYSGSRCEICADNHFGNPSEGGTCQKCECSNNIDLYDPGACDVATGA 987 (1758)
T ss_pred CCCCCCCCccchhccccccccccccceeeecccCccccchhhhcccccCCcccCCccccccccCCcCccCCCccchhhch
Confidence 9999765422 112454322 389999999999999999999999999999987 8877652 23455555554
Q ss_pred cccCCCCCccCC
Q psy9819 182 GLAERNAWEGKD 193 (377)
Q Consensus 182 ~~~c~~G~~G~~ 193 (377)
+..|...-+|.+
T Consensus 988 CLkCL~hTeG~h 999 (1758)
T KOG0994|consen 988 CLKCLYHTEGDH 999 (1758)
T ss_pred hhhhhhcccccc
Confidence 444444334443
|
|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >KOG1836|consensus | Back alignment and domain information |
|---|
| >KOG3512|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >KOG1836|consensus | Back alignment and domain information |
|---|
| >KOG1226|consensus | Back alignment and domain information |
|---|
| >KOG3512|consensus | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >KOG1226|consensus | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >KOG4260|consensus | Back alignment and domain information |
|---|
| >KOG4260|consensus | Back alignment and domain information |
|---|
| >cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies | Back alignment and domain information |
|---|
| >smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai | Back alignment and domain information |
|---|
| >PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation | Back alignment and domain information |
|---|
| >PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation | Back alignment and domain information |
|---|
| >cd00041 CUB CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast | Back alignment and domain information |
|---|
| >smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai | Back alignment and domain information |
|---|
| >KOG4586|consensus | Back alignment and domain information |
|---|
| >PF00431 CUB: CUB domain CUB domain entry Spermadhesins family entry Link to schematic domain picture by Peer Bork | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >smart00051 DSL delta serrate ligand | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >smart00042 CUB Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A | Back alignment and domain information |
|---|
| >PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A | Back alignment and domain information |
|---|
| >smart00051 DSL delta serrate ligand | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >KOG1388|consensus | Back alignment and domain information |
|---|
| >KOG3509|consensus | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >PHA02887 EGF-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG1218|consensus | Back alignment and domain information |
|---|
| >PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates | Back alignment and domain information |
|---|
| >PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >KOG3509|consensus | Back alignment and domain information |
|---|
| >PHA02887 EGF-like protein; Provisional | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >PF12662 cEGF: Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >KOG1218|consensus | Back alignment and domain information |
|---|
| >PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates | Back alignment and domain information |
|---|
| >PF09064 Tme5_EGF_like: Thrombomodulin like fifth domain, EGF-like; InterPro: IPR015149 This domain adopts a fold similar to other EGF domains, with a flat major and a twisted minor beta sheet | Back alignment and domain information |
|---|
| >PF04863 EGF_alliinase: Alliinase EGF-like domain; InterPro: IPR006947 Allicin is a thiosulphinate that gives rise to dithiines, allyl sulphides and ajoenes, the three groups of active compounds in Allium species | Back alignment and domain information |
|---|
| >PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 377 | ||||
| 1klo_A | 162 | Crystal Structure Of Three Consecutive Laminin-Type | 2e-06 | ||
| 1npe_B | 164 | Crystal Structure Of Nidogen/laminin Complex Length | 3e-06 | ||
| 4aqs_A | 525 | Laminin Beta1 Ln-Le1-4 Structure Length = 525 | 6e-05 |
| >pdb|1KLO|A Chain A, Crystal Structure Of Three Consecutive Laminin-Type Epidermal Growth Factor-Like (Le) Modules Of Laminin Gamma1 Chain Harboring The Nidogen Binding Site Length = 162 | Back alignment and structure |
|
| >pdb|1NPE|B Chain B, Crystal Structure Of Nidogen/laminin Complex Length = 164 | Back alignment and structure |
| >pdb|4AQS|A Chain A, Laminin Beta1 Ln-Le1-4 Structure Length = 525 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 377 | |||
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 6e-22 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 6e-20 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 2e-06 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 1e-17 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 2e-13 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 5e-13 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 2e-08 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 1e-05 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 4e-15 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 1e-07 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 1e-06 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 1e-13 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 2e-08 | |
| 3tbd_A | 338 | Netrin-G2, laminet-2; laminin N-terminal domain, d | 8e-09 | |
| 3tbd_A | 338 | Netrin-G2, laminet-2; laminin N-terminal domain, d | 1e-06 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 7e-08 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 4e-05 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 3e-04 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 1e-06 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 3e-06 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 3e-05 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 7e-05 | |
| 1spp_A | 109 | Major seminal plasma glycoprotein PSP-I; seminal p | 1e-06 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 1e-06 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 2e-06 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 8e-05 | |
| 1spp_B | 116 | Major seminal plasma glycoprotein PSP-II; seminal | 5e-06 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 7e-06 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 5e-05 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 2e-04 | |
| 1sfp_A | 114 | ASFP; spermadhesin, bovine seminal plasma protein, | 6e-05 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 8e-05 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 1e-04 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 2e-04 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 3e-04 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 4e-04 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 5e-04 | |
| 1skz_A | 119 | Antistasin; factor XA inhibitor, serine protease i | 4e-04 | |
| 1skz_A | 119 | Antistasin; factor XA inhibitor, serine protease i | 8e-04 | |
| 2ddu_A | 387 | Reelin; beta-jelly-roll, signaling protein; 2.05A | 5e-04 |
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 | Back alignment and structure |
|---|
Score = 90.3 bits (224), Expect = 6e-22
Identities = 32/103 (31%), Positives = 46/103 (44%), Gaps = 4/103 (3%)
Query: 61 DCSVNCLCNNHSTCVHGIGICDECHDWTTGDHCQYCRAGSYGNATTQE---GCRKCDCNS 117
C+ N N C G C +C T G +C C+ G +GN C+ C CN
Sbjct: 57 QCNDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKEGFFGNPLAPNPADKCKACACNP 116
Query: 118 HG-NSVLGVCDSITGECICQDNTQGKNCERCLPGYYGDPTDGG 159
+G C+ +TG+C C + G++C C PGYY + G
Sbjct: 117 YGTVQQQSSCNPVTGQCQCLPHVSGRDCGTCDPGYYNLQSGQG 159
|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 | Back alignment and structure |
|---|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 | Back alignment and structure |
|---|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 | Back alignment and structure |
|---|
| >3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Length = 338 | Back alignment and structure |
|---|
| >3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Length = 338 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >1spp_A Major seminal plasma glycoprotein PSP-I; seminal plasma proteins, spermadhesins, CUB domain architecture, complex (seminal plasma protein/SPP); 2.40A {Sus scrofa} SCOP: b.23.1.1 Length = 109 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 | Back alignment and structure |
|---|
| >1spp_B Major seminal plasma glycoprotein PSP-II; seminal plasma proteins, spermadhesins, CUB domain architecture, complex (seminal plasma protein/SPP); 2.40A {Sus scrofa} SCOP: b.23.1.1 Length = 116 | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 | Back alignment and structure |
|---|
| >1sfp_A ASFP; spermadhesin, bovine seminal plasma protein, acidic seminal fluid protein, CUB domain, X-RAY growth factor; 1.90A {Bos taurus} SCOP: b.23.1.1 Length = 114 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 | Back alignment and structure |
|---|
| >1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 | Back alignment and structure |
|---|
| >2ddu_A Reelin; beta-jelly-roll, signaling protein; 2.05A {Mus musculus} Length = 387 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 377 | |||
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 99.73 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 99.69 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 99.69 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 99.61 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 99.58 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 99.56 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 99.55 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 99.49 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 99.48 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 99.45 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 99.3 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 99.29 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 99.26 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 99.19 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 99.19 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 99.17 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 99.12 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 99.09 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 99.08 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 99.04 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 98.98 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 98.94 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 98.78 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 98.77 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 98.77 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 98.68 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 98.64 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 98.52 | |
| 1nzi_A | 159 | Complement C1S component; calcium, innate immunity | 98.51 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 98.5 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 98.48 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 98.44 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 98.42 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 98.41 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 98.4 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 98.32 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 98.31 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 98.31 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 98.31 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 98.25 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 98.23 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 98.19 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 98.18 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 98.17 | |
| 1sfp_A | 114 | ASFP; spermadhesin, bovine seminal plasma protein, | 98.14 | |
| 1spp_A | 109 | Major seminal plasma glycoprotein PSP-I; seminal p | 98.14 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 98.13 | |
| 2wno_A | 149 | Tumor necrosis factor-inducible gene 6 protein; gl | 98.12 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 98.08 | |
| 1spp_B | 116 | Major seminal plasma glycoprotein PSP-II; seminal | 98.07 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 98.07 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 98.04 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 97.99 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 97.98 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 97.98 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 97.96 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 97.96 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 97.95 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 97.91 | |
| 3poj_A | 115 | Mannan-binding lectin serine protease 1; CUB domai | 97.9 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 97.86 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 97.85 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 97.82 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 97.8 | |
| 3dem_A | 278 | Complement factor MAsp-3; complement system, innat | 97.8 | |
| 3dem_A | 278 | Complement factor MAsp-3; complement system, innat | 97.77 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 97.76 | |
| 1nt0_A | 286 | MAsp2, mannose-binding protein associated serine p | 97.75 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 97.71 | |
| 4aqb_A | 361 | Mannan-binding lectin serine protease 1; blood clo | 97.68 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 97.62 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 97.62 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 97.54 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 97.54 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 97.53 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 97.5 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 97.5 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 97.48 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 97.46 | |
| 1nt0_A | 286 | MAsp2, mannose-binding protein associated serine p | 97.43 | |
| 4gz9_A | 577 | Neuropilin-1, A5 protein; multi-domain, cell-CELL | 97.4 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 97.39 | |
| 2qqm_A | 450 | Neuropilin-1; VEGF receptor, semaphorin receptor, | 97.38 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 97.37 | |
| 2qqo_A | 460 | Neuropilin-2; VEGF receptor, semaphorin receptor, | 97.35 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 97.35 | |
| 3kq4_B | 457 | Cubilin; protein-protein complex, cobalt, cobalt t | 97.3 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 97.25 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 97.22 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 97.21 | |
| 4gz9_A | 577 | Neuropilin-1, A5 protein; multi-domain, cell-CELL | 97.15 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 97.14 | |
| 4aqb_A | 361 | Mannan-binding lectin serine protease 1; blood clo | 97.13 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 97.1 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 97.08 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 97.05 | |
| 3kq4_B | 457 | Cubilin; protein-protein complex, cobalt, cobalt t | 97.02 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 97.0 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 96.99 | |
| 2e26_A | 725 | Reelin, reeler protein; signaling protein; HET: NA | 96.96 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 96.95 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 96.89 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 96.78 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 96.78 | |
| 2qqk_A | 579 | Neuropilin-2; VEGF receptor, semaphorin receptor, | 96.74 | |
| 2qqk_A | 579 | Neuropilin-2; VEGF receptor, semaphorin receptor, | 96.74 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 96.52 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 96.44 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 96.32 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 96.27 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 96.25 | |
| 2rnl_A | 50 | Amphiregulin; AR, colorectum cell-derived growth f | 96.15 | |
| 2p26_A | 280 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 96.13 | |
| 1iox_A | 50 | Betacellulin; EGF-like fold, hormone/growth factor | 96.11 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 96.08 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 95.98 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 95.97 | |
| 2i9a_A | 145 | Urokinase-type plasminogen activator; growth facto | 95.96 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 95.82 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 95.77 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 94.51 | |
| 2e26_A | 725 | Reelin, reeler protein; signaling protein; HET: NA | 94.37 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 94.35 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 93.72 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 93.57 | |
| 2rnl_A | 50 | Amphiregulin; AR, colorectum cell-derived growth f | 93.18 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 93.13 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 93.13 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 93.02 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 92.44 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 91.94 | |
| 2i9a_A | 145 | Urokinase-type plasminogen activator; growth facto | 91.82 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 91.58 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 91.34 | |
| 2ddu_A | 387 | Reelin; beta-jelly-roll, signaling protein; 2.05A | 91.25 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 91.22 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 91.13 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 90.92 | |
| 3tbd_A | 338 | Netrin-G2, laminet-2; laminin N-terminal domain, d | 90.34 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 90.0 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 89.94 | |
| 1iox_A | 50 | Betacellulin; EGF-like fold, hormone/growth factor | 89.79 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 89.33 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 89.24 | |
| 1kig_L | 51 | Factor XA; glycoprotein, serine protease, plasma, | 87.94 | |
| 2p26_A | 280 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 86.85 | |
| 3fl7_A | 536 | Ephrin receptor; ATP-binding, kinase, nucleotide-b | 86.36 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 85.8 | |
| 2kl7_A | 71 | Fibulin-4; secreted, calcium, disease mutation, di | 85.43 | |
| 2bz6_L | 53 | Blood coagulation factor VIIA; serine protease, en | 85.31 | |
| 2wph_E | 59 | Coagulation factor IXA light chain; serine proteas | 82.6 | |
| 2ddu_A | 387 | Reelin; beta-jelly-roll, signaling protein; 2.05A | 81.76 | |
| 1kli_L | 69 | Factor VIIA; extrinsic coagulation pathway, serine | 81.34 |
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.73 E-value=7.3e-18 Score=158.54 Aligned_cols=91 Identities=33% Similarity=0.841 Sum_probs=63.4
Q ss_pred CCcCCCCCC-CeecCCCCeeeecCCCCccCCCCC-CC--CCCCCceeecCCCcccCCCCCCCCCCCCCCCCCcccCCCCC
Q psy9819 32 SLCYNKCIY-GYCKGPPDYSCQCELGWTGVDCSV-NC--LCNNHSTCVHGIGICDECHDWTTGDHCQYCRAGSYGNATTQ 107 (377)
Q Consensus 32 ~~C~~~C~~-G~C~~~~~~~C~C~~G~~G~~C~~-~C--~C~~~g~C~~~~~~C~~C~~g~~G~~C~~C~~g~~g~~c~~ 107 (377)
+.|+++|++ |+|+. .++|+|++||+|.+|+. .| +|.++|+|+. ++.| .|++||+|.+|+.
T Consensus 149 ~~C~~~C~~~G~C~~--~~~C~C~~G~~G~~C~~~~C~~~C~~~G~C~~-~~~C-~C~~G~~G~~C~~------------ 212 (324)
T 2ygq_A 149 AECPGGCRNGGFCNE--RRICECPDGFHGPHCEKALCTPRCMNGGLCVT-PGFC-ICPPGFYGVNCDK------------ 212 (324)
T ss_dssp CCCSSCCCSSCEECT--TSCEECCTTEESSSSCEESSSSCCCTTCEECS-SCCE-ECCTTCBTTTTCB------------
T ss_pred CCCCCCCCCCCEECC--CCeEECCCCCcCCCCCCCCCCCCCCCCCEEcC-CCEE-eCCCCccCCCccc------------
Confidence 567778875 88875 46888888888888885 34 5778888865 5677 5777777766652
Q ss_pred CCccCCCCCCCCCcCcccccCCCcceecCCCCccCCCc
Q psy9819 108 EGCRKCDCNSHGNSVLGVCDSITGECICQDNTQGKNCE 145 (377)
Q Consensus 108 ~~C~~~~C~~~g~~~~g~C~~~~g~C~C~~g~~G~~C~ 145 (377)
..|. .+|.++| +|.. ++.|.|.+||+|..|+
T Consensus 213 ~~C~-~~C~~~G-----~C~~-~~~C~C~~G~~G~~C~ 243 (324)
T 2ygq_A 213 ANCS-TTCFNGG-----TCFY-PGKCICPPGLEGEQCE 243 (324)
T ss_dssp CCCS-SCCCSSC-----CBSC-SSCBCCCTTCCTTTTC
T ss_pred CcCC-CCCCCCC-----eeCC-CCeeeCCCCccCCCCC
Confidence 2333 2566665 6754 5678888888777776
|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >1sfp_A ASFP; spermadhesin, bovine seminal plasma protein, acidic seminal fluid protein, CUB domain, X-RAY growth factor; 1.90A {Bos taurus} SCOP: b.23.1.1 | Back alignment and structure |
|---|
| >1spp_A Major seminal plasma glycoprotein PSP-I; seminal plasma proteins, spermadhesins, CUB domain architecture, complex (seminal plasma protein/SPP); 2.40A {Sus scrofa} SCOP: b.23.1.1 | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2wno_A Tumor necrosis factor-inducible gene 6 protein; glycoprotein, cell adhesion, extracellular matrix; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >1spp_B Major seminal plasma glycoprotein PSP-II; seminal plasma proteins, spermadhesins, CUB domain architecture, complex (seminal plasma protein/SPP); 2.40A {Sus scrofa} SCOP: b.23.1.1 | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >3poj_A Mannan-binding lectin serine protease 1; CUB domain, Ca2+ binding site, complex with ethylamine, COMP protein, lectin pathway of complement; 1.45A {Rattus norvegicus} PDB: 3pob_A 3pof_A 3pog_A 3poi_A 3poe_A | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >3dem_A Complement factor MAsp-3; complement system, innate immunity, calcium binding sites, C pathway, EGF-like domain, glycoprotein, hydrolase; HET: NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3dem_A Complement factor MAsp-3; complement system, innate immunity, calcium binding sites, C pathway, EGF-like domain, glycoprotein, hydrolase; HET: NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >1nt0_A MAsp2, mannose-binding protein associated serine proteas; CUB domain, EGF like domain., hydrolase, sugar binding protein; HET: NAG EDO; 2.70A {Rattus norvegicus} SCOP: b.23.1.1 b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >1nt0_A MAsp2, mannose-binding protein associated serine proteas; CUB domain, EGF like domain., hydrolase, sugar binding protein; HET: NAG EDO; 2.70A {Rattus norvegicus} SCOP: b.23.1.1 b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >4gz9_A Neuropilin-1, A5 protein; multi-domain, cell-CELL signaling, plexin, semaphorin, VEGF, glycosilated, transmembrane, signaling protein; HET: NAG BMA; 2.70A {Mus musculus} PDB: 4gza_H | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >2qqm_A Neuropilin-1; VEGF receptor, semaphorin receptor, calcium-binding domain, angiogenesis, developmental protein, differentiation; HET: NAG FUC; 2.00A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 b.23.1.1 | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qqo_A Neuropilin-2; VEGF receptor, semaphorin receptor, calcium-binding domain, developmental protein, differentiation, glycoprotein, membr neurogenesis; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >3kq4_B Cubilin; protein-protein complex, cobalt, cobalt transport, disease M disulfide bond, glycoprotein, secreted, transport, choleste metabolism; HET: NAG BMA MAN B12; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >4gz9_A Neuropilin-1, A5 protein; multi-domain, cell-CELL signaling, plexin, semaphorin, VEGF, glycosilated, transmembrane, signaling protein; HET: NAG BMA; 2.70A {Mus musculus} PDB: 4gza_H | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >3kq4_B Cubilin; protein-protein complex, cobalt, cobalt transport, disease M disulfide bond, glycoprotein, secreted, transport, choleste metabolism; HET: NAG BMA MAN B12; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >2qqk_A Neuropilin-2; VEGF receptor, semaphorin receptor, phage-derived antibody, developmental protein, differentiation, glycoprotein; HET: NAG; 2.75A {Homo sapiens} PDB: 2qql_A | Back alignment and structure |
|---|
| >2qqk_A Neuropilin-2; VEGF receptor, semaphorin receptor, phage-derived antibody, developmental protein, differentiation, glycoprotein; HET: NAG; 2.75A {Homo sapiens} PDB: 2qql_A | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* | Back alignment and structure |
|---|
| >1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A | Back alignment and structure |
|---|
| >2ddu_A Reelin; beta-jelly-roll, signaling protein; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... | Back alignment and structure |
|---|
| >1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A | Back alignment and structure |
|---|
| >3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A | Back alignment and structure |
|---|
| >2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* | Back alignment and structure |
|---|
| >2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* | Back alignment and structure |
|---|
| >2ddu_A Reelin; beta-jelly-roll, signaling protein; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 377 | ||||
| d1kloa2 | 56 | g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (M | 9e-10 | |
| d1kloa2 | 56 | g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (M | 2e-07 | |
| d1kloa3 | 51 | g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( | 6e-08 | |
| d1kloa1 | 55 | g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mu | 4e-06 | |
| d1kloa1 | 55 | g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mu | 8e-06 |
| >d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 56 | Back information, alignment and structure |
|---|
class: Small proteins fold: Knottins (small inhibitors, toxins, lectins) superfamily: EGF/Laminin family: Laminin-type module domain: Laminin gamma1 chain species: Mouse (Mus musculus) [TaxId: 10090]
Score = 51.8 bits (124), Expect = 9e-10
Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 2/51 (3%)
Query: 113 CDCNSHGN-SVLGVCDSITGECI-CQDNTQGKNCERCLPGYYGDPTDGGTC 161
C CN + + + +G C+ +TGEC+ C NT G C+RC G++G+P
Sbjct: 1 CQCNDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKEGFFGNPLAPNPA 51
|
| >d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 56 | Back information, alignment and structure |
|---|
| >d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 | Back information, alignment and structure |
|---|
| >d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 55 | Back information, alignment and structure |
|---|
| >d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 55 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 377 | |||
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.25 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.2 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 98.19 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 98.16 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 98.16 | |
| d1kloa2 | 56 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 98.13 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 98.12 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 98.1 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.07 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 98.05 | |
| d1sppb_ | 112 | Major seminal plasma glycoprotein PSP-II {Pig (Sus | 98.04 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 98.03 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 97.99 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 97.98 | |
| d1kloa1 | 55 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 97.98 | |
| d2qqma3 | 108 | Mannose-binding protein associated serine protease | 97.95 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 97.93 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 97.92 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 97.91 | |
| d1sppa_ | 109 | Major seminal plasma glycoprotein PSP-I {Pig (Sus | 97.83 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 97.82 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 97.81 | |
| d1kloa2 | 56 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 97.76 | |
| d1sfpa_ | 111 | Acidic seminal fluid protein (ASFP) {Cow (Bos taur | 97.76 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 97.76 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 97.67 | |
| d1kloa3 | 51 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 97.65 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 97.61 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 97.58 | |
| d1nt0a2 | 114 | Mannose-binding protein associated serine protease | 97.57 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 97.56 | |
| d1szba1 | 121 | Mannose-binding protein associated serine protease | 97.5 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 97.49 | |
| d1jv2b4 | 31 | Integrin beta EGF-like domains {Human (Homo sapien | 97.39 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 97.38 | |
| d1nzia1 | 117 | Complement C1S component {Human (Homo sapiens) [Ta | 97.29 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 97.27 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 97.26 | |
| d1jv2b5 | 43 | Integrin beta EGF-like domains {Human (Homo sapien | 97.23 | |
| d1kloa3 | 51 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 97.17 | |
| d2i9aa1 | 40 | Plasminogen activator (urokinase-type) {Human (Hom | 97.14 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 97.11 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 97.1 | |
| d1l3ya_ | 41 | Integrin beta EGF-like domains {Human (Homo sapien | 97.05 | |
| d1kloa1 | 55 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 96.92 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 96.46 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 96.02 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 95.87 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 95.83 | |
| d1xdtr_ | 41 | Heparin-binding epidermal growth factor, HBEGF {Hu | 95.7 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 95.68 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 95.56 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 95.53 | |
| d2i9aa1 | 40 | Plasminogen activator (urokinase-type) {Human (Hom | 95.5 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 95.5 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 95.39 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 95.37 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 95.36 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 95.27 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 95.23 | |
| d1l3ya_ | 41 | Integrin beta EGF-like domains {Human (Homo sapien | 95.02 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 94.99 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 94.98 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 94.69 | |
| d1apqa_ | 53 | Complement protease C1R {Human (Homo sapiens) [Tax | 94.47 | |
| d3bpse1 | 40 | Low density lipoprotein (LDL) receptor, different | 94.45 | |
| d1nzia2 | 42 | Complement C1S component {Human (Homo sapiens) [Ta | 94.28 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 94.25 | |
| d1jv2b5 | 43 | Integrin beta EGF-like domains {Human (Homo sapien | 93.87 | |
| d1nt0a3 | 45 | Mannose-binding protein associated serine protease | 93.87 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 93.78 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 93.76 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 93.7 | |
| d1emoa2 | 39 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 93.56 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 92.96 | |
| d1jv2b4 | 31 | Integrin beta EGF-like domains {Human (Homo sapien | 92.42 | |
| d1szba2 | 45 | Mannose-binding protein associated serine protease | 92.3 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 92.16 | |
| d1xdtr_ | 41 | Heparin-binding epidermal growth factor, HBEGF {Hu | 91.97 | |
| d1autl2 | 50 | Activated protein c (autoprothrombin IIa) {Human ( | 91.67 | |
| d2p3ua1 | 51 | Factor X, N-terminal module {Human (Homo sapiens) | 90.02 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 89.96 | |
| d1nt0a3 | 45 | Mannose-binding protein associated serine protease | 87.64 | |
| d1kigl_ | 51 | Factor X, N-terminal module {Cow (Bos taurus) [Tax | 87.61 | |
| d1emoa2 | 39 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 86.82 | |
| d1ijqa2 | 50 | Low density lipoprotein (LDL) receptor, different | 84.72 | |
| d1apqa_ | 53 | Complement protease C1R {Human (Homo sapiens) [Tax | 80.04 |
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Knottins (small inhibitors, toxins, lectins) superfamily: EGF/Laminin family: EGF-type module domain: Neurogenic locus notch homolog protein 1, Notch1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.25 E-value=2.4e-07 Score=56.19 Aligned_cols=33 Identities=33% Similarity=0.869 Sum_probs=27.3
Q ss_pred CCcC-CCCCC-CeecCCC-CeeeecCCCCccCCCCC
Q psy9819 32 SLCY-NKCIY-GYCKGPP-DYSCQCELGWTGVDCSV 64 (377)
Q Consensus 32 ~~C~-~~C~~-G~C~~~~-~~~C~C~~G~~G~~C~~ 64 (377)
..|. +||+| |+|++.. +|+|.|++||+|..|++
T Consensus 2 d~C~~~PC~n~g~C~~~~~~y~C~C~~G~~G~~Ce~ 37 (39)
T d2vj3a2 2 NECVSNPCQNDATCLDQIGEFQCICMPGYEGVHCEV 37 (39)
T ss_dssp CTTTTCCCCSSCEEEECSSCEEEECCTTEESSSSCE
T ss_pred cCCcCCCCCCCCEEECCCCCEEEeCCCCCccCcCee
Confidence 3454 69998 8999644 89999999999999985
|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sppb_ b.23.1.1 (B:) Major seminal plasma glycoprotein PSP-II {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2qqma3 b.23.1.1 (A:156-263) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sppa_ b.23.1.1 (A:) Major seminal plasma glycoprotein PSP-I {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sfpa_ b.23.1.1 (A:) Acidic seminal fluid protein (ASFP) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nt0a2 b.23.1.1 (A:165-278) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1szba1 b.23.1.1 (A:3-123) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nzia1 b.23.1.1 (A:1-117) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|