Psyllid ID: psy985
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 191 | ||||||
| 206725166 | 577 | fmr [Gryllus bimaculatus] | 0.884 | 0.292 | 0.641 | 1e-61 | |
| 350404195 | 599 | PREDICTED: fragile X mental retardation | 0.884 | 0.282 | 0.615 | 3e-58 | |
| 340725692 | 600 | PREDICTED: fragile X mental retardation | 0.884 | 0.281 | 0.615 | 3e-58 | |
| 340725688 | 605 | PREDICTED: fragile X mental retardation | 0.884 | 0.279 | 0.615 | 4e-58 | |
| 157122825 | 717 | fragile X mental retardation syndrome-re | 0.879 | 0.234 | 0.609 | 5e-58 | |
| 328783510 | 597 | PREDICTED: fragile X mental retardation | 0.884 | 0.283 | 0.609 | 7e-58 | |
| 332023074 | 599 | Fragile X mental retardation syndrome-re | 0.884 | 0.282 | 0.603 | 9e-58 | |
| 307203416 | 603 | Fragile X mental retardation syndrome-re | 0.884 | 0.280 | 0.603 | 9e-58 | |
| 328783508 | 602 | PREDICTED: fragile X mental retardation | 0.884 | 0.280 | 0.609 | 9e-58 | |
| 383859712 | 597 | PREDICTED: fragile X mental retardation | 0.884 | 0.283 | 0.609 | 1e-57 |
| >gi|206725166|dbj|BAG71783.1| fmr [Gryllus bimaculatus] | Back alignment and taxonomy information |
|---|
Score = 241 bits (614), Expect = 1e-61, Method: Compositional matrix adjust.
Identities = 109/170 (64%), Positives = 142/170 (83%), Gaps = 1/170 (0%)
Query: 17 WQPESKFQFSMVRLPPRETIN-SGFVENQEVEVFSKATEGESCGWWKVIVKMIKGDFHVV 75
WQPESKF FS VRLPP ++ + F E+QE+EVFS+A + E+CGWWK I+KMIKGDFHVV
Sbjct: 48 WQPESKFPFSQVRLPPDASLGKTDFTEHQEIEVFSRANDQEACGWWKAIIKMIKGDFHVV 107
Query: 76 EYLGCQSTFTEIVPPERMRQKNTNPPIDAKTFHKFDIEVPLDVQEFAKMEGAHKDFQKAI 135
EYLG ++T+TEIVP +R+R KN NPPI+ TF KF+IEVP +++E+AK+E AHK+FQKAI
Sbjct: 108 EYLGWENTYTEIVPSDRLRPKNPNPPINKSTFFKFEIEVPEELREYAKVETAHKEFQKAI 167
Query: 136 AAAIVRYIPDKGALSVISRDEACQKRASMIKDMHFRNLNQKVVLLKRTED 185
AAI RY+P++G LS ISR E +KR++M+++MHFRNL QKV+LLKRTE+
Sbjct: 168 EAAICRYVPERGVLSCISRCETSKKRSAMLQEMHFRNLTQKVLLLKRTEE 217
|
Source: Gryllus bimaculatus Species: Gryllus bimaculatus Genus: Gryllus Family: Gryllidae Order: Orthoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|350404195|ref|XP_003487031.1| PREDICTED: fragile X mental retardation syndrome-related protein 1-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340725692|ref|XP_003401200.1| PREDICTED: fragile X mental retardation syndrome-related protein 1-like isoform 3 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|340725688|ref|XP_003401198.1| PREDICTED: fragile X mental retardation syndrome-related protein 1-like isoform 1 [Bombus terrestris] gi|340725690|ref|XP_003401199.1| PREDICTED: fragile X mental retardation syndrome-related protein 1-like isoform 2 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|157122825|ref|XP_001659932.1| fragile X mental retardation syndrome-related protein 1, putative [Aedes aegypti] gi|108874593|gb|EAT38818.1| AAEL009326-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|328783510|ref|XP_394058.4| PREDICTED: fragile X mental retardation syndrome-related protein 1 isoform 2 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|332023074|gb|EGI63339.1| Fragile X mental retardation syndrome-related protein 1 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307203416|gb|EFN82491.1| Fragile X mental retardation syndrome-related protein 1 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|328783508|ref|XP_003250305.1| PREDICTED: fragile X mental retardation syndrome-related protein 1 isoform 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|383859712|ref|XP_003705336.1| PREDICTED: fragile X mental retardation syndrome-related protein 1-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 191 | ||||||
| FB|FBgn0028734 | 684 | Fmr1 "Fmr1" [Drosophila melano | 0.874 | 0.244 | 0.520 | 3.4e-42 | |
| UNIPROTKB|E9PSS6 | 519 | Fmr1 "Fragile X mental retarda | 0.884 | 0.325 | 0.467 | 1.6e-38 | |
| UNIPROTKB|E9PTH3 | 448 | Fmr1 "Fragile X mental retarda | 0.884 | 0.377 | 0.467 | 1.6e-38 | |
| RGD|2623 | 593 | Fmr1 "fragile X mental retarda | 0.884 | 0.284 | 0.467 | 1.7e-38 | |
| MGI|MGI:95564 | 614 | Fmr1 "fragile X mental retarda | 0.884 | 0.275 | 0.467 | 2.7e-38 | |
| UNIPROTKB|E9PSS4 | 614 | Fmr1 "Fragile X mental retarda | 0.884 | 0.275 | 0.467 | 2.7e-38 | |
| UNIPROTKB|A8MQB8 | 582 | FMR1 "Fragile X mental retarda | 0.884 | 0.290 | 0.455 | 5.5e-38 | |
| UNIPROTKB|G8JLE9 | 537 | FMR1 "Fragile X mental retarda | 0.884 | 0.314 | 0.455 | 5.5e-38 | |
| UNIPROTKB|Q8IXW7 | 297 | FMR1 "FMR1 protein" [Homo sapi | 0.884 | 0.569 | 0.455 | 5.5e-38 | |
| UNIPROTKB|K7GQ00 | 569 | FMR1 "Uncharacterized protein" | 0.884 | 0.297 | 0.461 | 5.5e-38 |
| FB|FBgn0028734 Fmr1 "Fmr1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 450 (163.5 bits), Expect = 3.4e-42, P = 3.4e-42
Identities = 89/171 (52%), Positives = 121/171 (70%)
Query: 19 PES-KFQFSMVRLPPRETINSG---FVENQEVEVFSKATEGESCGWWKVIVKMIKGDFHV 74
PES K+ F VRLPP ET+ F E EVEVF++ + E+CGWW I+KM K + +
Sbjct: 36 PESMKYPFVNVRLPPEETVEVAAPIFEEGMEVEVFTRTNDRETCGWWVGIIKMRKAEIYA 95
Query: 75 VEYLGCQSTFTEIVPPERMRQKNTNPPIDAKTFHKFDIEVPLDVQEFAKMEGAHKDFQKA 134
V Y+G ++++TEI R+R KN+NPPI AKTF++F + VP +++E A+ +G HK+FQ+
Sbjct: 96 VAYIGFETSYTEICELGRLRAKNSNPPITAKTFYQFTLPVPEELREEAQKDGIHKEFQRT 155
Query: 135 IAAAIVRYIPDKGALSVISRDEACQKRASMIKDMHFRNLNQKVVLLKRTED 185
I A + Y D AL VIS+ E QKRASM+KDMHFRNL+QKV+LLKRTE+
Sbjct: 156 IDAGVCNYSRDLDALIVISKFEHTQKRASMLKDMHFRNLSQKVMLLKRTEE 206
|
|
| UNIPROTKB|E9PSS6 Fmr1 "Fragile X mental retardation protein 1 homolog" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PTH3 Fmr1 "Fragile X mental retardation protein 1 homolog" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| RGD|2623 Fmr1 "fragile X mental retardation 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:95564 Fmr1 "fragile X mental retardation syndrome 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PSS4 Fmr1 "Fragile X mental retardation protein 1 homolog" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A8MQB8 FMR1 "Fragile X mental retardation protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G8JLE9 FMR1 "Fragile X mental retardation protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8IXW7 FMR1 "FMR1 protein" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7GQ00 FMR1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 191 | |||
| pfam05641 | 66 | pfam05641, Agenet, Agenet domain | 8e-04 |
| >gnl|CDD|218672 pfam05641, Agenet, Agenet domain | Back alignment and domain information |
|---|
Score = 36.2 bits (84), Expect = 8e-04
Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 8/62 (12%)
Query: 40 FVENQEVEVFSKATEGESCGWWKVIV-KMIKGDFHVVEYL------GCQSTFTEIVPPER 92
F + EVEV S+ E W++ V K + D + VEY G + E V R
Sbjct: 1 FSKGSEVEVSSEEEGFEGA-WFRAKVLKELGEDKYKVEYDDLSLEDGGSAPLNETVDLRR 59
Query: 93 MR 94
+R
Sbjct: 60 IR 61
|
This domain is related to the TUDOR domain pfam00567. The function of the agenet domain is unknown. This family currently only matches one of the two Agenet domains in the FMR proteins. Length = 66 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 191 | |||
| PF05641 | 68 | Agenet: Agenet domain; InterPro: IPR008395 This do | 98.97 | |
| smart00743 | 61 | Agenet Tudor-like domain present in plant sequence | 98.77 | |
| smart00561 | 96 | MBT Present in Drosophila Scm, l(3)mbt, and verteb | 97.46 | |
| PF11717 | 55 | Tudor-knot: RNA binding activity-knot of a chromod | 97.41 | |
| smart00333 | 57 | TUDOR Tudor domain. Domain of unknown function pre | 96.33 | |
| cd04508 | 48 | TUDOR Tudor domains are found in many eukaryotic o | 96.03 | |
| cd05162 | 87 | PWWP The PWWP domain, named for a conserved Pro-Tr | 95.16 | |
| PF00855 | 86 | PWWP: PWWP domain; InterPro: IPR000313 Upon charac | 94.79 | |
| PF02820 | 73 | MBT: mbt repeat; InterPro: IPR004092 The function | 94.75 | |
| cd05835 | 87 | Dnmt3b_related The PWWP domain is an essential com | 94.1 | |
| PF00018 | 48 | SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho | 93.98 | |
| cd05836 | 86 | N_Pac_NP60 The PWWP domain is an essential part of | 93.25 | |
| PF07653 | 55 | SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 | 92.47 | |
| cd05834 | 83 | HDGF_related The PWWP domain is an essential part | 91.22 | |
| PLN00104 | 450 | MYST -like histone acetyltransferase; Provisional | 91.04 | |
| PF14604 | 49 | SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 | 90.99 | |
| PF06003 | 264 | SMN: Survival motor neuron protein (SMN); InterPro | 90.7 | |
| smart00293 | 63 | PWWP domain with conserved PWWP motif. conservatio | 90.61 | |
| PF15057 | 124 | DUF4537: Domain of unknown function (DUF4537) | 90.37 | |
| KOG0162|consensus | 1106 | 90.19 | ||
| cd05840 | 93 | SPBC215_ISWI_like The PWWP domain is a component o | 90.06 | |
| PF00567 | 121 | TUDOR: Tudor domain; InterPro: IPR008191 There are | 89.12 | |
| cd05837 | 110 | MSH6_like The PWWP domain is present in MSH6, a mi | 87.59 | |
| smart00326 | 58 | SH3 Src homology 3 domains. Src homology 3 (SH3) d | 87.27 | |
| cd00174 | 54 | SH3 Src homology 3 domains; SH3 domains bind to pr | 86.53 | |
| COG2139 | 98 | RPL21A Ribosomal protein L21E [Translation, riboso | 83.95 | |
| cd05841 | 83 | BS69_related The PWWP domain is part of BS69 prote | 81.61 | |
| cd06080 | 80 | MUM1_like Mutated melanoma-associated antigen 1 (M | 81.17 |
| >PF05641 Agenet: Agenet domain; InterPro: IPR008395 This domain is related to the TUDOR domain IPR008191 from INTERPRO [] | Back alignment and domain information |
|---|
Probab=98.97 E-value=1.2e-09 Score=77.40 Aligned_cols=59 Identities=31% Similarity=0.392 Sum_probs=41.2
Q ss_pred ccCCCeEEEEeecCCCCccceeeEEEEEEecc-EEEEEEeccCCc------ceeeecCCCcccCCCC
Q psy985 40 FVENQEVEVFSKATEGESCGWWKVIVKMIKGD-FHVVEYLGCQST------FTEIVPPERMRQKNTN 99 (191)
Q Consensus 40 ~~egdeVEV~sran~~ep~gWW~a~V~~iKGd-f~vVey~~~d~~------~teIV~~erLR~~n~n 99 (191)
|..|+.|||++..+ +-.++|++|+|..+.++ .|.|+|...... .+|+|+..+|||..|.
T Consensus 1 F~~G~~VEV~s~e~-g~~gaWf~a~V~~~~~~~~~~V~Y~~~~~~~~~~~~l~e~V~~~~iRP~pP~ 66 (68)
T PF05641_consen 1 FKKGDEVEVSSDED-GFRGAWFPATVLKENGDDKYLVEYDDLPDEDGESPPLKEWVDARRIRPCPPP 66 (68)
T ss_dssp --TT-EEEEEE-SB-TT--EEEEEEEEEEETT-EEEEEETT-SS--------EEEEEGGGEEE----
T ss_pred CCCCCEEEEEEcCC-CCCcEEEEEEEEEeCCCcEEEEEECCcccccccccccEEEechheEECcCcC
Confidence 67999999998554 44899999999999999 999999766433 7999999999998753
|
The function of the agenet domain is unknown. This signature matches one of the two Agenet domains in the FMR proteins [].; GO: 0003723 RNA binding; PDB: 2BKD_N 3O8V_A 3KUF_A 3H8Z_A. |
| >smart00743 Agenet Tudor-like domain present in plant sequences | Back alignment and domain information |
|---|
| >smart00561 MBT Present in Drosophila Scm, l(3)mbt, and vertebrate SCML2 | Back alignment and domain information |
|---|
| >PF11717 Tudor-knot: RNA binding activity-knot of a chromodomain ; PDB: 2EKO_A 2RO0_A 2RNZ_A 1WGS_A 3E9G_A 3E9F_A 2K3X_A 2K3Y_A 2EFI_A 2F5K_F | Back alignment and domain information |
|---|
| >smart00333 TUDOR Tudor domain | Back alignment and domain information |
|---|
| >cd04508 TUDOR Tudor domains are found in many eukaryotic organisms and have been implicated in protein-protein interactions in which methylated protein substrates bind to these domains | Back alignment and domain information |
|---|
| >cd05162 PWWP The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids | Back alignment and domain information |
|---|
| >PF00855 PWWP: PWWP domain; InterPro: IPR000313 Upon characterisation of WHSC1, a gene mapping to the Wolf-Hirschhornsyndrome critical region and at its C terminus similar to the Drosophila melanogaster ASH1/trithorax group proteins, a novel protein domain designated PWWP domain was identified [] | Back alignment and domain information |
|---|
| >PF02820 MBT: mbt repeat; InterPro: IPR004092 The function of the malignant brain tumor (MBT) repeat is unknown, but is found in a number of nuclear proteins involved in transcriptional repression | Back alignment and domain information |
|---|
| >cd05835 Dnmt3b_related The PWWP domain is an essential component of DNA methyltransferase 3 B (Dnmt3b) which is responsible for establishing DNA methylation patterns during embryogenesis and gametogenesis | Back alignment and domain information |
|---|
| >PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >cd05836 N_Pac_NP60 The PWWP domain is an essential part of the cytokine-like nuclear factor n-pac protein, or NP60, which enhances the activity of MAP2K4 and MAP2K6 kinases to phosphorylate p38-alpha | Back alignment and domain information |
|---|
| >PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >cd05834 HDGF_related The PWWP domain is an essential part of the Hepatoma Derived Growth Factor (HDGF) family of proteins, and is necessary for DNA binding by HDGF | Back alignment and domain information |
|---|
| >PLN00104 MYST -like histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A | Back alignment and domain information |
|---|
| >PF06003 SMN: Survival motor neuron protein (SMN); InterPro: IPR010304 This family consists of several eukaryotic survival motor neuron (SMN) proteins | Back alignment and domain information |
|---|
| >smart00293 PWWP domain with conserved PWWP motif | Back alignment and domain information |
|---|
| >PF15057 DUF4537: Domain of unknown function (DUF4537) | Back alignment and domain information |
|---|
| >KOG0162|consensus | Back alignment and domain information |
|---|
| >cd05840 SPBC215_ISWI_like The PWWP domain is a component of the S | Back alignment and domain information |
|---|
| >PF00567 TUDOR: Tudor domain; InterPro: IPR008191 There are multiple copies of this domain in the Drosophila melanogaster tudor protein and it has been identified in several RNA-binding proteins [] | Back alignment and domain information |
|---|
| >cd05837 MSH6_like The PWWP domain is present in MSH6, a mismatch repair protein homologous to bacterial MutS | Back alignment and domain information |
|---|
| >smart00326 SH3 Src homology 3 domains | Back alignment and domain information |
|---|
| >cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies | Back alignment and domain information |
|---|
| >COG2139 RPL21A Ribosomal protein L21E [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd05841 BS69_related The PWWP domain is part of BS69 protein, a nuclear protein that specifically binds adenoviral E1A and Epstein-Barr viral EBNA2 proteins, suppressing their transactivation functions | Back alignment and domain information |
|---|
| >cd06080 MUM1_like Mutated melanoma-associated antigen 1 (MUM-1) is a melanoma-associated antigen (MAA) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 191 | ||||
| 2bkd_N | 134 | Structure Of The N-Terminal Domain Of Fragile X Men | 7e-22 | ||
| 3kuf_A | 131 | The Crystal Structure Of The Tudor Domains From Fxr | 1e-20 | ||
| 3h8z_A | 128 | The Crystal Structure Of The Tudor Domains From Fxr | 2e-19 |
| >pdb|2BKD|N Chain N, Structure Of The N-Terminal Domain Of Fragile X Mental Retardation Protein Length = 134 | Back alignment and structure |
|
| >pdb|3KUF|A Chain A, The Crystal Structure Of The Tudor Domains From Fxr1 Length = 131 | Back alignment and structure |
| >pdb|3H8Z|A Chain A, The Crystal Structure Of The Tudor Domains From Fxr2 Length = 128 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 191 | |||
| 3h8z_A | 128 | FragIle X mental retardation syndrome-related Pro; | 4e-35 |
| >3h8z_A FragIle X mental retardation syndrome-related Pro; tudor domains, FXR2, structura genomics, structural genomics consortium, SGC; 1.92A {Homo sapiens} PDB: 3o8v_A 3kuf_A 2bkd_N* Length = 128 | Back alignment and structure |
|---|
Score = 119 bits (298), Expect = 4e-35
Identities = 44/91 (48%), Positives = 55/91 (60%)
Query: 17 WQPESKFQFSMVRLPPRETINSGFVENQEVEVFSKATEGESCGWWKVIVKMIKGDFHVVE 76
WQ E + F VRLPP N E EVEV+S+A E E CGWW V+M+KGDF+V+E
Sbjct: 38 WQSERQIPFGDVRLPPPADYNKEITEGDEVEVYSRANEQEPCGWWLARVRMMKGDFYVIE 97
Query: 77 YLGCQSTFTEIVPPERMRQKNTNPPIDAKTF 107
Y C +T+ EIV ER+R N NP +F
Sbjct: 98 YAACDATYNEIVTLERLRPVNPNPLATKGSF 128
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 191 | |||
| 3h8z_A | 128 | FragIle X mental retardation syndrome-related Pro; | 100.0 | |
| 3sd4_A | 69 | PHD finger protein 20; tudor domain, transcription | 98.18 | |
| 2eqm_A | 88 | PHD finger protein 20-like 1; structural genomics, | 98.04 | |
| 2f5k_A | 102 | MORF-related gene 15 isoform 1; beta barrel, gene | 98.0 | |
| 3m9q_A | 101 | Protein MALE-specific lethal-3; chromodomain, MSL3 | 97.72 | |
| 2lcc_A | 76 | AT-rich interactive domain-containing protein 4A; | 97.63 | |
| 3m9p_A | 110 | MALE-specific lethal 3 homolog; chromodomain, MSL3 | 97.61 | |
| 3oa6_A | 110 | MALE-specific lethal 3 homolog; chromodomain, MSL3 | 97.36 | |
| 2k3y_A | 136 | Chromatin modification-related protein EAF3; dimet | 97.33 | |
| 2lrq_A | 85 | Protein MRG15, NUA4 complex subunit EAF3 homolog; | 96.42 | |
| 1mhn_A | 59 | SurviVal motor neuron protein; SMN, SMA, spinal mu | 97.28 | |
| 1wgs_A | 133 | MYST histone acetyltransferase 1; tudor domain, MY | 97.27 | |
| 4a4f_A | 64 | SurviVal of motor neuron-related-splicing factor; | 97.26 | |
| 2eko_A | 87 | Histone acetyltransferase htatip; chromo domain, h | 97.17 | |
| 2rnz_A | 94 | Histone acetyltransferase ESA1; HAT, chromodomain, | 97.01 | |
| 1g5v_A | 88 | SurviVal motor neuron protein 1; mRNA processing, | 97.0 | |
| 2equ_A | 74 | PHD finger protein 20-like 1; tudor domain, struct | 96.82 | |
| 3s6w_A | 54 | Tudor domain-containing protein 3; methylated argi | 96.77 | |
| 2d9t_A | 78 | Tudor domain-containing protein 3; structural geno | 96.75 | |
| 1wjq_A | 107 | KIAA1798 protein; MBT domain, structural genomics, | 96.71 | |
| 3pnw_C | 77 | Tudor domain-containing protein 3; FAB, structural | 96.62 | |
| 2ro0_A | 92 | Histone acetyltransferase ESA1; HAT, chromodomain, | 96.51 | |
| 2biv_A | 243 | SCML2 protein, sex COMB on midleg-like protein 2; | 96.24 | |
| 2r58_A | 265 | Polycomb protein SCM; MBT repeat, sex COMB on midl | 96.16 | |
| 2r58_A | 265 | Polycomb protein SCM; MBT repeat, sex COMB on midl | 96.07 | |
| 3qii_A | 85 | PHD finger protein 20; tudor domain, structural ge | 95.99 | |
| 2wac_A | 218 | CG7008-PA; unknown function, tudor, beta-barrel, n | 95.96 | |
| 3p8d_A | 67 | Medulloblastoma antigen MU-MB-50.72; tudor domain, | 95.86 | |
| 2biv_A | 243 | SCML2 protein, sex COMB on midleg-like protein 2; | 95.69 | |
| 2eqk_A | 85 | Tudor domain-containing protein 4; structural geno | 95.67 | |
| 3fdr_A | 94 | Tudor and KH domain-containing protein; TDRD2, str | 95.63 | |
| 2i0n_A | 80 | Class VII unconventional myosin; beta-sheet loop, | 95.01 | |
| 2cub_A | 88 | Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor | 94.9 | |
| 1oz2_A | 331 | Lethal(3)malignant brain tumor-like protein; prope | 94.7 | |
| 2ldm_A | 81 | Uncharacterized protein; PHF20, tudor domain, epig | 93.69 | |
| 2yup_A | 90 | Vinexin; sorbin and SH3 domain-containing protein | 94.64 | |
| 3ut1_A | 324 | Lethal(3)malignant brain tumor-like protein 3; chr | 94.51 | |
| 2diq_A | 110 | Tudor and KH domain-containing protein; tudor doma | 94.49 | |
| 2lj0_A | 65 | Sorbin and SH3 domain-containing protein 1; R85FL, | 94.43 | |
| 3h8z_A | 128 | FragIle X mental retardation syndrome-related Pro; | 94.41 | |
| 1y0m_A | 61 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 94.39 | |
| 1tg0_A | 68 | BBC1 protein, myosin tail region-interacting prote | 94.27 | |
| 2ysq_A | 81 | RHO guanine nucleotide exchange factor 9; SH3 doma | 94.22 | |
| 2bud_A | 92 | Males-absent on the first protein; transferase, MO | 94.06 | |
| 2yuo_A | 78 | CIP85, RUN and TBC1 domain containing 3; structura | 94.0 | |
| 1wjr_A | 127 | KIAA1617 protein; MBT domain, structural genomics, | 93.98 | |
| 3bdl_A | 570 | Staphylococcal nuclease domain-containing protein | 93.91 | |
| 2ekh_A | 80 | SH3 and PX domain-containing protein 2A; SH3 domai | 93.9 | |
| 3ntk_A | 169 | Maternal protein tudor; tudor domain, OB-fold, GER | 93.88 | |
| 2dbk_A | 88 | CRK-like protein; structural genomics, NPPSFA, nat | 93.82 | |
| 1uti_A | 58 | GRB2-related adaptor protein 2; signaling protein | 93.8 | |
| 2csi_A | 76 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 93.77 | |
| 1ue9_A | 80 | Intersectin 2; beta barrel, SH3 domain, riken stru | 93.61 | |
| 1wxu_A | 93 | Peroxisomal biogenesis factor 13; SH3 domain, PEX1 | 93.57 | |
| 2dmo_A | 68 | Neutrophil cytosol factor 2; SH3 domain, structura | 93.54 | |
| 2bzy_A | 67 | CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu | 93.52 | |
| 1oz2_A | 331 | Lethal(3)malignant brain tumor-like protein; prope | 93.47 | |
| 2yun_A | 79 | Nostrin; nitric oxide synthase trafficker, structu | 93.44 | |
| 2pqh_A | 80 | Spectrin alpha chain, brain; SH3 domain, chimera, | 93.43 | |
| 1x2q_A | 88 | Signal transducing adapter molecule 2; SH3 domain, | 93.37 | |
| 1jo8_A | 58 | ABP1P, actin binding protein; SH3 domain actin-bin | 93.36 | |
| 1wx6_A | 91 | Cytoplasmic protein NCK2; SH3 domain, structural g | 93.28 | |
| 1w70_A | 60 | Neutrophil cytosol factor 4; NADPH oxidase, P40PHO | 93.27 | |
| 2oaw_A | 65 | Spectrin alpha chain, brain; SH3 domain, chimera, | 93.23 | |
| 1neg_A | 83 | Spectrin alpha chain, brain; SH3-domain fold, five | 93.16 | |
| 2csq_A | 97 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 93.14 | |
| 2lx7_A | 60 | GAS-7, growth arrest-specific protein 7; structura | 93.13 | |
| 1k4u_S | 62 | Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti | 93.01 | |
| 1ruw_A | 69 | Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th | 92.98 | |
| 2ew3_A | 68 | SH3-containing GRB2-like protein 3; SH3GL3, soluti | 92.93 | |
| 2gnc_A | 60 | SLIT-ROBO RHO GTPase-activating protein 1; beta ba | 92.81 | |
| 1uj0_A | 62 | Signal transducing adaptor molecule (SH3 domain an | 92.8 | |
| 3ut1_A | 324 | Lethal(3)malignant brain tumor-like protein 3; chr | 92.74 | |
| 3ulr_B | 65 | SRC substrate cortactin; SH3, protein-protein inte | 92.73 | |
| 2o9s_A | 67 | Ponsin; SH3 domain, signaling protein; 0.83A {Homo | 92.65 | |
| 2dl8_A | 72 | SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom | 92.65 | |
| 1nm7_A | 69 | Peroxisomal membrane protein PAS20; yeast, PEX5P, | 92.64 | |
| 1cka_A | 57 | C-CRK N-terminal SH3 domain; complex (oncogene pro | 92.59 | |
| 3o5z_A | 90 | Phosphatidylinositol 3-kinase regulatory subunit; | 92.51 | |
| 1g2b_A | 62 | Spectrin alpha chain; capping protein, calcium-bin | 92.48 | |
| 2eyx_A | 67 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 92.46 | |
| 3e9g_A | 130 | Chromatin modification-related protein EAF3; chrom | 92.44 | |
| 2j6f_A | 62 | CD2-associated protein; metal-binding, immune resp | 92.44 | |
| 1zx6_A | 58 | YPR154WP; SH3 domain, protein binding; 1.60A {Sacc | 92.41 | |
| 2bz8_A | 58 | SH3-domain kinase binding protein 1; SH3 domain, C | 92.36 | |
| 1w1f_A | 65 | Tyrosine-protein kinase LYN; SH3-domain, SH3 domai | 92.28 | |
| 1zuu_A | 58 | BZZ1 protein; SH3 domain, unknown function; 0.97A | 92.21 | |
| 2a28_A | 54 | BZZ1 protein; SH3 domain, signaling protein; 1.07A | 92.18 | |
| 1b07_A | 65 | Protein (proto-oncogene CRK (CRK)); SH3 domain, in | 92.08 | |
| 2j05_A | 65 | RAS GTPase-activating protein 1; GTPase activation | 92.08 | |
| 1uhc_A | 79 | KIAA1010 protein; beta barrel, SH3, human cDNA, st | 92.06 | |
| 2eqi_A | 69 | Phospholipase C, gamma 2; SH3 domain, PLCG2, struc | 91.98 | |
| 2g6f_X | 59 | RHO guanine nucleotide exchange factor 7; SH3 doma | 91.95 | |
| 1zuy_A | 58 | Myosin-5 isoform; SH3 domain, contractIle protein; | 91.95 | |
| 3feo_A | 437 | MBT domain-containing protein 1; MBTL1, structural | 91.94 | |
| 1wie_A | 96 | RIM binding protein 2; beta barrel, KIAA0318 prote | 91.89 | |
| 1oot_A | 60 | Hypothetical 40.4 kDa protein in PES4-His2 interge | 91.81 | |
| 2gfu_A | 134 | DNA mismatch repair protein MSH6; PWWP domain, tud | 91.8 | |
| 2dl3_A | 68 | Sorbin and SH3 domain-containing protein 1; ponsin | 91.79 | |
| 2daq_A | 110 | WHSC1L1 protein, isoform long; PWWP domain, struct | 91.78 | |
| 2lcs_A | 73 | NAP1-binding protein 2; adaptor, transferase, sign | 91.78 | |
| 2ebp_A | 73 | SAM and SH3 domain-containing protein 1; proline-g | 91.76 | |
| 2hqx_A | 246 | P100 CO-activator tudor domain; human P100 tudor d | 91.76 | |
| 4glm_A | 72 | Dynamin-binding protein; SH3 domain, DNMBP, struct | 91.69 | |
| 3u23_A | 65 | CD2-associated protein; structural genomics, struc | 91.67 | |
| 2epd_A | 76 | RHO GTPase-activating protein 4; SH3 domain, struc | 91.63 | |
| 2dl7_A | 73 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 91.61 | |
| 4e6r_A | 58 | Cytoplasmic protein NCK2; SH3 domain, protein bind | 91.6 | |
| 2fpe_A | 62 | C-JUN-amino-terminal kinase interacting protein 1; | 91.56 | |
| 2nwm_A | 65 | Vinexin; cell adhesion; NMR {Homo sapiens} | 91.5 | |
| 2kbt_A | 142 | Chimera of proto-oncogene VAV, linker, immunoglobu | 91.45 | |
| 1sem_A | 58 | SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin | 91.43 | |
| 2x3w_D | 60 | Syndapin I, protein kinase C and casein kinase sub | 91.4 | |
| 3cqt_A | 79 | P59-FYN, proto-oncogene tyrosine-protein kinase FY | 91.39 | |
| 2dl4_A | 68 | Protein STAC; SH3 domain, STAC protein, SRC homolo | 91.39 | |
| 2ct4_A | 70 | CDC42-interacting protein 4; thyroid receptor inte | 91.37 | |
| 1x69_A | 79 | Cortactin isoform A; SH3 domain, CTTN, oncogene EM | 91.37 | |
| 2ke9_A | 83 | Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp | 91.3 | |
| 4f14_A | 64 | Nebulette; SH3 domain, heart muscle, actin-binding | 91.25 | |
| 2iim_A | 62 | Proto-oncogene tyrosine-protein kinase LCK; beta-b | 91.24 | |
| 2xmf_A | 60 | Myosin 1E SH3; motor protein, SH3 domain; HET: DIA | 91.2 | |
| 1x6g_A | 81 | Megakaryocyte-associated tyrosine-protein kinase; | 91.15 | |
| 1uff_A | 93 | Intersectin 2; beta barrel, SH3 domain, endocytosi | 91.12 | |
| 3ngp_A | 62 | Spectrin alpha chain, brain; beta barrel, structur | 91.12 | |
| 1zlm_A | 58 | Osteoclast stimulating factor 1; beta barrel, sign | 91.07 | |
| 1gl5_A | 67 | Tyrosine-protein kinase TEC; transferase, ATP-bind | 91.03 | |
| 2djq_A | 68 | SH3 domain containing ring finger 2; MUS musculus | 90.95 | |
| 1s1n_A | 68 | Nephrocystin 1; beta barrel, cell adhesion; NMR {H | 90.91 | |
| 2ed0_A | 78 | ABL interactor 2; coiled coil, cytoskeleton, nucle | 90.9 | |
| 2fei_A | 65 | CD2-associated protein; CMS SH3 domain, structural | 90.86 | |
| 2vwf_A | 58 | Growth factor receptor-bound protein 2; polymorphi | 90.85 | |
| 2ege_A | 75 | Uncharacterized protein KIAA1666; SH3 domain, KIAA | 90.84 | |
| 2jte_A | 64 | CD2-associated protein; SH3 domain, coiled coil, c | 90.8 | |
| 1v1c_A | 71 | Obscurin; muscle, sarcomere, adapter, myogenesis, | 90.73 | |
| 2drm_A | 58 | Acanthamoeba myosin IB; SH3 domain, contractIle pr | 90.73 | |
| 1j3t_A | 74 | Intersectin 2; beta barrel, SH3 domain, riken stru | 90.72 | |
| 3c0c_A | 73 | Endophilin-A2; endocytosis, SH3, voltage-gated cal | 90.64 | |
| 3h0h_A | 73 | Proto-oncogene tyrosine-protein kinase FYN; beta b | 90.63 | |
| 2fpf_A | 71 | C-JUN-amino-terminal kinase interacting protein 1; | 90.62 | |
| 4fu6_A | 153 | PC4 and SFRS1-interacting protein; structural geno | 90.6 | |
| 2l0a_A | 72 | STAM-1, signal transducing adapter molecule 1; str | 90.6 | |
| 2ak5_A | 64 | RHO guanine nucleotide exchange factor 7; adaptor | 90.55 | |
| 2dlp_A | 85 | KIAA1783 protein; SH3 domain, structural genomics, | 90.47 | |
| 2cuc_A | 70 | SH3 domain containing ring finger 2; structural ge | 90.43 | |
| 2dbm_A | 73 | SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH | 90.43 | |
| 1u5s_A | 71 | Cytoplasmic protein NCK2; protein-protein complex, | 90.33 | |
| 2v1r_A | 80 | Peroxisomal membrane protein PAS20; protein transp | 90.3 | |
| 2ecz_A | 70 | Sorbin and SH3 domain-containing protein 1; glycop | 90.13 | |
| 2k9g_A | 73 | SH3 domain-containing kinase-binding protein 1; CI | 90.13 | |
| 3thk_A | 73 | Spectrin alpha chain, brain; SH3 domain, chimera, | 90.11 | |
| 3feo_A | 437 | MBT domain-containing protein 1; MBTL1, structural | 89.96 | |
| 1i1j_A | 108 | Melanoma derived growth regulatory protein; SH3 su | 89.94 | |
| 1csk_A | 71 | C-SRC SH3 domain; phosphotransferase; 2.50A {Homo | 89.9 | |
| 1ri0_A | 110 | Hepatoma-derived growth factor; HDGF, HATH domain, | 89.83 | |
| 4b9w_A | 201 | TDRD1, tudor domain-containing protein 1; replicat | 89.78 | |
| 1k1z_A | 78 | VAV; SH3, proto-oncogene, signaling protein; NMR { | 89.75 | |
| 3h6z_A | 447 | Polycomb protein SFMBT; MBT, MBR repeat, aromatic | 89.73 | |
| 2ct3_A | 70 | Vinexin; SH3 domian, structural genomics, NPPSFA, | 89.68 | |
| 2dl5_A | 78 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 89.64 | |
| 1z9q_A | 79 | Neutrophil cytosol factor 4; oxidoreductase activa | 89.54 | |
| 2ega_A | 70 | SH3 and PX domain-containing protein 2A; SH3 domai | 89.47 | |
| 1gcq_C | 70 | VAV proto-oncogene; SH3 domain, protein-protein co | 89.46 | |
| 2v1q_A | 60 | SLA1, cytoskeleton assembly control protein SLA1; | 89.4 | |
| 2d8j_A | 77 | FYN-related kinase; SH3 domain, structural genomic | 89.4 | |
| 2dm1_A | 73 | Protein VAV-2; RHO family guanine nucleotide excha | 89.37 | |
| 1hsq_A | 71 | Phospholipase C-gamma (SH3 domain); phosphoric die | 89.35 | |
| 1x2k_A | 68 | OSTF1, osteoclast stimulating factor 1; SH3 domain | 89.33 | |
| 2b86_A | 67 | Cytoplasmic protein NCK2; NCK SH3 domain, signalin | 89.32 | |
| 4esr_A | 69 | Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai | 89.27 | |
| 1wyx_A | 69 | CRK-associated substrate; beta sheets, cell adhesi | 89.25 | |
| 2ed1_A | 76 | 130 kDa phosphatidylinositol 4,5-biphosphate- depe | 89.17 | |
| 2oi3_A | 86 | Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t | 89.14 | |
| 2o2o_A | 92 | SH3-domain kinase-binding protein 1; CIN85, protei | 89.08 | |
| 2ydl_A | 69 | SH3 domain-containing kinase-binding protein 1; si | 89.05 | |
| 1yn8_A | 59 | NBP2, NAP1-binding protein 2; SH3 domain, unknown | 88.92 | |
| 1tuc_A | 63 | Alpha-spectrin; capping protein, calcium-binding, | 88.9 | |
| 2jw4_A | 72 | Cytoplasmic protein NCK1; SH3 domain, phosphorylat | 88.87 | |
| 2dil_A | 69 | Proline-serine-threonine phosphatase-interacting p | 88.82 | |
| 3f70_A | 456 | Lethal(3)malignant brain tumor-like 2 protein; MBT | 88.7 | |
| 1wxt_A | 68 | Hypothetical protein FLJ21522; SH3 domain, EPS8-re | 88.65 | |
| 2kxd_A | 73 | 11-MER peptide, SH3 domain of spectrin alpha CHAI; | 88.57 | |
| 1x2p_A | 68 | Protein arginine N-methyltransferase 2; SH3 domain | 88.52 | |
| 1i07_A | 60 | Epidermal growth factor receptor kinase substrate | 88.44 | |
| 2k2m_A | 68 | EPS8-like protein 1; alternative splicing, coiled | 88.35 | |
| 4b9x_A | 226 | TDRD1, tudor domain-containing protein 1; replicat | 88.3 | |
| 2jxb_A | 86 | T-cell surface glycoprotein CD3 epsilon chain, cyt | 88.29 | |
| 2egc_A | 75 | SH3 and PX domain-containing protein 2A; SH3 domai | 88.29 | |
| 3f70_A | 456 | Lethal(3)malignant brain tumor-like 2 protein; MBT | 88.29 | |
| 2kxc_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 88.26 | |
| 3eg3_A | 63 | Proto-oncogene tyrosine-protein kinase ABL1; beta, | 88.25 | |
| 1jqq_A | 92 | PEX13P, peroxisomal membrane protein PAS20, PAS20P | 88.15 | |
| 2gqi_A | 71 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 88.13 | |
| 4ag1_C | 84 | Fynomer; hydrolase-de novo protein complex, inhibi | 88.11 | |
| 3a98_A | 184 | DOCK2, dedicator of cytokinesis protein 2; protein | 88.05 | |
| 2rf0_A | 89 | Mitogen-activated protein kinase kinase kinase 10; | 88.01 | |
| 2cre_A | 71 | HEF-like protein; SH3 domain, SRC homology 3 domai | 87.84 | |
| 3jv3_A | 283 | Intersectin-1; SH3 domain, DH domain, guanine nucl | 87.83 | |
| 1wxb_A | 68 | Epidermal growth factor receptor pathway substrate | 87.72 | |
| 2l89_A | 108 | PWWP domain-containing protein 1; histone binding, | 87.68 | |
| 1ujy_A | 76 | RHO guanine nucleotide exchange factor 6; structur | 87.67 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 87.67 | |
| 1spk_A | 72 | RSGI RUH-010, riken cDNA 1300006M19; structural ge | 87.39 | |
| 2kgt_A | 72 | Tyrosine-protein kinase 6; SH3 domain, SRC kinase, | 87.36 | |
| 2dnu_A | 71 | RUH-061, SH3 multiple domains 1; RSGI, structural | 87.23 | |
| 2rqr_A | 119 | CED-12 homolog, engulfment and cell motility prote | 87.22 | |
| 2enm_A | 77 | Sorting nexin-9; SH3-like barrel, protein transpor | 87.1 | |
| 3rnj_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 87.07 | |
| 1h3z_A | 109 | Hypothetical 62.8 kDa protein C215.07C; nuclear pr | 87.02 | |
| 2jt4_A | 71 | Cytoskeleton assembly control protein SLA1; endocy | 86.97 | |
| 2d8h_A | 80 | SH3YL1 protein; SH3 domain, hypothetical protein S | 86.97 | |
| 2jmc_A | 77 | Spectrin alpha chain, brain and P41 peptide chimer | 86.94 | |
| 1gbq_A | 74 | GRB2; complex (signal transduction/peptide), SH3 d | 86.89 | |
| 3i5r_A | 83 | Phosphatidylinositol 3-kinase regulatory subunit a | 86.81 | |
| 1x6b_A | 79 | RHO guanine exchange factor (GEF) 16; SH3 domain, | 86.4 | |
| 3pfs_A | 158 | Bromodomain and PHD finger-containing protein 3; s | 86.35 | |
| 2e5k_A | 94 | Suppressor of T-cell receptor signaling 1; SH3 dom | 86.25 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 86.14 | |
| 2yt6_A | 109 | Adult MALE urinary bladder cDNA, riken FULL- lengt | 85.97 | |
| 1bb9_A | 115 | Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat | 85.66 | |
| 2yuq_A | 85 | Tyrosine-protein kinase ITK/TSK; T-cell-specific k | 85.47 | |
| 2m0y_A | 74 | Dedicator of cytokinesis protein 1; apoptosis; NMR | 85.02 | |
| 3qwx_X | 174 | Cell death abnormality protein 2; cell engulfment, | 84.86 | |
| 1uhf_A | 69 | Intersectin 2; beta barrel, SH3 domain, riken stru | 84.79 | |
| 1khc_A | 147 | DNA cytosine-5 methyltransferase 3B2; five beta-sh | 84.75 | |
| 1x43_A | 81 | Endophilin B1, SH3 domain GRB2-like protein B1; st | 84.59 | |
| 1wi7_A | 68 | SH3-domain kinase binding protein 1; beta barrel, | 84.52 | |
| 3reb_B | 90 | Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain | 84.1 | |
| 2gtj_A | 96 | FYN-binding protein; SH3, redox, signaling protein | 84.06 | |
| 3h6z_A | 447 | Polycomb protein SFMBT; MBT, MBR repeat, aromatic | 83.61 | |
| 2da9_A | 70 | SH3-domain kinase binding protein 1; structural ge | 83.55 | |
| 1aww_A | 67 | ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke | 83.48 | |
| 2kym_A | 120 | BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI | 82.81 | |
| 3llr_A | 154 | DNA (cytosine-5)-methyltransferase 3A; DNA methylt | 82.67 | |
| 1ri9_A | 102 | FYN-binding protein; SH3-like, helically extended, | 81.8 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 81.52 | |
| 3qby_A | 94 | Hepatoma-derived growth factor-related protein 2; | 81.41 | |
| 1udl_A | 98 | Intersectin 2, KIAA1256; beta barrel, SH3 domain, | 81.3 | |
| 1awj_A | 77 | ITK; transferase, regulatory intramolecular comple | 81.06 | |
| 1ng2_A | 193 | Neutrophil cytosolic factor 1; P47PHOX, autoinhibi | 80.98 | |
| 1u3o_A | 82 | Huntingtin-associated protein-interacting protein; | 80.65 |
| >3h8z_A FragIle X mental retardation syndrome-related Pro; tudor domains, FXR2, structura genomics, structural genomics consortium, SGC; 1.92A {Homo sapiens} PDB: 3o8v_A 3kuf_A 2bkd_N* | Back alignment and structure |
|---|
Probab=100.00 E-value=4.3e-44 Score=282.57 Aligned_cols=100 Identities=46% Similarity=0.837 Sum_probs=82.8
Q ss_pred EEEEeecCCCCcccccccCcccccCCCCCCCCCccCCCeEEEEeecCCCCccceeeEEEEEEeccEEEEEEeccCCccee
Q psy985 7 NVSNPFSLLRWQPESKFQFSMVRLPPRETINSGFVENQEVEVFSKATEGESCGWWKVIVKMIKGDFHVVEYLGCQSTFTE 86 (191)
Q Consensus 7 ~v~V~f~eN~Wqpe~~vPf~~VRlPP~~~~~~~~~egdeVEV~sran~~ep~gWW~a~V~~iKGdf~vVey~~~d~~~te 86 (191)
+++|+| +|+|||+++|||++|||||+++.+.+|.+||+||||+++|++||||||+|+|+|+||+||+|+|+|||++|||
T Consensus 29 ~~~V~f-~n~w~~~~~vp~~~vRlpP~~~~~~~f~~gd~VEV~~~~~d~ep~gWw~a~I~~~kg~f~~V~y~~~~~~~~E 107 (128)
T 3h8z_A 29 SVTIFF-ENNWQSERQIPFGDVRLPPPADYNKEITEGDEVEVYSRANEQEPCGWWLARVRMMKGDFYVIEYAACDATYNE 107 (128)
T ss_dssp EEEEEE-TTCTTCCEEEEGGGEECCCCC----CCCTTCEEEEEECC---CCCEEEEEEEEEEETTEEEEEETTC----CE
T ss_pred cEEEEE-ccccCcceEechhhEEcCCCcccccCCCCCCEEEEEecCCCCCcCccEEEEEEEeeCCEEEEEEcCCCCCcce
Confidence 689999 9999999999999999999999889999999999999999999999999999999999999999999999999
Q ss_pred eecCCCcccCCCCCCCCcCce
Q psy985 87 IVPPERMRQKNTNPPIDAKTF 107 (191)
Q Consensus 87 IV~~erLR~~n~n~pi~~~~f 107 (191)
||+++||||+|+|+||+++||
T Consensus 108 iV~~~rlR~~n~~~p~~~~~f 128 (128)
T 3h8z_A 108 IVTLERLRPVNPNPLATKGSF 128 (128)
T ss_dssp EECGGGEEECCCCCCC-----
T ss_pred EEehhheEeCCCCCCcccCCC
Confidence 999999999999999999998
|
| >3sd4_A PHD finger protein 20; tudor domain, transcription; 1.93A {Homo sapiens} PDB: 3q1j_A | Back alignment and structure |
|---|
| >2eqm_A PHD finger protein 20-like 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2jtf_A | Back alignment and structure |
|---|
| >2f5k_A MORF-related gene 15 isoform 1; beta barrel, gene regulation; 2.20A {Homo sapiens} SCOP: b.34.13.3 PDB: 2efi_A | Back alignment and structure |
|---|
| >3m9q_A Protein MALE-specific lethal-3; chromodomain, MSL3, methyllysine recognition, aromatic CAGE, complex, transcription upregulation; 1.29A {Drosophila melanogaster} SCOP: b.34.13.0 | Back alignment and structure |
|---|
| >2lcc_A AT-rich interactive domain-containing protein 4A; chromobarrel domain, RBBP1, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3oa6_A MALE-specific lethal 3 homolog; chromodomain, MSL3, histone H4 tail, DNA backbone recognitio methyllysine recognition, H4K20ME1; HET: DNA MLZ; 2.35A {Homo sapiens} PDB: 3ob9_A* | Back alignment and structure |
|---|
| >2k3y_A Chromatin modification-related protein EAF3; dimethylated histone H3K36, EAF3-H3K36ME2 fusion, chromo barrel domain, histone deacetylase; HET: M2L; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2lrq_A Protein MRG15, NUA4 complex subunit EAF3 homolog; epigenetics, LID complex, transcription; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1mhn_A SurviVal motor neuron protein; SMN, SMA, spinal muscular atrophy, RNA binding protein; 1.80A {Homo sapiens} SCOP: b.34.9.1 PDB: 4a4e_A* 4a4g_A* | Back alignment and structure |
|---|
| >1wgs_A MYST histone acetyltransferase 1; tudor domain, MYST family, struct genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.34.13.3 | Back alignment and structure |
|---|
| >4a4f_A SurviVal of motor neuron-related-splicing factor; RNA binding protein; HET: 2MR; NMR {Homo sapiens} PDB: 4a4h_A* | Back alignment and structure |
|---|
| >2eko_A Histone acetyltransferase htatip; chromo domain, histone tail, chromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rnz_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1g5v_A SurviVal motor neuron protein 1; mRNA processing, translation; NMR {Homo sapiens} SCOP: b.34.9.1 | Back alignment and structure |
|---|
| >2equ_A PHD finger protein 20-like 1; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3s6w_A Tudor domain-containing protein 3; methylated arginine recognize, ISO-propanol, transcri; 1.78A {Homo sapiens} PDB: 3pmt_A* | Back alignment and structure |
|---|
| >2d9t_A Tudor domain-containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.34.9.1 | Back alignment and structure |
|---|
| >1wjq_A KIAA1798 protein; MBT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.9.3 | Back alignment and structure |
|---|
| >3pnw_C Tudor domain-containing protein 3; FAB, structural genomics consortium, antibody, SGC, protein immune system complex; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >2ro0_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2biv_A SCML2 protein, sex COMB on midleg-like protein 2; MBT, malignant brain tumor, transcription factor; 1.7A {Homo sapiens} SCOP: b.34.9.3 b.34.9.3 PDB: 1oi1_A 2vyt_A* 2p0k_A | Back alignment and structure |
|---|
| >2r58_A Polycomb protein SCM; MBT repeat, sex COMB on midleg, DI-methyl lysine, regulator, developmental protein, metal-binding, nucleus; HET: MLY; 2.00A {Drosophila melanogaster} PDB: 2r57_A* 2r5a_A* 2r5m_A* | Back alignment and structure |
|---|
| >2r58_A Polycomb protein SCM; MBT repeat, sex COMB on midleg, DI-methyl lysine, regulator, developmental protein, metal-binding, nucleus; HET: MLY; 2.00A {Drosophila melanogaster} PDB: 2r57_A* 2r5a_A* 2r5m_A* | Back alignment and structure |
|---|
| >3qii_A PHD finger protein 20; tudor domain, structural genomics, structural GE consortium, SGC, transcription regulator; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2wac_A CG7008-PA; unknown function, tudor, beta-barrel, nuclease domain, tudor P100, SND1, methylated arginine, SDMA, splicing; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3p8d_A Medulloblastoma antigen MU-MB-50.72; tudor domain, lysine-methylated P53 binding, histone binding binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2biv_A SCML2 protein, sex COMB on midleg-like protein 2; MBT, malignant brain tumor, transcription factor; 1.7A {Homo sapiens} SCOP: b.34.9.3 b.34.9.3 PDB: 1oi1_A 2vyt_A* 2p0k_A | Back alignment and structure |
|---|
| >2eqk_A Tudor domain-containing protein 4; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fdr_A Tudor and KH domain-containing protein; TDRD2, structural genomics, structural genomics consortium, SGC, alternative splicing, RNA-binding; 1.75A {Homo sapiens} SCOP: b.34.9.1 | Back alignment and structure |
|---|
| >2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1oz2_A Lethal(3)malignant brain tumor-like protein; propeller, transcription repressor, three malignant brain TU repeats, transcription; HET: MES; 1.55A {Homo sapiens} SCOP: b.34.9.3 b.34.9.3 b.34.9.3 PDB: 1oyx_A* 1oz3_A* 3oq5_A* 2rhi_A* 2rhx_A* 2rjd_A 2rjc_A 2rje_A* 2rjf_A* 3uwn_A* 2pqw_A* 3p8h_A* 2rhu_A* 2rhy_A* 2rhz_A* 2ri3_A* 2ri2_A* 2ri5_A* | Back alignment and structure |
|---|
| >2ldm_A Uncharacterized protein; PHF20, tudor domain, epigenetics, methylated P53, transcript factor, transcription-protein binding complex; HET: M2L; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ut1_A Lethal(3)malignant brain tumor-like protein 3; chromatin modification, transcription repression, MBT repeat structural genomics; HET: EPE; 2.05A {Homo sapiens} PDB: 4fl6_A* 1wjs_A | Back alignment and structure |
|---|
| >2diq_A Tudor and KH domain-containing protein; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.34.9.1 | Back alignment and structure |
|---|
| >2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A | Back alignment and structure |
|---|
| >3h8z_A FragIle X mental retardation syndrome-related Pro; tudor domains, FXR2, structura genomics, structural genomics consortium, SGC; 1.92A {Homo sapiens} PDB: 3o8v_A 3kuf_A 2bkd_N* | Back alignment and structure |
|---|
| >1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A | Back alignment and structure |
|---|
| >1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A | Back alignment and structure |
|---|
| >2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bud_A Males-absent on the first protein; transferase, MOF, HAT, acetyl-transfer, dosage compensation complex, DCC, royal family; NMR {Drosophila melanogaster} SCOP: b.34.13.3 | Back alignment and structure |
|---|
| >2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wjr_A KIAA1617 protein; MBT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.9.3 | Back alignment and structure |
|---|
| >3bdl_A Staphylococcal nuclease domain-containing protein 1; staphylococcal nuclease OB fold, tudor domain, cytoplasm, HOST-virus interaction, nucleus; HET: CIT; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ntk_A Maternal protein tudor; tudor domain, OB-fold, GERM cell formation, transcription; 1.80A {Drosophila melanogaster} PDB: 3nth_A* 3nti_A* | Back alignment and structure |
|---|
| >2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A | Back alignment and structure |
|---|
| >2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A | Back alignment and structure |
|---|
| >1oz2_A Lethal(3)malignant brain tumor-like protein; propeller, transcription repressor, three malignant brain TU repeats, transcription; HET: MES; 1.55A {Homo sapiens} SCOP: b.34.9.3 b.34.9.3 b.34.9.3 PDB: 1oyx_A* 1oz3_A* 3oq5_A* 2rhi_A* 2rhx_A* 2rjd_A 2rjc_A 2rje_A* 2rjf_A* 3uwn_A* 2pqw_A* 3p8h_A* 2rhu_A* 2rhy_A* 2rhz_A* 2ri3_A* 2ri2_A* 2ri5_A* | Back alignment and structure |
|---|
| >2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A | Back alignment and structure |
|---|
| >1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A | Back alignment and structure |
|---|
| >2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A | Back alignment and structure |
|---|
| >1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A | Back alignment and structure |
|---|
| >2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} | Back alignment and structure |
|---|
| >1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >3ut1_A Lethal(3)malignant brain tumor-like protein 3; chromatin modification, transcription repression, MBT repeat structural genomics; HET: EPE; 2.05A {Homo sapiens} PDB: 4fl6_A* 1wjs_A | Back alignment and structure |
|---|
| >3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A | Back alignment and structure |
|---|
| >2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A | Back alignment and structure |
|---|
| >2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A | Back alignment and structure |
|---|
| >3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A | Back alignment and structure |
|---|
| >1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A | Back alignment and structure |
|---|
| >2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3e9g_A Chromatin modification-related protein EAF3; chromatin remodeling, chromo domain, transcription factor, transcription regulation; 2.50A {Saccharomyces cerevisiae} PDB: 2k3x_A 3e9f_A* | Back alignment and structure |
|---|
| >2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A | Back alignment and structure |
|---|
| >1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A | Back alignment and structure |
|---|
| >2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} | Back alignment and structure |
|---|
| >1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A | Back alignment and structure |
|---|
| >1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A | Back alignment and structure |
|---|
| >1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A | Back alignment and structure |
|---|
| >3feo_A MBT domain-containing protein 1; MBTL1, structural genomics, structural genomics consortium, metal-binding, nucleus, zinc-finger; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A | Back alignment and structure |
|---|
| >2gfu_A DNA mismatch repair protein MSH6; PWWP domain, tudor domain, DNA binding, DNA binding protein; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A | Back alignment and structure |
|---|
| >2daq_A WHSC1L1 protein, isoform long; PWWP domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.34.9.2 | Back alignment and structure |
|---|
| >2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A | Back alignment and structure |
|---|
| >2hqx_A P100 CO-activator tudor domain; human P100 tudor domain, proteolytic fragment, PSI, structural genomics; 1.42A {Homo sapiens} SCOP: b.34.9.1 PDB: 2hqe_A 3omc_A* 3omg_A* 2o4x_A 2e6n_A 2o4x_B | Back alignment and structure |
|---|
| >4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A | Back alignment and structure |
|---|
| >2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A | Back alignment and structure |
|---|
| >2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* | Back alignment and structure |
|---|
| >2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A | Back alignment and structure |
|---|
| >2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D | Back alignment and structure |
|---|
| >3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A | Back alignment and structure |
|---|
| >2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A | Back alignment and structure |
|---|
| >2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A | Back alignment and structure |
|---|
| >2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} | Back alignment and structure |
|---|
| >1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... | Back alignment and structure |
|---|
| >1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} | Back alignment and structure |
|---|
| >1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A | Back alignment and structure |
|---|
| >2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A | Back alignment and structure |
|---|
| >2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A | Back alignment and structure |
|---|
| >1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* | Back alignment and structure |
|---|
| >2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4fu6_A PC4 and SFRS1-interacting protein; structural genomics consortium, SGC, transcription; 2.10A {Homo sapiens} PDB: 2b8a_A 2nlu_A | Back alignment and structure |
|---|
| >2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A | Back alignment and structure |
|---|
| >2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A | Back alignment and structure |
|---|
| >1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A | Back alignment and structure |
|---|
| >2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >3feo_A MBT domain-containing protein 1; MBTL1, structural genomics, structural genomics consortium, metal-binding, nucleus, zinc-finger; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A | Back alignment and structure |
|---|
| >1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1ri0_A Hepatoma-derived growth factor; HDGF, HATH domain, PWWP domain, heparin-binding, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.9.2 PDB: 2b8a_A 2nlu_A | Back alignment and structure |
|---|
| >4b9w_A TDRD1, tudor domain-containing protein 1; replication; HET: 2MR; 2.10A {Mus musculus} | Back alignment and structure |
|---|
| >1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >3h6z_A Polycomb protein SFMBT; MBT, MBR repeat, aromatic CAGE, chromatin regulator, DNA-BIN metal-binding, nucleus, repressor, transcription; HET: MLZ SUC; 2.80A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A | Back alignment and structure |
|---|
| >2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A | Back alignment and structure |
|---|
| >2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A | Back alignment and structure |
|---|
| >1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A | Back alignment and structure |
|---|
| >4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} | Back alignment and structure |
|---|
| >1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} | Back alignment and structure |
|---|
| >2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A | Back alignment and structure |
|---|
| >2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A | Back alignment and structure |
|---|
| >2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A | Back alignment and structure |
|---|
| >1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3f70_A Lethal(3)malignant brain tumor-like 2 protein; MBT, chromatin regulator, metal-binding, nucleus, transcript transcription regulation, zinc-finger; HET: MLZ; 2.10A {Homo sapiens} PDB: 3dbb_A* 3cey_A | Back alignment and structure |
|---|
| >1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A | Back alignment and structure |
|---|
| >2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A | Back alignment and structure |
|---|
| >4b9x_A TDRD1, tudor domain-containing protein 1; replication; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3f70_A Lethal(3)malignant brain tumor-like 2 protein; MBT, chromatin regulator, metal-binding, nucleus, transcript transcription regulation, zinc-finger; HET: MLZ; 2.10A {Homo sapiens} PDB: 3dbb_A* 3cey_A | Back alignment and structure |
|---|
| >2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A | Back alignment and structure |
|---|
| >1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A | Back alignment and structure |
|---|
| >2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... | Back alignment and structure |
|---|
| >3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A | Back alignment and structure |
|---|
| >1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l89_A PWWP domain-containing protein 1; histone binding, protein binding; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A | Back alignment and structure |
|---|
| >1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A | Back alignment and structure |
|---|
| >3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A | Back alignment and structure |
|---|
| >1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3pfs_A Bromodomain and PHD finger-containing protein 3; structural genomics, structural genomics consortium, SGC, PW domain, protein binding; 1.90A {Homo sapiens} PDB: 3lyi_A* | Back alignment and structure |
|---|
| >2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A | Back alignment and structure |
|---|
| >2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B | Back alignment and structure |
|---|
| >2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1khc_A DNA cytosine-5 methyltransferase 3B2; five beta-sheets barrel followed by five-helix bundle; HET: DNA; 1.80A {Mus musculus} SCOP: b.34.9.2 PDB: 3flg_A* 3qkj_A* | Back alignment and structure |
|---|
| >1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A | Back alignment and structure |
|---|
| >3h6z_A Polycomb protein SFMBT; MBT, MBR repeat, aromatic CAGE, chromatin regulator, DNA-BIN metal-binding, nucleus, repressor, transcription; HET: MLZ SUC; 2.80A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A | Back alignment and structure |
|---|
| >2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} | Back alignment and structure |
|---|
| >3llr_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase, methylysine binding, STR genomics consortium, SGC, alternative promoter usage; HET: DNA BTB; 2.30A {Homo sapiens} SCOP: b.34.9.0 | Back alignment and structure |
|---|
| >1ri9_A FYN-binding protein; SH3-like, helically extended, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A | Back alignment and structure |
|---|
| >3qby_A Hepatoma-derived growth factor-related protein 2; HDGF2, structural genomics consortium, SGC, protein binding; HET: M3L; 1.95A {Homo sapiens} SCOP: b.34.9.2 PDB: 3qj6_A* 3eae_A 1n27_A | Back alignment and structure |
|---|
| >1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B | Back alignment and structure |
|---|
| >1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 191 | |||
| d2f5ka1 | 83 | Mortality factor 4-like protein 1, MRG15 {Human (H | 97.72 | |
| d1wjqa_ | 107 | Lethal(3)malignant brain tumor-like 3 protein, L3M | 97.49 | |
| d1oz2a3 | 106 | Lethal(3)malignant brain tumor-like protein {Human | 97.46 | |
| d1mhna_ | 59 | Survival motor neuron protein 1, smn {Human (Homo | 97.28 | |
| d1wgsa_ | 133 | Probable histone acetyltransferase MYST1 {Mouse (M | 97.16 | |
| d1oi1a2 | 104 | Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} | 97.15 | |
| d1oi1a1 | 103 | Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} | 97.09 | |
| d1oz2a2 | 108 | Lethal(3)malignant brain tumor-like protein {Human | 96.88 | |
| d1oz2a1 | 110 | Lethal(3)malignant brain tumor-like protein {Human | 96.81 | |
| d2buda1 | 88 | Putative histone acetyltransferase MOF {Fruit fly | 96.79 | |
| d2d9ta1 | 60 | Tudor domain-containing protein 3, TDRD3 {Mouse (M | 96.19 | |
| d1ue9a_ | 80 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 95.9 | |
| d2hqxa1 | 90 | P100 co-activator, SND1 {Human (Homo sapiens) [Tax | 95.25 | |
| d1wjsa_ | 127 | Lethal(3)malignant brain tumor-like 3 protein, L3M | 95.13 | |
| d2nlua1 | 100 | Hepatoma-derived growth factor, HDGF {Human (Homo | 95.11 | |
| d1gcqc_ | 69 | Vav N-terminal SH3 domain {Mouse (Mus musculus) [T | 94.95 | |
| d1ycsb2 | 63 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 94.95 | |
| d1wjra_ | 127 | Scm-like with four MBT domains protein 2, SFMBT2 ( | 94.68 | |
| d1uj0a_ | 58 | Signal transducing adaptor molecule Stam2 {Mouse ( | 94.65 | |
| d1wlpb1 | 53 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 94.54 | |
| d2diqa1 | 97 | Tudor and KH domain-containing protein TDRKH {Huma | 94.52 | |
| d1sema_ | 58 | Growth factor receptor-bound protein 2 (GRB2), N- | 94.48 | |
| d1udla_ | 98 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 94.35 | |
| d1kjwa1 | 96 | Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | 94.29 | |
| d1phta_ | 83 | Phosphatidylinositol 3-kinase (p85-alpha subunit, | 94.2 | |
| d1u06a1 | 55 | alpha-Spectrin, SH3 domain {Chicken (Gallus gallus | 94.2 | |
| d1t0ha_ | 96 | SH3-like domain of the L-type calcium channel {Rab | 94.05 | |
| d1uhca_ | 79 | Hypothetical protein Baa76854.1 (KIAA1010) {Human | 93.99 | |
| d1vyva1 | 145 | SH3-like domain of the L-type calcium channel {Rat | 93.91 | |
| d1ug1a_ | 92 | Hypothetical protein Baa76854.1 (KIAA1010) {Human | 93.9 | |
| d1wfwa_ | 74 | Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} | 93.65 | |
| d1utia_ | 57 | Grb2-related adaptor protein 2 (Mona/Gads) {Mouse | 93.62 | |
| d1u5sa1 | 71 | Nck-2 {Human (Homo sapiens) [TaxId: 9606]} | 93.43 | |
| d1oota_ | 58 | Hypothetical protein YFR024c {Baker's yeast (Sacch | 93.32 | |
| d1ng2a2 | 118 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 93.31 | |
| d1ng2a1 | 58 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 93.26 | |
| d1wiea_ | 96 | RIM binding protein 2, RIMBP2 {Human (Homo sapiens | 93.19 | |
| d1jo8a_ | 58 | Actin binding protein ABP1 {Baker's yeast (Sacchar | 93.15 | |
| d1k4us_ | 62 | p67phox {Human (Homo sapiens) [TaxId: 9606]} | 93.12 | |
| d1gl5a_ | 67 | tyrosine kinase tec {Mouse (Mus musculus) [TaxId: | 92.89 | |
| d1ujya_ | 76 | Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 | 92.87 | |
| d1j3ta_ | 74 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 92.72 | |
| d1uffa_ | 93 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 92.71 | |
| d2v1ra1 | 67 | Peroxisomal membrane protein Pex13p {Baker's yeast | 92.58 | |
| d1bb9a_ | 83 | Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 | 92.39 | |
| d2rn8a1 | 53 | Bruton's tyrosine kinase {Mus musculus [TaxId: 100 | 92.37 | |
| d1gcqa_ | 56 | Growth factor receptor-bound protein 2 (GRB2), N- | 92.35 | |
| d1ckaa_ | 57 | C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) | 92.25 | |
| d1i1ja_ | 106 | Melanoma inhibitory activity protein {Human (Homo | 92.14 | |
| d1efna_ | 57 | Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu | 92.07 | |
| d2hspa_ | 71 | Phospholipase C, SH3 domain {Human (Homo sapiens) | 91.96 | |
| d1h3za_ | 108 | Hypothetical protein SPBC215.07c {Fission yeast (S | 91.92 | |
| d2daqa1 | 97 | Histone-lysine N-methyltransferase NSD3 {Human (Ho | 91.76 | |
| d1khca_ | 137 | DNA methyltransferase DNMT3B {Mouse (Mus musculus) | 91.58 | |
| d1fmka1 | 64 | c-src protein tyrosine kinase {Human (Homo sapiens | 91.21 | |
| d1opka1 | 57 | Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul | 90.98 | |
| d1k9aa1 | 71 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 89.38 | |
| d1arka_ | 60 | SH3 domain from nebulin {Human (Homo sapiens) [Tax | 89.18 | |
| d2cpqa1 | 78 | Fragile X mental retardation syndrome related prot | 89.17 | |
| d1spka_ | 72 | BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 | 89.02 | |
| d1ugva_ | 72 | Olygophrenin-1 like protein (KIAA0621) {Human (Hom | 88.78 | |
| d1uhfa_ | 69 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 88.53 | |
| d1vyua1 | 136 | SH3-like domain of the L-type calcium channel {Rat | 87.52 | |
| d1awwa_ | 67 | Bruton's tyrosine kinase {Human (Homo sapiens) [Ta | 87.51 | |
| d1qcfa1 | 65 | Hemapoetic cell kinase Hck {Human (Homo sapiens) [ | 86.44 | |
| d1i07a_ | 59 | EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 | 85.9 | |
| d1gria1 | 56 | Growth factor receptor-bound protein 2 (GRB2), N- | 85.9 | |
| d1j4wa1 | 74 | Far upstream binding element, FBP {Human (Homo sap | 83.84 | |
| d2iima1 | 62 | p56-lck tyrosine kinase, SH3 domain {Human (Homo s | 83.36 | |
| d1we8a_ | 104 | Tudor and KH domain containing protein, Tdrkh {Mou | 82.96 |
| >d2f5ka1 b.34.13.3 (A:6-88) Mortality factor 4-like protein 1, MRG15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: SH3-like barrel superfamily: Chromo domain-like family: Chromo barrel domain domain: Mortality factor 4-like protein 1, MRG15 species: Human (Homo sapiens) [TaxId: 9606]
Probab=97.72 E-value=3.6e-05 Score=54.52 Aligned_cols=56 Identities=18% Similarity=0.252 Sum_probs=48.9
Q ss_pred CCCccCCCeEEEEeecCCCCccceeeEEEEEEe---cc-EEEEEEeccCCcceeeecCCCcccCCC
Q psy985 37 NSGFVENQEVEVFSKATEGESCGWWKVIVKMIK---GD-FHVVEYLGCQSTFTEIVPPERMRQKNT 98 (191)
Q Consensus 37 ~~~~~egdeVEV~sran~~ep~gWW~a~V~~iK---Gd-f~vVey~~~d~~~teIV~~erLR~~n~ 98 (191)
...|.+|+.|-+|. ...+|.|+|..++ |+ .|.|-|.||++.+.|.|+.+||+..|+
T Consensus 3 ~~~f~~ge~Vlc~~------~~~lYeAkil~~~~~~~~~~Y~VHy~GWn~~~DeWv~~~ril~~~~ 62 (83)
T d2f5ka1 3 KPKFQEGERVLCFH------GPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVD 62 (83)
T ss_dssp SCSCCTTCEEEEES------SSSEEEEEEEEEEEETTEEEEEEEETTSCGGGCEEEEGGGEEESSH
T ss_pred CCccCCCCEEEEEE------CCeeEEeEEEEEEEcCCceEEEEEecccCCccccccChhhcccCCH
Confidence 46789999999985 4589999999885 44 899999999999999999999998874
|
| >d1wjqa_ b.34.9.3 (A:) Lethal(3)malignant brain tumor-like 3 protein, L3MBTL3 (KIAA1798) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oz2a3 b.34.9.3 (A:422-527) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mhna_ b.34.9.1 (A:) Survival motor neuron protein 1, smn {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgsa_ b.34.13.3 (A:) Probable histone acetyltransferase MYST1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1oi1a2 b.34.9.3 (A:140-243) Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oi1a1 b.34.9.3 (A:33-135) Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oz2a2 b.34.9.3 (A:314-421) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oz2a1 b.34.9.3 (A:204-313) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2buda1 b.34.13.3 (A:367-454) Putative histone acetyltransferase MOF {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2d9ta1 b.34.9.1 (A:8-67) Tudor domain-containing protein 3, TDRD3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hqxa1 b.34.9.1 (A:8-97) P100 co-activator, SND1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjsa_ b.34.9.3 (A:) Lethal(3)malignant brain tumor-like 3 protein, L3MBTL3 (KIAA1798) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nlua1 b.34.9.2 (A:1-100) Hepatoma-derived growth factor, HDGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjra_ b.34.9.3 (A:) Scm-like with four MBT domains protein 2, SFMBT2 (KIAA1617) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2diqa1 b.34.9.1 (A:8-104) Tudor and KH domain-containing protein TDRKH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h3za_ b.34.9.2 (A:) Hypothetical protein SPBC215.07c {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2daqa1 b.34.9.2 (A:8-104) Histone-lysine N-methyltransferase NSD3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1khca_ b.34.9.2 (A:) DNA methyltransferase DNMT3B {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|