Psyllid ID: psy9943

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-----
MSQELLPRGRNRNPLWEKFFAVNKLLKDSLSDRLSDRSRLEFISHDISDLVSDDRISAGDFFDFLRLTESGSRKVFGPIHDIIEKAKKKKKEKKKKKKKKRKKKKKRKKKKKKKKKKKKKKKKKKKNKNKIIKIN
cccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc
cccccccccccccHHHHHHHHHHHHHHHHcHHHHcccccEEEEEEccccEccccccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEc
msqellprgrnrnplWEKFFAVNKLLKDSlsdrlsdrsrleFISHDisdlvsddrisagdffdflrltesgsrkvfgpIHDIIEKAKKKKKEKKKKKKKKRKKKKKRKKKKKKKKKKKKKKKKKKKNKNKIIKIN
msqellprgrnrnplweKFFAVNKLLKDSLSDRLSDRSRLEFIshdisdlvsddriSAGDFFDFLRLtesgsrkvfgpihDIIEkakkkkkekkkkkkkkrkkkkkrkkkkkkkkkkkkkkkkkkknknkiikin
MSQELLPRGRNRNPLWEKFFAVNkllkdslsdrlsdrsrlEFISHDISDLVSDDRISAGDFFDFLRLTESGSRKVFGPIHDIIekakkkkkekkkkkkkkrkkkkkrkkkkkkkkkkkkkkkkkkknknkiikIN
*************PLWEKFFAVNKLLKDSL********RLEFISHDISDLVSDDRISAGDFFDFLRLTESGSRKVFGPIHDI*****************************************************
MSQELLPRGRNRNPLWEKFFAVNKLLKDSLSDRLSDRSRLEFISHDISDLVSDDRISAGDFFDFLRLTESGSRKVFGPIHDIIE***********************************************IKI*
MSQELLPRGRNRNPLWEKFFAVNKLLKDSLSDRLSDRSRLEFISHDISDLVSDDRISAGDFFDFLRLTESGSRKVFGPIHDIIEK**************************************************
*****L*RGRNRNPLWEKFFAVNKLLKDSLSDRLSDRSRLEFISHDISDLVSDDRISAGDFFDFLRLTESGSRKVFGPIHDIIEKAKKKKKEKKKKKKKKRKKKKKRKKKKKKKKKKKKKKKKKKKNKNKIIKIN
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQELLPRGRNRNPLWEKFFAVNKLLKDSLSDRLSDRSRLEFISHDISDLVSDDRISAGDFFDFLRLTESGSRKVFGPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIIKIN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query135 2.2.26 [Sep-21-2011]
O35264229 Platelet-activating facto no N/A 0.659 0.388 0.397 9e-09
Q61206229 Platelet-activating facto yes N/A 0.659 0.388 0.397 9e-09
Q5R4G2229 Platelet-activating facto yes N/A 0.659 0.388 0.387 1e-08
P68402229 Platelet-activating facto yes N/A 0.659 0.388 0.387 1e-08
P68401229 Platelet-activating facto yes N/A 0.659 0.388 0.387 1e-08
Q5ZMS2229 Platelet-activating facto yes N/A 0.659 0.388 0.387 2e-07
>sp|O35264|PA1B2_RAT Platelet-activating factor acetylhydrolase IB subunit beta OS=Rattus norvegicus GN=Pafah1b2 PE=1 SV=1 Back     alignment and function desciption
 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 37/93 (39%), Positives = 53/93 (56%), Gaps = 4/93 (4%)

Query: 5   LLPRGRNRNPLWEKFFAVNKLLKDSLSDRLSDRSRLEFISHDISDLVSDDRISAGDFFDF 64
           LLPRG   NPL +K   VN+LLK SL  +L++   L+    D   + SD  IS  D FDF
Sbjct: 139 LLPRGEKPNPLRQKNAKVNQLLKVSLP-KLANVQLLDI---DGGFVHSDGAISCHDMFDF 194

Query: 65  LRLTESGSRKVFGPIHDIIEKAKKKKKEKKKKK 97
           L LT  G  K+  P+H++I +  ++  E+K+  
Sbjct: 195 LHLTGGGYAKICKPLHELIMQLLEETPEEKQTT 227
Inactivates PAF by removing the acetyl group at the sn-2 position. This is a catalytic subunit.
Rattus norvegicus (taxid: 10116)
EC: 3EC: .EC: 1EC: .EC: 1EC: .EC: 4EC: 7
>sp|Q61206|PA1B2_MOUSE Platelet-activating factor acetylhydrolase IB subunit beta OS=Mus musculus GN=Pafah1b2 PE=1 SV=2 Back     alignment and function description
>sp|Q5R4G2|PA1B2_PONAB Platelet-activating factor acetylhydrolase IB subunit beta OS=Pongo abelii GN=PAFAH1B2 PE=2 SV=1 Back     alignment and function description
>sp|P68402|PA1B2_HUMAN Platelet-activating factor acetylhydrolase IB subunit beta OS=Homo sapiens GN=PAFAH1B2 PE=1 SV=1 Back     alignment and function description
>sp|P68401|PA1B2_BOVIN Platelet-activating factor acetylhydrolase IB subunit beta OS=Bos taurus GN=PAFAH1B2 PE=1 SV=1 Back     alignment and function description
>sp|Q5ZMS2|PA1B2_CHICK Platelet-activating factor acetylhydrolase IB subunit beta OS=Gallus gallus GN=PAFAH1B2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query135
395848576202 PREDICTED: platelet-activating factor ac 0.688 0.460 0.402 4e-08
170051824225 platelet-activating factor acetylhydrola 0.570 0.342 0.419 8e-08
224083121 242 PREDICTED: platelet-activating factor ac 0.659 0.367 0.408 3e-07
354499863133 PREDICTED: platelet-activating factor ac 0.659 0.669 0.376 4e-07
345310485229 PREDICTED: platelet-activating factor ac 0.659 0.388 0.376 5e-07
345799902229 PREDICTED: platelet-activating factor ac 0.659 0.388 0.387 5e-07
184185464229 platelet-activating factor acetylhydrola 0.651 0.384 0.391 6e-07
90081086177 unnamed protein product [Macaca fascicul 0.659 0.502 0.376 6e-07
290561659227 Platelet-activating factor acetylhydrola 0.540 0.321 0.402 6e-07
348573877228 PREDICTED: platelet-activating factor ac 0.659 0.390 0.376 6e-07
>gi|395848576|ref|XP_003796926.1| PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta, partial [Otolemur garnettii] Back     alignment and taxonomy information
 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 56/97 (57%), Gaps = 4/97 (4%)

Query: 1   MSQELLPRGRNRNPLWEKFFAVNKLLKDSLSDRLSDRSRLEFISHDISDLVSDDRISAGD 60
           +SQ LLPRG   NPL +K   VN+LLK SL  +L++   L+    D   + SD  IS  D
Sbjct: 108 LSQGLLPRGEKPNPLRQKNAKVNQLLKVSLP-KLTNVQLLDI---DGGFVHSDGAISCHD 163

Query: 61  FFDFLRLTESGSRKVFGPIHDIIEKAKKKKKEKKKKK 97
            FDFL LT  G  K+  P+H++I +  ++  E+K+  
Sbjct: 164 MFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTT 200

Source: Otolemur garnettii

Species: Otolemur garnettii

Genus: Otolemur

Family: Galagidae

Order: Primates

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota
>gi|170051824|ref|XP_001861941.1| platelet-activating factor acetylhydrolase IB subunit beta [Culex quinquefasciatus] gi|167872897|gb|EDS36280.1| platelet-activating factor acetylhydrolase IB subunit beta [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|224083121|ref|XP_002190232.1| PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta [Taeniopygia guttata] Back     alignment and taxonomy information
>gi|354499863|ref|XP_003512024.1| PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta-like, partial [Cricetulus griseus] Back     alignment and taxonomy information
>gi|345310485|ref|XP_001514293.2| PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta-like [Ornithorhynchus anatinus] Back     alignment and taxonomy information
>gi|345799902|ref|XP_536562.3| PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta [Canis lupus familiaris] Back     alignment and taxonomy information
>gi|184185464|gb|ACC68869.1| platelet-activating factor acetylhydrolase, isoform Ib, beta subunit (predicted) [Rhinolophus ferrumequinum] Back     alignment and taxonomy information
>gi|90081086|dbj|BAE90023.1| unnamed protein product [Macaca fascicularis] Back     alignment and taxonomy information
>gi|290561659|gb|ADD38229.1| Platelet-activating factor acetylhydrolase IB subunit gamma [Lepeophtheirus salmonis] Back     alignment and taxonomy information
>gi|348573877|ref|XP_003472717.1| PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta-like [Cavia porcellus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query135
UNIPROTKB|J3KNE3175 PAFAH1B2 "Platelet-activating 0.555 0.428 0.354 1.2e-05
UNIPROTKB|E2RN02229 PAFAH1B2 "Uncharacterized prot 0.555 0.327 0.354 2.4e-05
UNIPROTKB|P68401229 PAFAH1B2 "Platelet-activating 0.555 0.327 0.354 3.1e-05
UNIPROTKB|P68402229 PAFAH1B2 "Platelet-activating 0.555 0.327 0.354 3.1e-05
UNIPROTKB|F2Z5V4229 PAFAH1B2 "Uncharacterized prot 0.555 0.327 0.354 3.1e-05
MGI|MGI:108415229 Pafah1b2 "platelet-activating 0.555 0.327 0.354 4e-05
RGD|620332229 Pafah1b2 "platelet-activating 0.555 0.327 0.354 4e-05
ZFIN|ZDB-GENE-060526-43228 pafah1b2 "platelet-activating 0.555 0.328 0.341 0.00019
UNIPROTKB|F1N8K4229 PAFAH1B2 "Platelet-activating 0.555 0.327 0.341 0.00019
UNIPROTKB|Q5ZMS2229 PAFAH1B2 "Platelet-activating 0.555 0.327 0.341 0.00019
UNIPROTKB|J3KNE3 PAFAH1B2 "Platelet-activating factor acetylhydrolase IB subunit beta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 102 (41.0 bits), Expect = 1.2e-05, P = 1.2e-05
 Identities = 28/79 (35%), Positives = 36/79 (45%)

Query:     5 LLPRGRNRNPLWEKFFAVNXXXXXXXXXXXXXXXXXEFISHDISDLVSDDRISAGDFFDF 64
             LLPRG   NPL +K   VN                 + +  D   + SD  IS  D FDF
Sbjct:    85 LLPRGEKPNPLRQKNAKVNQLLKVSLPKLANV----QLLDTDGGFVHSDGAISCHDMFDF 140

Query:    65 LRLTESGSRKVFGPIHDII 83
             L LT  G  K+  P+H++I
Sbjct:   141 LHLTGGGYAKICKPLHELI 159
GO:0016787 "hydrolase activity" evidence=IEA
UNIPROTKB|E2RN02 PAFAH1B2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P68401 PAFAH1B2 "Platelet-activating factor acetylhydrolase IB subunit beta" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P68402 PAFAH1B2 "Platelet-activating factor acetylhydrolase IB subunit beta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5V4 PAFAH1B2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:108415 Pafah1b2 "platelet-activating factor acetylhydrolase, isoform 1b, subunit 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620332 Pafah1b2 "platelet-activating factor acetylhydrolase 1b, catalytic subunit 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060526-43 pafah1b2 "platelet-activating factor acetylhydrolase 1b, catalytic subunit 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1N8K4 PAFAH1B2 "Platelet-activating factor acetylhydrolase IB subunit beta" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZMS2 PAFAH1B2 "Platelet-activating factor acetylhydrolase IB subunit beta" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
cd01820214 cd01820, PAF_acetylesterase_like, PAF_acetylhydrol 8e-12
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 2e-09
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 3e-09
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 3e-09
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 6e-09
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 7e-09
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 9e-09
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 1e-08
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 1e-08
PRK11642813 PRK11642, PRK11642, exoribonuclease R; Provisional 3e-07
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 7e-07
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 7e-07
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 1e-06
PRK07561859 PRK07561, PRK07561, DNA topoisomerase I subunit om 2e-06
PRK04195482 PRK04195, PRK04195, replication factor C large sub 4e-06
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 6e-06
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 1e-05
PRK07561859 PRK07561, PRK07561, DNA topoisomerase I subunit om 1e-05
PRK07561859 PRK07561, PRK07561, DNA topoisomerase I subunit om 2e-05
PRK07561859 PRK07561, PRK07561, DNA topoisomerase I subunit om 2e-05
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 3e-05
PRK04950213 PRK04950, PRK04950, ProP expression regulator; Pro 3e-05
PRK07561859 PRK07561, PRK07561, DNA topoisomerase I subunit om 4e-05
pfam13148 379 pfam13148, DUF3987, Protein of unknown function (D 5e-05
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 6e-05
PRK05306 746 PRK05306, infB, translation initiation factor IF-2 8e-05
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 1e-04
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 1e-04
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 1e-04
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 1e-04
PRK11642813 PRK11642, PRK11642, exoribonuclease R; Provisional 2e-04
PRK07561859 PRK07561, PRK07561, DNA topoisomerase I subunit om 2e-04
PRK04950213 PRK04950, PRK04950, ProP expression regulator; Pro 2e-04
PRK04950213 PRK04950, PRK04950, ProP expression regulator; Pro 2e-04
PRK04950213 PRK04950, PRK04950, ProP expression regulator; Pro 2e-04
PRK04950213 PRK04950, PRK04950, ProP expression regulator; Pro 3e-04
PRK06319860 PRK06319, PRK06319, DNA topoisomerase I/SWI domain 3e-04
PRK11642813 PRK11642, PRK11642, exoribonuclease R; Provisional 4e-04
PRK11642813 PRK11642, PRK11642, exoribonuclease R; Provisional 4e-04
pfam08496154 pfam08496, Peptidase_S49_N, Peptidase family S49 N 4e-04
PRK11642813 PRK11642, PRK11642, exoribonuclease R; Provisional 5e-04
PRK04195482 PRK04195, PRK04195, replication factor C large sub 7e-04
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 7e-04
pfam14181155 pfam14181, YqfQ, YqfQ-like protein 7e-04
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 8e-04
PRK11778 330 PRK11778, PRK11778, putative inner membrane peptid 8e-04
pfam14181155 pfam14181, YqfQ, YqfQ-like protein 9e-04
PRK04950213 PRK04950, PRK04950, ProP expression regulator; Pro 0.001
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 0.001
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 0.001
PRK06319860 PRK06319, PRK06319, DNA topoisomerase I/SWI domain 0.001
PRK06319860 PRK06319, PRK06319, DNA topoisomerase I/SWI domain 0.001
pfam08496154 pfam08496, Peptidase_S49_N, Peptidase family S49 N 0.001
PRK11778 330 PRK11778, PRK11778, putative inner membrane peptid 0.001
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 0.002
PRK06319860 PRK06319, PRK06319, DNA topoisomerase I/SWI domain 0.002
pfam08496154 pfam08496, Peptidase_S49_N, Peptidase family S49 N 0.002
pfam08496154 pfam08496, Peptidase_S49_N, Peptidase family S49 N 0.002
PRK11778 330 PRK11778, PRK11778, putative inner membrane peptid 0.002
PTZ00108 1388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 0.002
PRK06319860 PRK06319, PRK06319, DNA topoisomerase I/SWI domain 0.003
PRK06319860 PRK06319, PRK06319, DNA topoisomerase I/SWI domain 0.003
PTZ00108 1388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 0.003
COG1498395 COG1498, SIK1, Protein implicated in ribosomal bio 0.003
pfam06217 301 pfam06217, GAGA_bind, GAGA binding protein-like fa 0.003
PRK06319860 PRK06319, PRK06319, DNA topoisomerase I/SWI domain 0.004
pfam14181155 pfam14181, YqfQ, YqfQ-like protein 0.004
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 0.004
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 0.004
PTZ00372 413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 0.004
PRK05563 559 PRK05563, PRK05563, DNA polymerase III subunits ga 0.004
COG1754298 COG1754, COG1754, Uncharacterized C-terminal domai 0.004
>gnl|CDD|238858 cd01820, PAF_acetylesterase_like, PAF_acetylhydrolase (PAF-AH)_like subfamily of SGNH-hydrolases Back     alignment and domain information 
 Score = 59.6 bits (145), Expect = 8e-12
 Identities = 31/84 (36%), Positives = 41/84 (48%), Gaps = 8/84 (9%)

Query: 5   LLPRGRNRNPLWEKFFAVNKLLKDSLSDRLSDRSRLEFISHDISDLV--SDDRISAGDFF 62
           LLPRG+N NPL E+   VN+LL      R      + F+  DI      SD  IS  D  
Sbjct: 136 LLPRGQNPNPLRERNAQVNRLLAV----RYDGLPNVTFL--DIDKGFVQSDGTISHHDMP 189

Query: 63  DFLRLTESGSRKVFGPIHDIIEKA 86
           D+L LT +G RK    +H  + + 
Sbjct: 190 DYLHLTAAGYRKWADALHPTLARL 213

Platelet-activating factor (PAF) and PAF-AH are key players in inflammation and in atherosclerosis. PAF-AH is a calcium independent phospholipase A2 which exhibits strong substrate specificity towards PAF, hydrolyzing an acetyl ester at the sn-2 position. PAF-AH also degrades a family of oxidized PAF-like phospholipids with short sn-2 residues. In addition, PAF and PAF-AH are associated with neural migration and mammalian reproduction. Length = 214
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated Back     alignment and domain information
>gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated Back     alignment and domain information
>gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional Back     alignment and domain information
>gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated Back     alignment and domain information
>gnl|CDD|221937 pfam13148, DUF3987, Protein of unknown function (DUF3987) Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional Back     alignment and domain information
>gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated Back     alignment and domain information
>gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional Back     alignment and domain information
>gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional Back     alignment and domain information
>gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional Back     alignment and domain information
>gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional Back     alignment and domain information
>gnl|CDD|235778 PRK06319, PRK06319, DNA topoisomerase I/SWI domain fusion protein; Validated Back     alignment and domain information
>gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional Back     alignment and domain information
>gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional Back     alignment and domain information
>gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal Back     alignment and domain information
>gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|236978 PRK11778, PRK11778, putative inner membrane peptidase; Provisional Back     alignment and domain information
>gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein Back     alignment and domain information
>gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|235778 PRK06319, PRK06319, DNA topoisomerase I/SWI domain fusion protein; Validated Back     alignment and domain information
>gnl|CDD|235778 PRK06319, PRK06319, DNA topoisomerase I/SWI domain fusion protein; Validated Back     alignment and domain information
>gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal Back     alignment and domain information
>gnl|CDD|236978 PRK11778, PRK11778, putative inner membrane peptidase; Provisional Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|235778 PRK06319, PRK06319, DNA topoisomerase I/SWI domain fusion protein; Validated Back     alignment and domain information
>gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal Back     alignment and domain information
>gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal Back     alignment and domain information
>gnl|CDD|236978 PRK11778, PRK11778, putative inner membrane peptidase; Provisional Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|235778 PRK06319, PRK06319, DNA topoisomerase I/SWI domain fusion protein; Validated Back     alignment and domain information
>gnl|CDD|235778 PRK06319, PRK06319, DNA topoisomerase I/SWI domain fusion protein; Validated Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|224415 COG1498, SIK1, Protein implicated in ribosomal biogenesis, Nop56p homolog [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|218941 pfam06217, GAGA_bind, GAGA binding protein-like family Back     alignment and domain information
>gnl|CDD|235778 PRK06319, PRK06319, DNA topoisomerase I/SWI domain fusion protein; Validated Back     alignment and domain information
>gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|235505 PRK05563, PRK05563, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|224668 COG1754, COG1754, Uncharacterized C-terminal domain of topoisomerase IA [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 135
cd01820214 PAF_acetylesterase_like PAF_acetylhydrolase (PAF-A 99.66
cd01841174 NnaC_like NnaC (CMP-NeuNAc synthetase) _like subfa 99.52
cd01828169 sialate_O-acetylesterase_like2 sialate_O-acetylest 99.42
cd04502171 SGNH_hydrolase_like_7 Members of the SGNH-hydrolas 99.36
KOG1388|consensus217 99.25
cd01838199 Isoamyl_acetate_hydrolase_like Isoamyl-acetate hyd 99.22
cd01836191 FeeA_FeeB_like SGNH_hydrolase subfamily, FeeA, Fee 99.21
cd04501183 SGNH_hydrolase_like_4 Members of the SGNH-hydrolas 99.21
cd01835193 SGNH_hydrolase_like_3 SGNH_hydrolase subfamily. SG 99.13
cd01844177 SGNH_hydrolase_like_6 SGNH_hydrolase subfamily. SG 99.1
cd01829200 SGNH_hydrolase_peri2 SGNH_peri2; putative periplas 99.09
cd01827188 sialate_O-acetylesterase_like1 sialate O-acetylest 99.07
cd01833157 XynB_like SGNH_hydrolase subfamily, similar to Rum 99.07
cd01832185 SGNH_hydrolase_like_1 Members of the SGNH-hydrolas 99.06
cd01834191 SGNH_hydrolase_like_2 SGNH_hydrolase subfamily. SG 99.06
PF13472179 Lipase_GDSL_2: GDSL-like Lipase/Acylhydrolase fami 99.04
cd01825189 SGNH_hydrolase_peri1 SGNH_peri1; putative periplas 98.96
cd01839208 SGNH_arylesterase_like SGNH_hydrolase subfamily, s 98.94
cd04506204 SGNH_hydrolase_YpmR_like Members of the SGNH-hydro 98.92
cd01821198 Rhamnogalacturan_acetylesterase_like Rhamnogalactu 98.8
cd01840150 SGNH_hydrolase_yrhL_like yrhL-like subfamily of SG 98.8
cd00229187 SGNH_hydrolase SGNH_hydrolase, or GDSL_hydrolase, 98.79
cd01830204 XynE_like SGNH_hydrolase subfamily, similar to the 98.78
cd01822177 Lysophospholipase_L1_like Lysophospholipase L1-lik 98.78
PRK10528191 multifunctional acyl-CoA thioesterase I and protea 98.77
cd01823259 SEST_like SEST_like. A family of secreted SGNH-hyd 98.73
COG2755216 TesA Lysophospholipase L1 and related esterases [A 98.7
cd01831169 Endoglucanase_E_like Endoglucanase E-like members 98.68
PF00657234 Lipase_GDSL: GDSL-like Lipase/Acylhydrolase; Inter 98.14
PF14606178 Lipase_GDSL_3: GDSL-like Lipase/Acylhydrolase fami 98.03
KOG3035|consensus245 97.86
cd01824288 Phospholipase_B_like Phospholipase-B_like. This su 97.56
cd01847281 Triacylglycerol_lipase_like Triacylglycerol lipase 97.47
cd01846270 fatty_acyltransferase_like Fatty acyltransferase-l 97.44
PRK15381408 pathogenicity island 2 effector protein SseJ; Prov 97.4
COG2845354 Uncharacterized protein conserved in bacteria [Fun 97.25
cd01837315 SGNH_plant_lipase_like SGNH_plant_lipase_like, a p 97.18
PLN03156351 GDSL esterase/lipase; Provisional 96.97
cd01826305 acyloxyacyl_hydrolase_like Acyloxyacyl-hydrolase l 96.31
cd01842183 SGNH_hydrolase_like_5 SGNH_hydrolase subfamily. SG 94.93
PF13839263 PC-Esterase: GDSL/SGNH-like Acyl-Esterase family f 94.64
PF04914130 DltD_C: DltD C-terminal region; InterPro: IPR00699 93.61
PF04311327 DUF459: Protein of unknown function (DUF459); Inte 92.54
PF07611345 DUF1574: Protein of unknown function (DUF1574); In 91.48
COG3240370 Phospholipase/lecithinase/hemolysin [Lipid metabol 87.45
>cd01820 PAF_acetylesterase_like PAF_acetylhydrolase (PAF-AH)_like subfamily of SGNH-hydrolases Back     alignment and domain information 
Probab=99.66  E-value=1.5e-16  Score=123.38  Aligned_cols=83  Identities=35%  Similarity=0.480  Sum_probs=75.2

Q ss_pred             CcccccCCCCCCChhHHHHHHHHHHHHHHhhhhhcCCCCeEEEeCCCCCcCCCCccCCCCCCCcCCCChhhhhhhhhhHH
Q psy9943           1 MSQELLPRGRNRNPLWEKFFAVNKLLKDSLSDRLSDRSRLEFISHDISDLVSDDRISAGDFFDFLRLTESGSRKVFGPIH   80 (135)
Q Consensus         1 ~LlslLPrg~~pn~~r~~i~~iN~~L~~~~~~~ls~~~~V~fiDi~~~fl~~dG~Ls~~~m~DgLHLt~~GY~k~a~~l~   80 (135)
                      +|++++|++..+++++..+.++|+.|.+.+.    ...+|.|||+++.|.+.+|.+.++++.||||||++||+.|++.|.
T Consensus       132 il~~~~p~~~~~~~~~~~~~~~n~~l~~~~~----~~~~v~~vd~~~~~~~~~g~~~~~~~~DGlHpn~~Gy~~~a~~l~  207 (214)
T cd01820         132 LLLGLLPRGQNPNPLRERNAQVNRLLAVRYD----GLPNVTFLDIDKGFVQSDGTISHHDMPDYLHLTAAGYRKWADALH  207 (214)
T ss_pred             EEEeccCCCCCchhHHHHHHHHHHHHHHHhc----CCCCEEEEeCchhhcccCCCcCHhhcCCCCCCCHHHHHHHHHHHH
Confidence            4678999988777888999999999987765    467999999999999999999999999999999999999999999


Q ss_pred             HHHHHHH
Q psy9943          81 DIIEKAK   87 (135)
Q Consensus        81 ~~l~qLL   87 (135)
                      +.|.++|
T Consensus       208 ~~l~~~~  214 (214)
T cd01820         208 PTLARLL  214 (214)
T ss_pred             HHHHhhC
Confidence            9998875

Platelet-activating factor (PAF) and PAF-AH are key players in inflammation and in atherosclerosis. PAF-AH is a calcium independent phospholipase A2 which exhibits strong substrate specificity towards PAF, hydrolyzing an acetyl ester at the sn-2 position. PAF-AH also degrades a family of oxidized PAF-like phospholipids with short sn-2 residues. In addition, PAF and PAF-AH are associated with neural migration and mammalian reproduction.
>cd01841 NnaC_like NnaC (CMP-NeuNAc synthetase) _like subfamily of SGNH_hydrolases, a diverse family of lipases and esterases Back     alignment and domain information
>cd01828 sialate_O-acetylesterase_like2 sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases Back     alignment and domain information
>cd04502 SGNH_hydrolase_like_7 Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases Back     alignment and domain information
>KOG1388|consensus Back     alignment and domain information
>cd01838 Isoamyl_acetate_hydrolase_like Isoamyl-acetate hydrolyzing esterase-like proteins Back     alignment and domain information
>cd01836 FeeA_FeeB_like SGNH_hydrolase subfamily, FeeA, FeeB and similar esterases/lipases Back     alignment and domain information
>cd04501 SGNH_hydrolase_like_4 Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases Back     alignment and domain information
>cd01835 SGNH_hydrolase_like_3 SGNH_hydrolase subfamily Back     alignment and domain information
>cd01844 SGNH_hydrolase_like_6 SGNH_hydrolase subfamily Back     alignment and domain information
>cd01829 SGNH_hydrolase_peri2 SGNH_peri2; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases Back     alignment and domain information
>cd01827 sialate_O-acetylesterase_like1 sialate O-acetylesterase_like family of the SGNH hydrolases, a diverse family of lipases and esterases Back     alignment and domain information
>cd01833 XynB_like SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB Back     alignment and domain information
>cd01832 SGNH_hydrolase_like_1 Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases Back     alignment and domain information
>cd01834 SGNH_hydrolase_like_2 SGNH_hydrolase subfamily Back     alignment and domain information
>PF13472 Lipase_GDSL_2: GDSL-like Lipase/Acylhydrolase family; PDB: 1ES9_A 1WAB_A 3DT9_A 1BWQ_A 1FXW_A 3DT6_A 1BWR_A 3DT8_A 1BWP_A 2WAA_A Back     alignment and domain information
>cd01825 SGNH_hydrolase_peri1 SGNH_peri1; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases Back     alignment and domain information
>cd01839 SGNH_arylesterase_like SGNH_hydrolase subfamily, similar to arylesterase (7-aminocephalosporanic acid-deacetylating enzyme) of A Back     alignment and domain information
>cd04506 SGNH_hydrolase_YpmR_like Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases Back     alignment and domain information
>cd01821 Rhamnogalacturan_acetylesterase_like Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases Back     alignment and domain information
>cd01840 SGNH_hydrolase_yrhL_like yrhL-like subfamily of SGNH-hydrolases, a diverse family of lipases and esterases Back     alignment and domain information
>cd00229 SGNH_hydrolase SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases Back     alignment and domain information
>cd01830 XynE_like SGNH_hydrolase subfamily, similar to the putative arylesterase/acylhydrolase from the rumen anaerobe Prevotella bryantii XynE Back     alignment and domain information
>cd01822 Lysophospholipase_L1_like Lysophospholipase L1-like subgroup of SGNH-hydrolases Back     alignment and domain information
>PRK10528 multifunctional acyl-CoA thioesterase I and protease I and lysophospholipase L1; Provisional Back     alignment and domain information
>cd01823 SEST_like SEST_like Back     alignment and domain information
>COG2755 TesA Lysophospholipase L1 and related esterases [Amino acid transport and metabolism] Back     alignment and domain information
>cd01831 Endoglucanase_E_like Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans Back     alignment and domain information
>PF00657 Lipase_GDSL: GDSL-like Lipase/Acylhydrolase; InterPro: IPR001087 A variety of lipolytic enzymes with serine as part of the active site have been identified [] Back     alignment and domain information
>PF14606 Lipase_GDSL_3: GDSL-like Lipase/Acylhydrolase family; PDB: 3SKV_B Back     alignment and domain information
>KOG3035|consensus Back     alignment and domain information
>cd01824 Phospholipase_B_like Phospholipase-B_like Back     alignment and domain information
>cd01847 Triacylglycerol_lipase_like Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases Back     alignment and domain information
>cd01846 fatty_acyltransferase_like Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases Back     alignment and domain information
>PRK15381 pathogenicity island 2 effector protein SseJ; Provisional Back     alignment and domain information
>COG2845 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd01837 SGNH_plant_lipase_like SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases Back     alignment and domain information
>PLN03156 GDSL esterase/lipase; Provisional Back     alignment and domain information
>cd01826 acyloxyacyl_hydrolase_like Acyloxyacyl-hydrolase like subfamily of the SGNH-hydrolase family Back     alignment and domain information
>cd01842 SGNH_hydrolase_like_5 SGNH_hydrolase subfamily Back     alignment and domain information
>PF13839 PC-Esterase: GDSL/SGNH-like Acyl-Esterase family found in Pmr5 and Cas1p Back     alignment and domain information
>PF04914 DltD_C: DltD C-terminal region; InterPro: IPR006998 The dlt operon (dltA to dltD) of Lactobacillus rhamnosus 7469 encodes four proteins responsible for the esterification of lipoteichoic acid (LTA) by D-alanine Back     alignment and domain information
>PF04311 DUF459: Protein of unknown function (DUF459); InterPro: IPR007407 This is a putative periplasmic protein Back     alignment and domain information
>PF07611 DUF1574: Protein of unknown function (DUF1574); InterPro: IPR011468 This is a family of hypothetical proteins found in Leptospira interrogans and other bacteria Back     alignment and domain information
>COG3240 Phospholipase/lecithinase/hemolysin [Lipid metabolism / General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
1fxw_F229 Crystal Structure Of The Recombinant Alpha1ALPHA2 C 1e-05
>pdb|1FXW|F Chain F, Crystal Structure Of The Recombinant Alpha1ALPHA2 Catalytic Heterodimer Of Bovine Brain Platelet-Activating Factor Acetylhydrolase Ib. Length = 229 Back     alignment and structure 
Iteration: 1

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 36/79 (45%), Gaps = 4/79 (5%)
Query: 5   LLPRGRNRNPLWEKFFAVNXXXXXXXXXXXXXXXXXEFISHDISDLVSDDRISAGDFFDF 64
           LLPRG   NPL +K   VN                 + +  D   + SD  IS  D FDF
Sbjct: 139 LLPRGEKPNPLRQKNAKVNQLLKVSLPKLANV----QLLDTDGGFVHSDGAISCHDMFDF 194
Query: 65  LRLTESGSRKVFGPIHDII 83
           L LT  G  K+  P+H++I
Sbjct: 195 LHLTGGGYAKICKPLHELI 213

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
1fxw_F229 Alpha2, platelet-activating factor acetylhydrolase 4e-06
1es9_A232 PAF-AH, platelet-activating factor acetylhydrolase 2e-05
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 3e-04
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 8e-04
1kxf_A 264 Sindbis virus capsid protein; chymotrypsin-like se 4e-04
1kxf_A 264 Sindbis virus capsid protein; chymotrypsin-like se 5e-04
1kxf_A 264 Sindbis virus capsid protein; chymotrypsin-like se 8e-04
>1fxw_F Alpha2, platelet-activating factor acetylhydrolase IB beta subunit; alpha beta hydrolase fold; 2.10A {Bos taurus} SCOP: c.23.10.3 PDB: 1vyh_A Length = 229 Back     alignment and structure
 Score = 43.2 bits (101), Expect = 4e-06
 Identities = 34/95 (35%), Positives = 51/95 (53%), Gaps = 4/95 (4%)

Query: 1   MSQELLPRGRNRNPLWEKFFAVNKLLKDSLSDRLSDRSRLEFISHDISDLVSDDRISAGD 60
           +   LLPRG   NPL +K   VN+LLK      L   + ++ +  D   + SD  IS  D
Sbjct: 135 IVLGLLPRGEKPNPLRQKNAKVNQLLK----VSLPKLANVQLLDTDGGFVHSDGAISCHD 190

Query: 61  FFDFLRLTESGSRKVFGPIHDIIEKAKKKKKEKKK 95
            FDFL LT  G  K+  P+H++I +  ++  E+K+
Sbjct: 191 MFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQ 225
>1es9_A PAF-AH, platelet-activating factor acetylhydrolase IB gamma subunit; alpha/beta hydrolase fold; 1.30A {Bos taurus} SCOP: c.23.10.3 PDB: 1wab_A 1fxw_A 1bwr_A 1bwq_A 1bwp_A 3dt9_A* 3dt6_A* 3dt8_A* Length = 232 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} Length = 963 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} Length = 963 Back     alignment and structure
>1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Length = 264 Back     alignment and structure
>1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Length = 264 Back     alignment and structure
>1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Length = 264 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query135
1fxw_F229 Alpha2, platelet-activating factor acetylhydrolase 99.66
1es9_A232 PAF-AH, platelet-activating factor acetylhydrolase 99.64
4hf7_A209 Putative acylhydrolase; PF13472 family, structural 99.6
3p94_A204 GDSL-like lipase; serine hydrolase, catalytic tria 99.48
2hsj_A214 Putative platelet activating factor; structr genom 99.46
3mil_A240 Isoamyl acetate-hydrolyzing esterase; SGNH-hydrola 99.26
4h08_A200 Putative hydrolase; GDSL-like lipase/acylhydrolase 99.23
1yzf_A195 Lipase/acylhydrolase; structural GENO PSI, protein 99.2
2vpt_A215 Lipolytic enzyme; esterase, hydrolase; 1.40A {Clos 99.17
3dci_A232 Arylesterase; SGNH_hydrolase SUBF structural genom 99.16
3hp4_A185 GDSL-esterase; psychrotrophic, monoethylphosphonat 99.13
2q0q_A216 ARYL esterase; SGNH hydrolase, oligomeric enzyme, 99.11
3dc7_A232 Putative uncharacterized protein LP_3323; NESG LPR 99.08
1vjg_A218 Putative lipase from the G-D-S-L family; structura 99.01
3rjt_A216 Lipolytic protein G-D-S-L family; PSI-biology, mid 98.97
1ivn_A190 Thioesterase I; hydrolase, protease; 1.90A {Escher 98.96
3skv_A385 SSFX3; jelly roll, GDSL/SGNH fold, alpha/beta hydr 98.88
1esc_A306 Esterase; 2.10A {Streptomyces scabiei} SCOP: c.23. 98.87
2wao_A341 Endoglucanase E; plant cell WALL degradation, carb 98.61
3bzw_A274 Putative lipase; protein structure initiative II, 98.58
2o14_A375 Hypothetical protein YXIM; NESG, X-RAY, SR595, str 98.52
1k7c_A233 Rhamnogalacturonan acetylesterase; N-linked glycos 98.48
2waa_A347 Acetyl esterase, xylan esterase, putative, AXE2C; 98.42
2w9x_A366 AXE2A, CJCE2B, putative acetyl xylan esterase; car 97.75
3kvn_X 632 Esterase ESTA; beta barrel, alpha-beta-alpha motif 97.09
1zmb_A290 Acetylxylan esterase related enzyme; alpha-beta pr 95.68
4i8i_A271 Hypothetical protein; 5-stranded beta sheet flanke 92.34
2apj_A260 Putative esterase; AT4G34215, CAR esterase family 89.11
>1fxw_F Alpha2, platelet-activating factor acetylhydrolase IB beta subunit; alpha beta hydrolase fold; 2.10A {Bos taurus} SCOP: c.23.10.3 PDB: 1vyh_A Back     alignment and structure
Probab=99.66  E-value=2.1e-16  Score=120.27  Aligned_cols=89  Identities=38%  Similarity=0.568  Sum_probs=76.4

Q ss_pred             CcccccCCCCCCChhHHHHHHHHHHHHHHhhhhhcCCCCeEEEeCCCCCcCCCCccCCCCCCCcCCCChhhhhhhhhhHH
Q psy9943           1 MSQELLPRGRNRNPLWEKFFAVNKLLKDSLSDRLSDRSRLEFISHDISDLVSDDRISAGDFFDFLRLTESGSRKVFGPIH   80 (135)
Q Consensus         1 ~LlslLPrg~~pn~~r~~i~~iN~~L~~~~~~~ls~~~~V~fiDi~~~fl~~dG~Ls~~~m~DgLHLt~~GY~k~a~~l~   80 (135)
                      +|++++|++..+.+++..+.++|+.|++++.    ...+|.|||+++.|.+.+|.+...++.||+|||++||+.|++.|.
T Consensus       135 il~~~~p~~~~~~~~~~~~~~~n~~l~~~a~----~~~~v~~iD~~~~~~~~~g~~~~~~~~DgvHpn~~G~~~~a~~l~  210 (229)
T 1fxw_F          135 IVLGLLPRGEKPNPLRQKNAKVNQLLKVSLP----KLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLH  210 (229)
T ss_dssp             EEECCCCCSSSCCHHHHHHHHHHHHHHHHSS----SSSSEEEECCCCSCBCTTSCBCTTTBTTSSSBCHHHHHHHHHHHH
T ss_pred             EEEeCCCCCCchhhHHHHHHHHHHHHHHHHh----cCCCeEEEeCHHHhhccCCCcchhhcCCCCCcCHHHHHHHHHHHH
Confidence            4678999988877788899999999998875    368999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhhHHHH
Q psy9943          81 DIIEKAKKKKKEK   93 (135)
Q Consensus        81 ~~l~qLLee~eeK   93 (135)
                      +.|.++++++.++
T Consensus       211 ~~l~~~l~~~p~~  223 (229)
T 1fxw_F          211 ELIMQLLEETPEE  223 (229)
T ss_dssp             HHHHHHC------
T ss_pred             HHHHHHhcCCCCC
Confidence            9999999887553
>1es9_A PAF-AH, platelet-activating factor acetylhydrolase IB gamma subunit; alpha/beta hydrolase fold; 1.30A {Bos taurus} SCOP: c.23.10.3 PDB: 1wab_A 1fxw_A 1bwr_A 1bwq_A 1bwp_A 3dt9_A* 3dt6_A* 3dt8_A* Back     alignment and structure
>4hf7_A Putative acylhydrolase; PF13472 family, structural genomics, joint center for struct genomics, JCSG, protein structure initiative; HET: OSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3p94_A GDSL-like lipase; serine hydrolase, catalytic triad, flavodo structural genomics, joint center for structural genomics; HET: MSE PG4; 1.93A {Parabacteroides distasonis} Back     alignment and structure
>2hsj_A Putative platelet activating factor; structr genomics, structural genomics, PSI-2; HET: MSE; 1.50A {Streptococcus pneumoniae} SCOP: c.23.10.3 Back     alignment and structure
>3mil_A Isoamyl acetate-hydrolyzing esterase; SGNH-hydrolase, hydrolase; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4h08_A Putative hydrolase; GDSL-like lipase/acylhydrolase family protein, structural GE joint center for structural genomics, JCSG; HET: GOL; 1.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1yzf_A Lipase/acylhydrolase; structural GENO PSI, protein structure initiative, midwest center for struc genomics, MCSG; 1.90A {Enterococcus faecalis} SCOP: c.23.10.5 Back     alignment and structure
>2vpt_A Lipolytic enzyme; esterase, hydrolase; 1.40A {Clostridium thermocellum} Back     alignment and structure
>3dci_A Arylesterase; SGNH_hydrolase SUBF structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; HET: MSE; 2.00A {Agrobacterium tumefaciens str} Back     alignment and structure
>3hp4_A GDSL-esterase; psychrotrophic, monoethylphosphonate, hydrolase; HET: MIR; 1.35A {Pseudoalteromonas SP} SCOP: c.23.10.0 Back     alignment and structure
>2q0q_A ARYL esterase; SGNH hydrolase, oligomeric enzyme, acyl transfer, ARYL ester hydrolase; 1.50A {Mycobacterium smegmatis} PDB: 2q0s_A* Back     alignment and structure
>3dc7_A Putative uncharacterized protein LP_3323; NESG LPR109 X-RAY LP_3323, structural genomics, PSI-2, prote structure initiative; 2.12A {Lactobacillus plantarum} SCOP: c.23.10.9 Back     alignment and structure
>1vjg_A Putative lipase from the G-D-S-L family; structural genomics center for structural genomics, JCSG, protein structure INI PSI, hydrolase; 2.01A {Nostoc SP} SCOP: c.23.10.6 PDB: 1z8h_A Back     alignment and structure
>3rjt_A Lipolytic protein G-D-S-L family; PSI-biology, midwest center for structural genomics, MCSG, H; 1.50A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1ivn_A Thioesterase I; hydrolase, protease; 1.90A {Escherichia coli} SCOP: c.23.10.5 PDB: 1u8u_A* 1j00_A* 1jrl_A 1v2g_A* Back     alignment and structure
>3skv_A SSFX3; jelly roll, GDSL/SGNH fold, alpha/beta hydrolase fold, trans; 2.49A {Streptomyces SP} Back     alignment and structure
>1esc_A Esterase; 2.10A {Streptomyces scabiei} SCOP: c.23.10.1 PDB: 1esd_A 1ese_A Back     alignment and structure
>2wao_A Endoglucanase E; plant cell WALL degradation, carbohydrate metabolism, polysaccharide degradation, esterase, hydrolase, cellulases; HET: BGC; 1.80A {Clostridium thermocellum} PDB: 2wab_A* Back     alignment and structure
>3bzw_A Putative lipase; protein structure initiative II, (PSI-II), NYSGXRC, structural genomics; 1.87A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.23.10.9 Back     alignment and structure
>2o14_A Hypothetical protein YXIM; NESG, X-RAY, SR595, structural genomics, PSI-2, protein structure initiative; 2.10A {Bacillus subtilis} SCOP: b.18.1.32 c.23.10.8 Back     alignment and structure
>1k7c_A Rhamnogalacturonan acetylesterase; N-linked glycosylation, SGNH-hydrolase, hydrolase; HET: NAG MAN; 1.12A {Aspergillus aculeatus} SCOP: c.23.10.4 PDB: 1dex_A* 1deo_A* 1pp4_A* 3c1u_A* Back     alignment and structure
>2waa_A Acetyl esterase, xylan esterase, putative, AXE2C; carbohydrate binding, plant cell WALL degradation, hydrolase, cellulases; 1.80A {Cellvibrio japonicus} Back     alignment and structure
>2w9x_A AXE2A, CJCE2B, putative acetyl xylan esterase; carbohydrate esterase family 2, hydrolase; 2.00A {Cellvibrio japonicus} Back     alignment and structure
>3kvn_X Esterase ESTA; beta barrel, alpha-beta-alpha motif, cell membrane, cell out membrane, hydrolase, membrane, transmembrane; HET: C8E; 2.50A {Pseudomonas aeruginosa} Back     alignment and structure
>1zmb_A Acetylxylan esterase related enzyme; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.61A {Clostridium acetobutylicum} SCOP: c.23.10.7 Back     alignment and structure
>4i8i_A Hypothetical protein; 5-stranded beta sheet flanked by 8 helices fold, structural joint center for structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides uniformis} Back     alignment and structure
>2apj_A Putative esterase; AT4G34215, CAR esterase family 6, structural genomics, protein structure initiative, CESG; HET: SEB; 1.60A {Arabidopsis thaliana} SCOP: c.23.10.7 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query135
d1fxwf_212 Platelet-activating factor acetylhydrolase {Cow (B 99.77
d1es9a_212 Platelet-activating factor acetylhydrolase {Cow (B 99.77
d2hsja1211 Uncharacterized protein SP1450 {Streptococcus pneu 99.6
d1vjga_201 Hypothetical protein alr1529 {Nostoc sp. pcc 7120 99.04
d1yzfa1195 Lipase/acylhydrolase {Enterococcus faecalis [TaxId 99.04
d3dc7a1207 Uncharacterized protein Lp3323 {Lactobacillus plan 98.82
d1k7ca_233 Rhamnogalacturonan acetylesterase {Fungus (Aspergi 98.75
d2o14a2208 Hypothetical protein YxiM {Bacillus subtilis [TaxI 98.71
d1esca_302 Esterase {Streptomyces scabies [TaxId: 1930]} 98.65
d1jrla_179 Thioesterase I, TAP {Escherichia coli [TaxId: 562] 98.64
d3bzwa1248 Uncharacterized protein BT2961 {Bacteroides thetai 98.31
d1zmba1282 Acetylxylan esterase related enzyme {Clostridium a 95.56
d2apja1244 Putative acetylxylan esterase At4g34215 {Thale cre 93.27
d1pcfa_66 Transcriptional coactivator PC4 C-terminal domain 86.55
>d1fxwf_ c.23.10.3 (F:) Platelet-activating factor acetylhydrolase {Cow (Bos taurus), alpha2 [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: SGNH hydrolase
family: Acetylhydrolase
domain: Platelet-activating factor acetylhydrolase
species: Cow (Bos taurus), alpha2 [TaxId: 9913]

Probab=99.77  E-value=2.7e-19  Score=135.11  Aligned_cols=83  Identities=40%  Similarity=0.582  Sum_probs=77.3

Q ss_pred             CcccccCCCCCCChhHHHHHHHHHHHHHHhhhhhcCCCCeEEEeCCCCCcCCCCccCCCCCCCcCCCChhhhhhhhhhHH
Q psy9943           1 MSQELLPRGRNRNPLWEKFFAVNKLLKDSLSDRLSDRSRLEFISHDISDLVSDDRISAGDFFDFLRLTESGSRKVFGPIH   80 (135)
Q Consensus         1 ~LlslLPrg~~pn~~r~~i~~iN~~L~~~~~~~ls~~~~V~fiDi~~~fl~~dG~Ls~~~m~DgLHLt~~GY~k~a~~l~   80 (135)
                      ++++++|+.+.+++.+..+.++|+.|++.+.    ..++|.|||+++.|++++|.+.+++|+||||||++||+.||+.|.
T Consensus       130 i~~~~~P~~~~~~~~~~~~~~~n~~l~~~~a----~~~~v~~iD~~~~l~~~~g~~~~~~~~DGlHpn~~Gy~~~a~~i~  205 (212)
T d1fxwf_         130 IVLGLLPRGEKPNPLRQKNAKVNQLLKVSLP----KLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLH  205 (212)
T ss_dssp             EEECCCCCSSSCCHHHHHHHHHHHHHHHHSS----SSSSEEEECCCCSCBCTTSCBCTTTBTTSSSBCHHHHHHHHHHHH
T ss_pred             cceeecccccccchHHHHHHHHHHHHHHHHH----HhcCceEeeccHHHhcccCCCChhhCCCCCCCCHHHHHHHHHHHH
Confidence            4688999999999999999999999987655    578999999999999999999999999999999999999999999


Q ss_pred             HHHHHHH
Q psy9943          81 DIIEKAK   87 (135)
Q Consensus        81 ~~l~qLL   87 (135)
                      +.|.++|
T Consensus       206 ~~L~~lL  212 (212)
T d1fxwf_         206 ELIMQLL  212 (212)
T ss_dssp             HHHHHHC
T ss_pred             HHHHHhC
Confidence            9999986
>d1es9a_ c.23.10.3 (A:) Platelet-activating factor acetylhydrolase {Cow (Bos taurus), alpha1 [TaxId: 9913]} Back     information, alignment and structure
>d2hsja1 c.23.10.3 (A:1-211) Uncharacterized protein SP1450 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1vjga_ c.23.10.6 (A:) Hypothetical protein alr1529 {Nostoc sp. pcc 7120 [TaxId: 103690]} Back     information, alignment and structure
>d1yzfa1 c.23.10.5 (A:1-195) Lipase/acylhydrolase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d3dc7a1 c.23.10.9 (A:18-224) Uncharacterized protein Lp3323 {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1k7ca_ c.23.10.4 (A:) Rhamnogalacturonan acetylesterase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Back     information, alignment and structure
>d2o14a2 c.23.10.8 (A:160-367) Hypothetical protein YxiM {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1esca_ c.23.10.1 (A:) Esterase {Streptomyces scabies [TaxId: 1930]} Back     information, alignment and structure
>d1jrla_ c.23.10.5 (A:) Thioesterase I, TAP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3bzwa1 c.23.10.9 (A:38-285) Uncharacterized protein BT2961 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1zmba1 c.23.10.7 (A:1-282) Acetylxylan esterase related enzyme {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2apja1 c.23.10.7 (A:17-260) Putative acetylxylan esterase At4g34215 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pcfa_ d.18.1.1 (A:) Transcriptional coactivator PC4 C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure