Psyllid ID: psy9964

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-----
MSEIKVTPLGAGQDVGRSCILVSMGGKNIMLDCGMHMGYHDDRKFPDFKFIAPQGPVTDMIDCLIISHFHLDHCGALPYFTEMFGYAGPIYMTHPTKAIAPILLEDFRKISVEKKGDSNFFTSQMNILKIQILKYVMIKGTSKVWGHSSDDLLEFNKAHNYQDRISYIVENDLIIDAVTKKLNTLNIDIVYQKKVAHYELPEQPLNNVKIKFESGESIECKLLLGTDGARSQVRNAMNVQYSNWSYDQKGIVATVKISTSPPNRTAWQRFTPSGTVALLPLSDEFSSLVWATTPENAKALLQMPGESFVDALNSEFNKPAELNESIQVATKFTHNVLEFFNLSTGNEQVVPPRVMSVEEKSRAAFPLGFGHSVRYIGPGCALLGDSAHRIHPLAGQGVNLGFGDIACLVQLSAESVSNGYPIGHPESLTKYESIRQRENLPVMLSIDLMYRVYRSSLTPVKILGNLGFQLVNAVRPIKSILCDIFMRTSMEKVTLLVWNARYYSSLGGKQYDVVISGGGMIGTTLACAIAQNPTLKDLSILMIESGPEKSLHFSKSSSYSNRVSSINSSSKQLFETIGAWDHIESTRTCTVDNMK
ccccccEEccccccccccEEEEEEccccccccccccccccccccccccccccccccccccEEEEEEEccccccccccccccccccccEEEEEcccccccccccccccccEEEEEHHHHHHHHHccccccccccccccccccEEEEcccccccEEEEcccccccccEEEEHHHHHHHHHHHHHHccccEEEEccEEEEEEccccccccEEEEEccccEEEEcEEEEEcccccHHHHHccccccccccccEEEEEEEEcccccccccEEEEEcccccEEEcccccccEEEEEcccHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHcccHHHHHccccccccccccccccccccccEEcccccccccccccccEEEEcccccccccccHHHHHHcHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccHHcEEcccccccccccccccEEEEcccHHHHHHHHHHHccccccccEEEEEcccccccccccccccccccEEEEcHHHHHHHHHcccHHHHHHHccccccccc
cccEEEcccccccccccEEEEEEcccccEEEcccccccccccccccccEEEcccccccHHHHHHHHHHccccHHHHHHHHHHHcccEEEEEEccccccccccccccccEEEEccHHHHHHHHHcccHHHHHHHHcccHHHHEEEEcccccEEEEEcHHHcccccccHEEHHHHHHHHHHHHHHHcccEEEcccEEEEEEEccccccEEEEEEccccEEEEEEEEEcccccHHHHHHcccccEEEEcccEEEEEEEEcccccccccEEEEEcccccEEEEEccccccEEEEcccHHHHHHHHcccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccccccccccccEEEEcccccccccccHHHHHHHHcccEEEEEccHccccccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHHHHcccccccccEEEEEccHHHHHHHHHHHcccccccccEEEEEEccccccccccccccccccEEEccHHHHHHHHHccHHHHHHHHHHcHHHccc
mseikvtplgagqdvgrSCILVSmggknimldcgmhmgyhddrkfpdfkfiapqgpvtdmidCLIIshfhldhcgalpyftemfgyagpiymthptkaiaPILLEDFRKISvekkgdsnfftsQMNILKIQILKYVMIKGtskvwghssDDLLefnkahnyqdrISYIVENDLIIDAVTKKLNTLNIDIVYQKKvahyelpeqplnnvkikfesgesiecklllgtdgaRSQVRNAMNVQYSNWSYDQKGIVATVKistsppnrtawqrftpsgtvallplsdefsslVWATTPENAKALLQMPGESFVDALnsefnkpaelnESIQVATKFTHNVLEFFnlstgneqvvpprvmsveeksraafplgfghsvryigpgcallgdsahrihplagqgvnlgfGDIACLVQLsaesvsngypighpesltkyESIRQRENLPVMLSIDLMYRVYRssltpvkilGNLGFQLVNAVRPIKSILCDIFMRTSMEKVTLLVWNARYYsslggkqydvvisgggmiGTTLACAIaqnptlkdlSILMIesgpekslhfsksssysnrvssinSSSKQLFETIGawdhiestrtctvdnmk
mseikvtplgagqdvgrSCILVSMGGKNIMLDCGMHMGYHDDRKFPDFKFIAPQGPVTDMIDCLIISHFHLDHCGALPYFTEMFGYAGPIYMTHPTKAIAPILLEDFRKISVEkkgdsnfftsqmNILKIQILKYVMIKGTSKVWGHSSDDLLEFNKAHNYQDRISYIVENDLIIDAVTKKLNTLNIDIVYQKKVahyelpeqplnNVKIKFESGESIECKLLLGTDGARSQVRNAMNVQYSNWSYDQKGIVATVKISTSPPNRTAWQRFTPSGTVALLPLSDEFSSLVWATTPENAKALLQMPGESFVDALNSEFNKPAELNESIQVATKFTHNVLEFFNlstgneqvvPPRVMSVEEKSRAAFPLGFGHSVRYIGPGCALLGDSAHRIHPLAGQGVNLGFGDIACLVQLSAESVSNGYPIGHPESLTKYESIRQRENLPVMLSIDLMYRVYRSSLTPVKILGNLGFQLVNAVRPIKSILCDIFMRTSMEKVTLLVWNARYYSSLGGKQYDVVISGGGMIGTTLACAIAQNPTLKDLSILMIESGPEKSLHFSKSSSYSNRVSSINSSSKQLFETigawdhiestrtctvdnmk
MSEIKVTPLGAGQDVGRSCILVSMGGKNIMLDCGMHMGYHDDRKFPDFKFIAPQGPVTDMIDCLIISHFHLDHCGALPYFTEMFGYAGPIYMTHPTKAIAPILLEDFRKISVEKKGDSNFFTSQMNILKIQILKYVMIKGTSKVWGHSSDDLLEFNKAHNYQDRISYIVENDLIIDAVTKKLNTLNIDIVYQKKVAHYELPEQPLNNVKIKFESGESIECKLLLGTDGARSQVRNAMNVQYSNWSYDQKGIVATVKISTSPPNRTAWQRFTPSGTVALLPLSDEFSSLVWATTPENAKALLQMPGESFVDALNSEFNKPAELNESIQVATKFTHNVLEFFNLSTGNEQVVPPRVMSVEEKSRAAFPLGFGHSVRYIGPGCALLGDSAHRIHPLAGQGVNLGFGDIACLVQLSAESVSNGYPIGHPESLTKYESIRQRENLPVMLSIDLMYRVYRSSLTPVKILGNLGFQLVNAVRPIKSILCDIFMRTSMEKVTLLVWNARYYSSLGGKQYDVVISGGGMIGTTLACAIAQNPTLKDLSILMIESGPEKslhfsksssysnrvssinsssKQLFETIGAWDHIESTRTCTVDNMK
***********GQDVGRSCILVSMGGKNIMLDCGMHMGYHDDRKFPDFKFIAPQGPVTDMIDCLIISHFHLDHCGALPYFTEMFGYAGPIYMTHPTKAIAPILLEDFRKISVEKKGDSNFFTSQMNILKIQILKYVMIKGTSKVWGHSSDDLLEFNKAHNYQDRISYIVENDLIIDAVTKKLNTLNIDIVYQKKVAHYELPEQPLNNVKIKFESGESIECKLLLGTDGARSQVRNAMNVQYSNWSYDQKGIVATVKISTSPPNRTAWQRFTPSGTVALLPLSDEFSSLVWATTPENAKALLQMPGESFVDALN**F****ELNESIQVATKFTHNVLEFFNLSTGNEQVVPPRVMSV**KSRAAFPLGFGHSVRYIGPGCALLGDSAHRIHPLAGQGVNLGFGDIACLVQLSAESVSNGYPIGHPESLTKYESIRQRENLPVMLSIDLMYRVYRSSLTPVKILGNLGFQLVNAVRPIKSILCDIFMRTSMEKVTLLVWNARYYSSLGGKQYDVVISGGGMIGTTLACAIAQNPTLKDLSILMI*****************************LFETIGAWDHIEST*********
****KVTPLGAGQDVGRSCILVSMGGKNIMLDCGMHMGYHDDRKFPDFKFIAPQGPVTDMIDCLIISHFHLDHCGALPYFTEMFGYAGPIYMTHPTK******LEDFRKISVEKKGDSNFFTSQMNILKIQILKYVMIKGTSKVWGHSSDDLLEFNKAHNYQDRISYIVENDLIIDAVTKKLNTLNIDIVYQKKVAHYELPEQPLNNVKIKFESGESIECKLLLGTDGARSQVRNAMNVQYSNWSYDQKGIVATVKISTSPPNRTAWQRFTPSGTVALLPLSDEFSSLVWATTPENAKALLQMPGESFVDALNSEFNKPAELNESIQVATKFTHNVLEFFNLSTGNEQVVPPRVMSVEEKSRAAFPLGFGHSVRYIGPGCALLGDSAHRIHPLAGQGVNLGFGDIACLVQLSAESVSNGYPIGHPESLTKYESIRQRENLPVMLSIDLMYRVYRSSLTPVKILGNLGFQLVNAVRPIKSILCDIFMRTSMEKVTLLVWNARYYSSLGGKQYDVVISGGGMIGTTLACAIAQNPTLKDLSILMIESGP***********YSNRVSSINSSSKQLFETIGAWDHIESTRTCTVDNMK
MSEIKVTPLGAGQDVGRSCILVSMGGKNIMLDCGMHMGYHDDRKFPDFKFIAPQGPVTDMIDCLIISHFHLDHCGALPYFTEMFGYAGPIYMTHPTKAIAPILLEDFRKISVEKKGDSNFFTSQMNILKIQILKYVMIKGTSKVWGHSSDDLLEFNKAHNYQDRISYIVENDLIIDAVTKKLNTLNIDIVYQKKVAHYELPEQPLNNVKIKFESGESIECKLLLGTDGARSQVRNAMNVQYSNWSYDQKGIVATVKISTSPPNRTAWQRFTPSGTVALLPLSDEFSSLVWATTPENAKALLQMPGESFVDALNSEFNKPAELNESIQVATKFTHNVLEFFNLSTGNEQVVPPRVMSVEEKSRAAFPLGFGHSVRYIGPGCALLGDSAHRIHPLAGQGVNLGFGDIACLVQLSAESVSNGYPIGHPESLTKYESIRQRENLPVMLSIDLMYRVYRSSLTPVKILGNLGFQLVNAVRPIKSILCDIFMRTSMEKVTLLVWNARYYSSLGGKQYDVVISGGGMIGTTLACAIAQNPTLKDLSILMIESGPE*********************SKQLFETIGAWDHIESTRTCTVDNMK
**EIKVTPLGAGQDVGRSCILVSMGGKNIMLDCGMHMGYHDDRKFPDFKFIAPQGPVTDMIDCLIISHFHLDHCGALPYFTEMFGYAGPIYMTHPTKAIAPILLEDFRKISVEKKGDSNFFTSQMNILKIQILKYVMIKGTSKVWGHSSDDLLEFNKAHNYQDRISYIVENDLIIDAVTKKLNTLNIDIVYQKKVAHYELPEQPLNNVKIKFESGESIECKLLLGTDGARSQVRNAMNVQYSNWSYDQKGIVATVKISTSPPNRTAWQRFTPSGTVALLPLSDEFSSLVWATTPENAKALLQMPGESFVDALNSEFNKPAELNESIQVATKFTHNVLEFFNLSTGNEQVVPPRVMSVEEKSRAAFPLGFGHSVRYIGPGCALLGDSAHRIHPLAGQGVNLGFGDIACLVQLSAESVSNGYPIGHPESLTKYESIRQRENLPVMLSIDLMYRVYRSSLTPVKILGNLGFQLVNAVRPIKSILCDIFMRTSMEKVTLLVWNARYYSSLGGKQYDVVISGGGMIGTTLACAIAQNPTLKDLSILMIESGPEKSLHFSKSSSYSNRVSSINSSSKQLFETIGAWDHIESTRTCTVDN**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEIKVTPLGAGQDVGRSCILVSMGGKNIMLDCGMHMGYHDDRKFPDFKFIAPQGPVTDMIDCLIISHFHLDHCGALPYFTEMFGYAGPIYMTHPTKAIAPILLEDFRKISVEKKGDSNFFTSQMNILKIQILKYVMIKGTSKVWGHSSDDLLEFNKAHNYQDRISYIVENDLIIDAVTKKLNTLNIDIVYQKKVAHYELPEQPLNNVKIKFESGESIECKLLLGTDGARSQVRNAMNVQYSNWSYDQKGIVATVKISTSPPNRTAWQRFTPSGTVALLPLSDEFSSLVWATTPENAKALLQMPGESFVDALNSEFNKPAELNESIQVATKFTHNVLEFFNLSTGNEQVVPPRVMSVEEKSRAAFPLGFGHSVRYIGPGCALLGDSAHRIHPLAGQGVNLGFGDIACLVQLSAESVSNGYPIGHPESLTKYESIRQRENLPVMLSIDLMYRVYRSSLTPVKILGNLGFQLVNAVRPIKSILCDIFMRTSMEKVTLLVWNARYYSSLGGKQYDVVISGGGMIGTTLACAIAQNPTLKDLSILMIESGPEKSLHFSKSSSYSNRVSSINSSSKQLFETIGAWDHIESTRTCTVDNMK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query595 2.2.26 [Sep-21-2011]
Q6DF46464 Ubiquinone biosynthesis m yes N/A 0.589 0.756 0.420 1e-80
F1RAX8484 Ubiquinone biosynthesis m yes N/A 0.563 0.692 0.434 5e-79
Q68FU7476 Ubiquinone biosynthesis m yes N/A 0.557 0.697 0.417 8e-76
Q8R1S0476 Ubiquinone biosynthesis m yes N/A 0.557 0.697 0.417 2e-75
Q9Y2Z9468 Ubiquinone biosynthesis m yes N/A 0.561 0.713 0.419 3e-74
Q2KIL4469 Ubiquinone biosynthesis m yes N/A 0.559 0.710 0.415 7e-73
O01884451 Probable ubiquinone biosy yes N/A 0.616 0.813 0.390 6e-71
Q9VMQ5477 Putative ubiquinone biosy yes N/A 0.591 0.737 0.402 2e-69
Q5ZIH0600 Integrator complex subuni no N/A 0.210 0.208 0.8 9e-60
Q3MHC2600 Integrator complex subuni no N/A 0.210 0.208 0.784 4e-59
>sp|Q6DF46|COQ6_XENTR Ubiquinone biosynthesis monooxygenase COQ6 OS=Xenopus tropicalis GN=coq6 PE=2 SV=1 Back     alignment and function desciption
 Score =  301 bits (771), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 154/366 (42%), Positives = 229/366 (62%), Gaps = 15/366 (4%)

Query: 121 FTSQMNILKIQILKYVMIKGTSKVWGHSSDDLLEFNKAHNYQDRISYIVENDLIIDAVTK 180
           F +  +IL +++  Y  ++    VW   SD L+ F+K  +  + + YIVEND+II+A+TK
Sbjct: 97  FGAWDHILAMRLKPYKRMQ----VWDACSDALITFDK--DALEDMGYIVENDIIIEALTK 150

Query: 181 KLNTL--NIDIVYQKKVAHYELPEQPLNN------VKIKFESGESIECKLLLGTDGARSQ 232
           +L  +  +++++Y+ +   Y  P  P NN      V+I+   G+ +  KLL+G DG  S 
Sbjct: 151 QLELMSDHVEVMYRSRALSYSWPP-PYNNGKATPWVEIELADGQRLHTKLLIGADGHNSM 209

Query: 233 VRNAMNVQYSNWSYDQKGIVATVKISTSPPNRTAWQRFTPSGTVALLPLSDEFSSLVWAT 292
           VR+A  +Q   W+Y+   +VAT+ +S +  N  AWQRF P+G +ALLPLSD  SSLVW+T
Sbjct: 210 VRSAAGMQSVQWNYNHAAVVATLHLSEATDNNVAWQRFLPTGPIALLPLSDTCSSLVWST 269

Query: 293 TPENAKALLQMPGESFVDALNSEFNKPAELNESIQVATKFTHNVLEFFNLSTGNEQVVPP 352
           +PE+A  L+ M  ESFVD +NS F      +E I  A    H+ L FF  +  + + +PP
Sbjct: 270 SPEHASELVSMDEESFVDTVNSAFWSNENHSEFITSAGSLLHSALSFFMPTGSSPRQLPP 329

Query: 353 RVMSVEEKSRAAFPLGFGHSVRYIGPGCALLGDSAHRIHPLAGQGVNLGFGDIACLVQLS 412
            V  VE+ SRA+FPLG  H+  YI    AL+GD+AHR+HPLAGQGVN+GFGD+ACL    
Sbjct: 330 SVSRVEQNSRASFPLGLKHATEYIRHRVALIGDAAHRVHPLAGQGVNMGFGDVACLAHHL 389

Query: 413 AESVSNGYPIGHPESLTKYESIRQRENLPVMLSIDLMYRVYRSSLTPVKILGNLGFQLVN 472
           +++  NG  +G  + L +YE+ RQR NLP+M ++DL+ R+Y +   P+ +L  LG Q  N
Sbjct: 390 SQAAFNGSDLGSTKHLLEYETERQRHNLPLMAAVDLLKRLYNTKQPPIVLLRTLGLQATN 449

Query: 473 AVRPIK 478
           A+ P+K
Sbjct: 450 ALTPVK 455

Xenopus tropicalis (taxid: 8364)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 3EC: .EC: -
>sp|F1RAX8|COQ6_DANRE Ubiquinone biosynthesis monooxygenase COQ6 OS=Danio rerio GN=coq6 PE=2 SV=1 Back     alignment and function description
>sp|Q68FU7|COQ6_RAT Ubiquinone biosynthesis monooxygenase COQ6 OS=Rattus norvegicus GN=Coq6 PE=2 SV=1 Back     alignment and function description
>sp|Q8R1S0|COQ6_MOUSE Ubiquinone biosynthesis monooxygenase COQ6 OS=Mus musculus GN=Coq6 PE=2 SV=3 Back     alignment and function description
>sp|Q9Y2Z9|COQ6_HUMAN Ubiquinone biosynthesis monooxygenase COQ6 OS=Homo sapiens GN=COQ6 PE=1 SV=2 Back     alignment and function description
>sp|Q2KIL4|COQ6_BOVIN Ubiquinone biosynthesis monooxygenase COQ6 OS=Bos taurus GN=COQ6 PE=2 SV=2 Back     alignment and function description
>sp|O01884|COQ6_CAEEL Probable ubiquinone biosynthesis monooxygenase coq-6 OS=Caenorhabditis elegans GN=coq-6 PE=3 SV=2 Back     alignment and function description
>sp|Q9VMQ5|COQ6_DROME Putative ubiquinone biosynthesis monooxygenase COQ6 OS=Drosophila melanogaster GN=CG7277 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZIH0|INT11_CHICK Integrator complex subunit 11 OS=Gallus gallus GN=CPSF3L PE=2 SV=1 Back     alignment and function description
>sp|Q3MHC2|INT11_RAT Integrator complex subunit 11 OS=Rattus norvegicus GN=Cpsf3l PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query595
380025009476 PREDICTED: ubiquinone biosynthesis monoo 0.591 0.739 0.456 2e-84
383863837475 PREDICTED: ubiquinone biosynthesis monoo 0.583 0.730 0.448 2e-83
66509969474 PREDICTED: ubiquinone biosynthesis monoo 0.591 0.742 0.447 3e-83
332374764462 unknown [Dendroctonus ponderosae] 0.559 0.720 0.460 4e-81
307174003 999 Uncharacterized aarF domain-containing p 0.588 0.350 0.427 4e-80
307192550476 Ubiquinone biosynthesis monooxygenase CO 0.591 0.739 0.442 6e-80
242022685458 ubiquinone biosynthesis monooxygenase CO 0.581 0.755 0.448 2e-79
350417283477 PREDICTED: ubiquinone biosynthesis monoo 0.571 0.712 0.459 3e-79
55741992464 ubiquinone biosynthesis monooxygenase CO 0.589 0.756 0.420 7e-79
47230184478 unnamed protein product [Tetraodon nigro 0.563 0.700 0.447 9e-79
>gi|380025009|ref|XP_003696274.1| PREDICTED: ubiquinone biosynthesis monooxygenase COQ6-like [Apis florea] Back     alignment and taxonomy information
 Score =  320 bits (819), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 162/355 (45%), Positives = 233/355 (65%), Gaps = 3/355 (0%)

Query: 130 IQILKYVMIKGTSKVWGHSSDDLLEFNKAHNYQDRISYIVENDLIIDAVTKKL-NTLNID 188
           I+ ++Y  ++   +VW   SD ++ FN+ +   + I+YIVENDL++ AV K+L +  N++
Sbjct: 116 IEAIRYSTVRKM-QVWDACSDAMIIFNEDY-LTEEIAYIVENDLLLHAVNKQLTDKENVN 173

Query: 189 IVYQKKVAHYELPEQPLNNVKIKFESGESIECKLLLGTDGARSQVRNAMNVQYSNWSYDQ 248
           I+Y  KV + +LP+    N  I+ + G   + KLL+G DG  S VR  M+ QY  W+Y+Q
Sbjct: 174 IIYNSKVENIKLPKTQEENAVIQLQDGTKYKSKLLIGADGVNSLVRRTMDTQYVKWNYNQ 233

Query: 249 KGIVATVKISTSPPNRTAWQRFTPSGTVALLPLSDEFSSLVWATTPENAKALLQMPGESF 308
            GIVAT+K+S    N  AWQRF PSG +ALLPL++E SSLVW+   + AK LL++  E F
Sbjct: 234 MGIVATLKLSEPCENIVAWQRFLPSGPIALLPLTNELSSLVWSLPIDEAKRLLKVSEEEF 293

Query: 309 VDALNSEFNKPAELNESIQVATKFTHNVLEFFNLSTGNEQVVPPRVMSVEEKSRAAFPLG 368
           VD +N+   K    +  ++   K    +LE F+L TG  + + P V ++ E SRAAFPL 
Sbjct: 294 VDNINNALWKVYPKDGIVESGMKALQQLLEGFSLQTGVVRQLQPSVSAISEGSRAAFPLQ 353

Query: 369 FGHSVRYIGPGCALLGDSAHRIHPLAGQGVNLGFGDIACLVQLSAESVSNGYPIGHPESL 428
           FGHSV Y+  G  L+GD+AHR+HPLAGQGVNLGFGDI  LVQL AE+V +G PIG+   L
Sbjct: 354 FGHSVSYVQTGTVLVGDAAHRVHPLAGQGVNLGFGDITVLVQLLAEAVISGVPIGNIMYL 413

Query: 429 TKYESIRQRENLPVMLSIDLMYRVYRSSLTPVKILGNLGFQLVNAVRPIKSILCD 483
            KYE++RQR N+P+M +ID ++R+Y  +  P+ ++ +LG QL NA+  IK  L +
Sbjct: 414 RKYETLRQRYNVPIMFAIDALHRLYNGTAAPIVLVRSLGLQLTNAIPVIKKALIE 468

Source: Apis florea

Species: Apis florea

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383863837|ref|XP_003707386.1| PREDICTED: ubiquinone biosynthesis monooxygenase COQ6-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|66509969|ref|XP_395883.2| PREDICTED: ubiquinone biosynthesis monooxygenase COQ6-like [Apis mellifera] Back     alignment and taxonomy information
>gi|332374764|gb|AEE62523.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|307174003|gb|EFN64713.1| Uncharacterized aarF domain-containing protein kinase 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307192550|gb|EFN75738.1| Ubiquinone biosynthesis monooxygenase COQ6 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|242022685|ref|XP_002431769.1| ubiquinone biosynthesis monooxygenase COQ6, putative [Pediculus humanus corporis] gi|212517094|gb|EEB19031.1| ubiquinone biosynthesis monooxygenase COQ6, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|350417283|ref|XP_003491346.1| PREDICTED: ubiquinone biosynthesis monooxygenase COQ6-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|55741992|ref|NP_001006829.1| ubiquinone biosynthesis monooxygenase COQ6 [Xenopus (Silurana) tropicalis] gi|82182792|sp|Q6DF46.1|COQ6_XENTR RecName: Full=Ubiquinone biosynthesis monooxygenase COQ6; AltName: Full=Coenzyme Q10 monooxygenase 6 gi|49903471|gb|AAH76897.1| coenzyme Q6 homolog (yeast) [Xenopus (Silurana) tropicalis] gi|89273821|emb|CAJ83665.1| coenzyme Q6 homolog (yeast) [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|47230184|emb|CAG10598.1| unnamed protein product [Tetraodon nigroviridis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query595
ZFIN|ZDB-GENE-060825-297484 coq6 "coenzyme Q6 homolog, mon 0.563 0.692 0.434 7.5e-73
RGD|1311149476 Coq6 "coenzyme Q6 homolog, mon 0.561 0.701 0.422 3e-69
UNIPROTKB|F1S3H4476 COQ6 "Uncharacterized protein" 0.559 0.699 0.424 8e-69
MGI|MGI:1924408476 Coq6 "coenzyme Q6 homolog (yea 0.561 0.701 0.419 2.1e-68
UNIPROTKB|G3XA86393 COQ6 "Coenzyme Q6 homolog, mon 0.563 0.852 0.424 2.1e-68
UNIPROTKB|Q9Y2Z9468 COQ6 "Ubiquinone biosynthesis 0.561 0.713 0.422 2.7e-68
UNIPROTKB|F1PBF7469 COQ6 "Uncharacterized protein" 0.559 0.710 0.427 2.7e-68
UNIPROTKB|Q2KIL4469 COQ6 "Ubiquinone biosynthesis 0.559 0.710 0.418 3.1e-67
WB|WBGene00000766451 coq-6 [Caenorhabditis elegans 0.561 0.740 0.427 1.3e-66
UNIPROTKB|F1NBR7470 COQ6 "Uncharacterized protein" 0.561 0.710 0.411 2.2e-66
ZFIN|ZDB-GENE-060825-297 coq6 "coenzyme Q6 homolog, monooxygenase (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 736 (264.1 bits), Expect = 7.5e-73, P = 7.5e-73
 Identities = 149/343 (43%), Positives = 214/343 (62%)

Query:   143 KVWGHSSDDLLEFNKAHNYQDRISYIVENDLIIDAVTKKLNTLN--IDIVYQKKVAHYEL 200
             +VW   SD L+ F+K  N QD ++YIVEND+I+ A+TK+L TL+  + + Y+ KV  Y  
Sbjct:   134 QVWDACSDALITFDK-ENLQDEMAYIVENDVIVAALTKQLQTLSDHVKVQYRTKVVKYTW 192

Query:   201 PE-----QPLNNVKIKFESGESIECKLLLGTDGARSQVRNAMNVQYSNWSYDQKGIVATV 255
             P      + +  V++   +G+++  KLL+G DG  S VR    +    W+YDQ  +VA +
Sbjct:   193 PHPYHVSESIPWVQVALANGKTLHTKLLIGADGPNSMVRREAGIPTVKWNYDQSAVVAVL 252

Query:   256 KISTSPPNRTAWQRFTPSGTVALLPLSDEFSSLVWATTPENAKALLQMPGESFVDALNSE 315
              +S    N  AWQRF P+G +A+LPLSD  SSLVW+T+ ++A+ LLQM  ESFVDA+NS 
Sbjct:   253 HLSEPTENNVAWQRFLPTGPIAMLPLSDTESSLVWSTSHQHAEELLQMDEESFVDAINSA 312

Query:   316 FNKPAELNESIQVATKFTHNVLEFFNLSTGNEQVVPPRVMSVEEKSRAAFPLGFGHSVRY 375
             F      +E ++ A       L      +G+ + +PP V  +  KSR  FPLG GH+  Y
Sbjct:   313 FWSNENHSELVETAGSLFRMALSVLMPDSGSARQLPPSVSGIGPKSRVMFPLGMGHATEY 372

Query:   376 IGPGCALLGDSAHRIHPLAGQGVNLGFGDIACLVQLSAESVSNGYPIGHPESLTKYESIR 435
             I    AL+GD+AHR+HPLAGQG NLGFGD++ L Q+ +++  NG  IG  + L ++E+ R
Sbjct:   373 IRHRVALIGDAAHRVHPLAGQGANLGFGDVSYLTQVLSQAAYNGKDIGAMQHLLEFETER 432

Query:   436 QRENLPVMLSIDLMYRVYRSSLTPVKILGNLGFQLVNAVRPIK 478
             QR NLP+M +IDLM R+Y S+  P+ +L   G Q  NAV P+K
Sbjct:   433 QRHNLPMMTAIDLMKRLYSSNTAPMVLLRTFGLQATNAVPPLK 475
GO:0016709 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0004497 "monooxygenase activity" evidence=IEA
GO:0006744 "ubiquinone biosynthetic process" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0042995 "cell projection" evidence=IEA
GO:0005794 "Golgi apparatus" evidence=IEA
RGD|1311149 Coq6 "coenzyme Q6 homolog, monooxygenase (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1S3H4 COQ6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1924408 Coq6 "coenzyme Q6 homolog (yeast)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|G3XA86 COQ6 "Coenzyme Q6 homolog, monooxygenase (Yeast), isoform CRA_a" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y2Z9 COQ6 "Ubiquinone biosynthesis monooxygenase COQ6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PBF7 COQ6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KIL4 COQ6 "Ubiquinone biosynthesis monooxygenase COQ6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
WB|WBGene00000766 coq-6 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1NBR7 COQ6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O01884COQ6_CAEEL1, ., 1, 4, ., 1, 3, ., -0.39030.61680.8137yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.14.13LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query595
TIGR01989437 TIGR01989, COQ6, ubiquinone biosynthesis monooxyge 1e-111
TIGR01988387 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hyd 2e-93
PRK07608388 PRK07608, PRK07608, ubiquinone biosynthesis hydrox 2e-49
PRK07333403 PRK07333, PRK07333, 2-octaprenyl-6-methoxyphenyl h 2e-48
PRK08020391 PRK08020, ubiF, 2-octaprenyl-3-methyl-6-methoxy-1, 8e-48
PRK08849384 PRK08849, PRK08849, 2-octaprenyl-3-methyl-6-methox 1e-47
PRK05714405 PRK05714, PRK05714, 2-octaprenyl-3-methyl-6-methox 1e-46
PRK08850405 PRK08850, PRK08850, 2-octaprenyl-6-methoxyphenol h 7e-45
COG0654387 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydrox 2e-43
PRK07364415 PRK07364, PRK07364, 2-octaprenyl-6-methoxyphenyl h 2e-43
TIGR01984382 TIGR01984, UbiH, 2-polyprenyl-6-methoxyphenol 4-hy 5e-42
PRK05732395 PRK05732, PRK05732, 2-octaprenyl-6-methoxyphenyl h 2e-41
PRK08773392 PRK08773, PRK08773, 2-octaprenyl-3-methyl-6-methox 6e-41
PRK08013400 PRK08013, PRK08013, oxidoreductase; Provisional 5e-35
PRK09126392 PRK09126, PRK09126, hypothetical protein; Provisio 2e-28
COG1236427 COG1236, YSH1, Predicted exonuclease of the beta-l 2e-28
PRK07494388 PRK07494, PRK07494, 2-octaprenyl-6-methoxyphenyl h 9e-28
TIGR03675630 TIGR03675, arCOG00543, arCOG00543 universal archae 2e-25
COG1782637 COG1782, COG1782, Predicted metal-dependent RNase, 2e-24
TIGR01989 437 TIGR01989, COQ6, ubiquinone biosynthesis monooxyge 7e-24
PRK06996398 PRK06996, PRK06996, hypothetical protein; Provisio 4e-22
PRK06617374 PRK06617, PRK06617, 2-octaprenyl-6-methoxyphenyl h 7e-22
TIGR01988 387 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hyd 2e-19
PRK08849 384 PRK08849, PRK08849, 2-octaprenyl-3-methyl-6-methox 7e-12
pfam00753148 pfam00753, Lactamase_B, Metallo-beta-lactamase sup 7e-12
PRK08013 400 PRK08013, PRK08013, oxidoreductase; Provisional 9e-12
COG0595555 COG0595, COG0595, mRNA degradation ribonucleases J 1e-11
smart00849177 smart00849, Lactamase_B, Metallo-beta-lactamase su 2e-11
COG0654 387 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydrox 1e-10
PRK07608 388 PRK07608, PRK07608, ubiquinone biosynthesis hydrox 5e-10
PRK05714 405 PRK05714, PRK05714, 2-octaprenyl-3-methyl-6-methox 5e-10
PRK08020 391 PRK08020, ubiF, 2-octaprenyl-3-methyl-6-methoxy-1, 1e-09
PRK07045388 PRK07045, PRK07045, putative monooxygenase; Review 1e-09
PRK07364 415 PRK07364, PRK07364, 2-octaprenyl-6-methoxyphenyl h 7e-09
PRK08850 405 PRK08850, PRK08850, 2-octaprenyl-6-methoxyphenol h 1e-08
PRK07333 403 PRK07333, PRK07333, 2-octaprenyl-6-methoxyphenyl h 1e-07
TIGR01984 382 TIGR01984, UbiH, 2-polyprenyl-6-methoxyphenol 4-hy 2e-07
PRK05732 395 PRK05732, PRK05732, 2-octaprenyl-6-methoxyphenyl h 4e-07
TIGR00649422 TIGR00649, MG423, conserved hypothetical protein 5e-06
COG0491252 COG0491, GloB, Zn-dependent hydrolases, including 6e-06
PRK06996 398 PRK06996, PRK06996, hypothetical protein; Provisio 1e-05
pfam01494349 pfam01494, FAD_binding_3, FAD binding domain 2e-05
COG1237259 COG1237, COG1237, Metal-dependent hydrolases of th 9e-05
PRK00055270 PRK00055, PRK00055, ribonuclease Z; Reviewed 1e-04
COG1235269 COG1235, PhnP, Metal-dependent hydrolases of the b 2e-04
PRK08244493 PRK08244, PRK08244, hypothetical protein; Provisio 3e-04
PRK09126 392 PRK09126, PRK09126, hypothetical protein; Provisio 4e-04
PRK06184502 PRK06184, PRK06184, hypothetical protein; Provisio 4e-04
COG0644396 COG0644, FixC, Dehydrogenases (flavoproteins) [Ene 8e-04
PRK02113252 PRK02113, PRK02113, putative hydrolase; Provisiona 0.001
PRK08773 392 PRK08773, PRK08773, 2-octaprenyl-3-methyl-6-methox 0.002
PRK06753373 PRK06753, PRK06753, hypothetical protein; Provisio 0.003
>gnl|CDD|233672 TIGR01989, COQ6, ubiquinone biosynthesis monooxygenase COQ6 Back     alignment and domain information 
 Score =  339 bits (872), Expect = e-111
 Identities = 138/348 (39%), Positives = 204/348 (58%), Gaps = 11/348 (3%)

Query: 144 VWGHSSDDLLEFNKAHNYQDRISYIVENDLIIDAVTKKL---NTLNIDIVYQKKVAHYEL 200
           VW   S  L+ F++  N ++ ++ I+END I +++  +L   N  N+ I+   ++    +
Sbjct: 90  VWDGCSLALIRFDRD-NGKEDMACIIENDNIQNSLYNRLQEYNGDNVKILNPARLISVTI 148

Query: 201 PEQPLNN----VKIKFESGESIECKLLLGTDGARSQVRNAMNVQYSNWSYDQKGIVATVK 256
           P +  N+    V I    G+ +  KLL+G DG+ S VR A N+  + W+Y+Q  +VAT+K
Sbjct: 149 PSKYPNDNSNWVHITLSDGQVLYTKLLIGADGSNSNVRKAANIDTTGWNYNQHAVVATLK 208

Query: 257 ISTSPPNRTAWQRFTPSGTVALLPLSDEFSSLVWATTPENAKALLQMPGESFVDALNSEF 316
           +  +  N  AWQRF P+G +ALLPL D  S+LVW+T+PE A  LL +P E FVDALN+ F
Sbjct: 209 LEEATENDVAWQRFLPTGPIALLPLPDNNSTLVWSTSPEEALRLLSLPPEDFVDALNAAF 268

Query: 317 NKPAELNESIQVATKFTHNVLEF--FNLSTGNEQV-VPPRVMSVEEKSRAAFPLGFGHSV 373
           +     +    +       + E   F          VPPRV+ V +KSRAAFPLG GH+ 
Sbjct: 269 DLGYSDHPYSYLLDYAMEKLNEDIGFRTEGSKSCFQVPPRVIGVVDKSRAAFPLGLGHAD 328

Query: 374 RYIGPGCALLGDSAHRIHPLAGQGVNLGFGDIACLVQLSAESVSNGYPIGHPESLTKYES 433
            Y+    AL+GD+AHR+HPLAGQGVNLGFGD+A LV+  AE+VS G  IG   SL  YE 
Sbjct: 329 EYVTKRVALVGDAAHRVHPLAGQGVNLGFGDVASLVKALAEAVSVGADIGSISSLKPYER 388

Query: 434 IRQRENLPVMLSIDLMYRVYRSSLTPVKILGNLGFQLVNAVRPIKSIL 481
            R  +N+ ++  +D ++++Y +   PV  L   G  L N + P+K+ +
Sbjct: 389 ERYAKNVVLLGLVDKLHKLYATDFPPVVALRTFGLNLTNYIGPLKNFI 436

This model represents the monooxygenase responsible for the 4-hydroxylateion of the phenol ring in the aerobic biosynthesis of ubiquinone. Length = 437
>gnl|CDD|233671 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>gnl|CDD|181057 PRK07608, PRK07608, ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>gnl|CDD|180935 PRK07333, PRK07333, 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|181199 PRK08020, ubiF, 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>gnl|CDD|181564 PRK08849, PRK08849, 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|168201 PRK05714, PRK05714, 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|236341 PRK08850, PRK08850, 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|223727 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|236001 PRK07364, PRK07364, 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|233669 TIGR01984, UbiH, 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>gnl|CDD|235584 PRK05732, PRK05732, 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|181552 PRK08773, PRK08773, 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|236139 PRK08013, PRK08013, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|236385 PRK09126, PRK09126, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|224157 COG1236, YSH1, Predicted exonuclease of the beta-lactamase fold involved in RNA processing [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|181001 PRK07494, PRK07494, 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|188365 TIGR03675, arCOG00543, arCOG00543 universal archaeal KH-domain/beta-lactamase-domain protein Back     alignment and domain information
>gnl|CDD|224696 COG1782, COG1782, Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|233672 TIGR01989, COQ6, ubiquinone biosynthesis monooxygenase COQ6 Back     alignment and domain information
>gnl|CDD|235905 PRK06996, PRK06996, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|168629 PRK06617, PRK06617, 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|233671 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>gnl|CDD|181564 PRK08849, PRK08849, 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|216099 pfam00753, Lactamase_B, Metallo-beta-lactamase superfamily Back     alignment and domain information
>gnl|CDD|236139 PRK08013, PRK08013, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|223668 COG0595, COG0595, mRNA degradation ribonucleases J1/J2 (metallo-beta-lactamase superfamily) [Translation, ribosomal structure and biogenesis; Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|214854 smart00849, Lactamase_B, Metallo-beta-lactamase superfamily Back     alignment and domain information
>gnl|CDD|223727 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|181057 PRK07608, PRK07608, ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>gnl|CDD|168201 PRK05714, PRK05714, 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|181199 PRK08020, ubiF, 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>gnl|CDD|136171 PRK07045, PRK07045, putative monooxygenase; Reviewed Back     alignment and domain information
>gnl|CDD|236001 PRK07364, PRK07364, 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|236341 PRK08850, PRK08850, 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|180935 PRK07333, PRK07333, 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|233669 TIGR01984, UbiH, 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>gnl|CDD|235584 PRK05732, PRK05732, 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|233071 TIGR00649, MG423, conserved hypothetical protein Back     alignment and domain information
>gnl|CDD|223565 COG0491, GloB, Zn-dependent hydrolases, including glyoxylases [General function prediction only] Back     alignment and domain information
>gnl|CDD|235905 PRK06996, PRK06996, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|216530 pfam01494, FAD_binding_3, FAD binding domain Back     alignment and domain information
>gnl|CDD|224158 COG1237, COG1237, Metal-dependent hydrolases of the beta-lactamase superfamily II [General function prediction only] Back     alignment and domain information
>gnl|CDD|234602 PRK00055, PRK00055, ribonuclease Z; Reviewed Back     alignment and domain information
>gnl|CDD|224156 COG1235, PhnP, Metal-dependent hydrolases of the beta-lactamase superfamily I [General function prediction only] Back     alignment and domain information
>gnl|CDD|236199 PRK08244, PRK08244, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|236385 PRK09126, PRK09126, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235728 PRK06184, PRK06184, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|179371 PRK02113, PRK02113, putative hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|181552 PRK08773, PRK08773, 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|168661 PRK06753, PRK06753, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 595
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 100.0
PRK08013400 oxidoreductase; Provisional 100.0
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 100.0
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 100.0
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 100.0
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 100.0
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 100.0
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 100.0
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 100.0
PRK06996398 hypothetical protein; Provisional 100.0
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 100.0
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 100.0
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 100.0
KOG3855|consensus481 100.0
PRK09126392 hypothetical protein; Provisional 100.0
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 100.0
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 100.0
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 100.0
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 100.0
PRK06185407 hypothetical protein; Provisional 100.0
PRK07588391 hypothetical protein; Provisional 100.0
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 100.0
PRK06834488 hypothetical protein; Provisional 100.0
PRK08244493 hypothetical protein; Provisional 100.0
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 100.0
PRK06753373 hypothetical protein; Provisional 100.0
PRK07045388 putative monooxygenase; Reviewed 100.0
PRK05868372 hypothetical protein; Validated 99.98
PRK08132547 FAD-dependent oxidoreductase; Provisional 99.98
PRK08294634 phenol 2-monooxygenase; Provisional 99.98
PRK07190487 hypothetical protein; Provisional 99.97
PRK06475400 salicylate hydroxylase; Provisional 99.97
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 99.97
PRK06184502 hypothetical protein; Provisional 99.97
PRK06847375 hypothetical protein; Provisional 99.97
PTZ00367567 squalene epoxidase; Provisional 99.97
PLN02985514 squalene monooxygenase 99.97
PRK08163396 salicylate hydroxylase; Provisional 99.97
PRK07538413 hypothetical protein; Provisional 99.96
PRK06126545 hypothetical protein; Provisional 99.96
PRK07236386 hypothetical protein; Provisional 99.96
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 99.96
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 99.96
PLN02927668 antheraxanthin epoxidase/zeaxanthin epoxidase 99.95
KOG2614|consensus420 99.93
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 99.9
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 99.89
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 99.89
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 99.88
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 99.86
PRK11445351 putative oxidoreductase; Provisional 99.85
PRK10015429 oxidoreductase; Provisional 99.82
PF08491276 SE: Squalene epoxidase; InterPro: IPR013698 This d 99.82
KOG1136|consensus501 99.78
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 99.77
PRK10157428 putative oxidoreductase FixC; Provisional 99.77
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 99.74
KOG1298|consensus509 99.71
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 99.68
PLN02697529 lycopene epsilon cyclase 99.59
COG1782637 Predicted metal-dependent RNase, consists of a met 99.54
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 99.51
PLN02463447 lycopene beta cyclase 99.44
TIGR03675630 arCOG00543 arCOG00543 universal archaeal KH-domain 99.43
COG0595555 mRNA degradation ribonucleases J1/J2 (metallo-beta 99.4
TIGR00649422 MG423 conserved hypothetical protein. Contains an 99.35
PRK00055270 ribonuclease Z; Reviewed 99.3
KOG3855|consensus 481 99.23
PRK08850 405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 99.18
PRK08013 400 oxidoreductase; Provisional 99.17
PRK08849 384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.17
TIGR02651299 RNase_Z ribonuclease Z. Processing of the 3-prime 99.15
COG1237259 Metal-dependent hydrolases of the beta-lactamase s 99.14
PRK07494 388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 99.13
PRK06617 374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.13
PRK05714 405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.12
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 99.11
TIGR01989 437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 99.1
TIGR02649303 true_RNase_BN ribonuclease BN. Members of this pro 99.1
COG1234292 ElaC Metal-dependent hydrolases of the beta-lactam 99.1
PRK08773 392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.08
PRK06185 407 hypothetical protein; Provisional 99.07
PRK08020 391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 99.07
COG0654 387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 99.07
PRK02113252 putative hydrolase; Provisional 99.04
PRK05184302 pyrroloquinoline quinone biosynthesis protein PqqB 99.03
COG1236427 YSH1 Predicted exonuclease of the beta-lactamase f 99.02
PRK06184 502 hypothetical protein; Provisional 99.01
PRK08244 493 hypothetical protein; Provisional 99.01
PRK11244250 phnP carbon-phosphorus lyase complex accessory pro 99.0
KOG1137|consensus668 98.99
PRK09126 392 hypothetical protein; Provisional 98.99
TIGR02108302 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B. 98.99
PRK08294 634 phenol 2-monooxygenase; Provisional 98.98
PRK07333 403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.98
PRK07190 487 hypothetical protein; Provisional 98.97
PRK06126 545 hypothetical protein; Provisional 98.95
PRK07364 415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.95
PRK06996 398 hypothetical protein; Provisional 98.93
PRK07045 388 putative monooxygenase; Reviewed 98.93
PRK07608 388 ubiquinone biosynthesis hydroxylase family protein 98.92
TIGR02360 390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 98.91
PRK05732 395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.9
PF01494 356 FAD_binding_3: FAD binding domain; InterPro: IPR00 98.89
PRK06834 488 hypothetical protein; Provisional 98.89
PRK02126334 ribonuclease Z; Provisional 98.89
TIGR01984 382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 98.88
PLN02985 514 squalene monooxygenase 98.87
PLN02469258 hydroxyacylglutathione hydrolase 98.87
PRK08243 392 4-hydroxybenzoate 3-monooxygenase; Validated 98.86
TIGR01988 385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 98.86
PRK08163 396 salicylate hydroxylase; Provisional 98.84
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 98.82
PTZ00367 567 squalene epoxidase; Provisional 98.82
smart00849183 Lactamase_B Metallo-beta-lactamase superfamily. Ap 98.8
PRK08132 547 FAD-dependent oxidoreductase; Provisional 98.79
PRK07588 391 hypothetical protein; Provisional 98.79
PRK06475 400 salicylate hydroxylase; Provisional 98.77
PRK05868 372 hypothetical protein; Validated 98.77
PRK06753 373 hypothetical protein; Provisional 98.76
PF00753194 Lactamase_B: Metallo-beta-lactamase superfamily; I 98.76
PRK07538 413 hypothetical protein; Provisional 98.74
PRK10241251 hydroxyacylglutathione hydrolase; Provisional 98.69
PLN02398329 hydroxyacylglutathione hydrolase 98.67
PRK04286298 hypothetical protein; Provisional 98.67
PRK11921394 metallo-beta-lactamase/flavodoxin domain-containin 98.66
TIGR03413248 GSH_gloB hydroxyacylglutathione hydrolase. Members 98.66
PLN02962251 hydroxyacylglutathione hydrolase 98.65
PRK06847 375 hypothetical protein; Provisional 98.63
PRK07236 386 hypothetical protein; Provisional 98.63
TIGR00361662 ComEC_Rec2 DNA internalization-related competence 98.59
TIGR03307238 PhnP phosphonate metabolism protein PhnP. This fam 98.57
KOG2614|consensus 420 98.56
PRK05335 436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 98.54
PRK00685228 metal-dependent hydrolase; Provisional 98.53
PRK05452479 anaerobic nitric oxide reductase flavorubredoxin; 98.53
PRK11539755 ComEC family competence protein; Provisional 98.51
PRK11445 351 putative oxidoreductase; Provisional 98.45
COG2333293 ComEC Predicted hydrolase (metallo-beta-lactamase 98.42
PF01946 230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 98.41
TIGR03219 414 salicylate_mono salicylate 1-monooxygenase. Member 98.41
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 98.39
KOG1298|consensus 509 98.38
COG1635 262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.34
COG1235269 PhnP Metal-dependent hydrolases of the beta-lactam 98.32
PLN00093 450 geranylgeranyl diphosphate reductase; Provisional 98.32
KOG0813|consensus265 98.29
KOG1135|consensus 764 98.28
TIGR02023 388 BchP-ChlP geranylgeranyl reductase. This model rep 98.23
COG0426388 FpaA Uncharacterized flavoproteins [Energy product 98.23
COG0491252 GloB Zn-dependent hydrolases, including glyoxylase 98.22
TIGR02032 295 GG-red-SF geranylgeranyl reductase family. This mo 98.2
PRK04176 257 ribulose-1,5-biphosphate synthetase; Provisional 98.11
TIGR02028 398 ChlP geranylgeranyl reductase. This model represen 98.1
COG0644 396 FixC Dehydrogenases (flavoproteins) [Energy produc 98.09
TIGR00292 254 thiazole biosynthesis enzyme. This enzyme is invol 98.04
TIGR00137 433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 98.02
PRK10015 429 oxidoreductase; Provisional 98.02
PLN02463 447 lycopene beta cyclase 97.99
PRK10157 428 putative oxidoreductase FixC; Provisional 97.98
PF12706194 Lactamase_B_2: Beta-lactamase superfamily domain; 97.93
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 97.88
TIGR02650277 RNase_Z_T_toga ribonuclease Z, Thermotoga type. Me 97.86
TIGR01373 407 soxB sarcosine oxidase, beta subunit family, heter 97.84
COG2081 408 Predicted flavoproteins [General function predicti 97.8
COG3075 421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 97.79
PRK13369 502 glycerol-3-phosphate dehydrogenase; Provisional 97.79
PRK11259 376 solA N-methyltryptophan oxidase; Provisional 97.75
PRK12266 508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 97.74
KOG2121|consensus746 97.68
PF03486 409 HI0933_like: HI0933-like protein; InterPro: IPR004 97.68
COG0492 305 TrxB Thioredoxin reductase [Posttranslational modi 97.65
PLN02464 627 glycerol-3-phosphate dehydrogenase 97.65
TIGR03364 365 HpnW_proposed FAD dependent oxidoreductase TIGR033 97.64
COG1233 487 Phytoene dehydrogenase and related proteins [Secon 97.63
TIGR01377 380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 97.61
PLN02661 357 Putative thiazole synthesis 97.56
PF13483163 Lactamase_B_3: Beta-lactamase superfamily domain; 97.54
PF05834 374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 97.54
PRK08010 441 pyridine nucleotide-disulfide oxidoreductase; Prov 97.52
PF1369163 Lactamase_B_4: tRNase Z endonuclease 97.51
COG3380 331 Predicted NAD/FAD-dependent oxidoreductase [Genera 97.51
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 97.49
TIGR03378 419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 97.49
PTZ00363 443 rab-GDP dissociation inhibitor; Provisional 97.49
TIGR01790 388 carotene-cycl lycopene cyclase family protein. Thi 97.48
PLN02697 529 lycopene epsilon cyclase 97.48
TIGR02731 453 phytoene_desat phytoene desaturase. Plants and cya 97.48
PRK11709355 putative L-ascorbate 6-phosphate lactonase; Provis 97.47
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 97.44
PF01266 358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 97.43
PRK07251 438 pyridine nucleotide-disulfide oxidoreductase; Prov 97.43
COG0665 387 DadA Glycine/D-amino acid oxidases (deaminating) [ 97.43
PF04820 454 Trp_halogenase: Tryptophan halogenase; InterPro: I 97.43
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 97.41
PRK05249 461 soluble pyridine nucleotide transhydrogenase; Prov 97.41
PRK12409 410 D-amino acid dehydrogenase small subunit; Provisio 97.41
PF12831 428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 97.41
PRK05257 494 malate:quinone oxidoreductase; Validated 97.4
PRK08274 466 tricarballylate dehydrogenase; Validated 97.39
PRK06370 463 mercuric reductase; Validated 97.39
KOG2415|consensus 621 97.39
PF00732 296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 97.38
PTZ00383 497 malate:quinone oxidoreductase; Provisional 97.36
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 97.35
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 97.34
COG0579 429 Predicted dehydrogenase [General function predicti 97.33
TIGR01421 450 gluta_reduc_1 glutathione-disulfide reductase, ani 97.31
COG0578 532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 97.31
COG2220258 Predicted Zn-dependent hydrolases of the beta-lact 97.3
PRK06115 466 dihydrolipoamide dehydrogenase; Reviewed 97.3
KOG0029|consensus 501 97.3
PRK13339 497 malate:quinone oxidoreductase; Reviewed 97.3
PRK06116 450 glutathione reductase; Validated 97.27
PRK07208 479 hypothetical protein; Provisional 97.26
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.26
PRK11728 393 hydroxyglutarate oxidase; Provisional 97.26
TIGR03329 460 Phn_aa_oxid putative aminophosphonate oxidoreducta 97.25
TIGR01292 300 TRX_reduct thioredoxin-disulfide reductase. This m 97.24
PRK05329 422 anaerobic glycerol-3-phosphate dehydrogenase subun 97.23
PRK06292 460 dihydrolipoamide dehydrogenase; Validated 97.23
TIGR01424 446 gluta_reduc_2 glutathione-disulfide reductase, pla 97.23
TIGR02730 493 carot_isom carotene isomerase. Members of this fam 97.22
TIGR01320 483 mal_quin_oxido malate:quinone-oxidoreductase. This 97.21
PF02112335 PDEase_II: cAMP phosphodiesterases class-II; Inter 97.21
TIGR01789 370 lycopene_cycl lycopene cyclase. This model represe 97.21
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 97.2
PF00890 417 FAD_binding_2: FAD binding domain of the Pfam fami 97.2
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 97.19
PRK00711 416 D-amino acid dehydrogenase small subunit; Validate 97.18
PRK14694 468 putative mercuric reductase; Provisional 97.18
TIGR00031 377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 97.18
PRK02106 560 choline dehydrogenase; Validated 97.16
PRK01747 662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 97.16
TIGR00562 462 proto_IX_ox protoporphyrinogen oxidase. This prote 97.16
PLN02612 567 phytoene desaturase 97.16
PRK06416 462 dihydrolipoamide dehydrogenase; Reviewed 97.16
PRK05976 472 dihydrolipoamide dehydrogenase; Validated 97.13
PRK06467 471 dihydrolipoamide dehydrogenase; Reviewed 97.12
TIGR02732 474 zeta_caro_desat carotene 7,8-desaturase. Carotene 97.1
PRK07818 466 dihydrolipoamide dehydrogenase; Reviewed 97.1
COG1231 450 Monoamine oxidase [Amino acid transport and metabo 97.1
PRK06481 506 fumarate reductase flavoprotein subunit; Validated 97.09
TIGR02733 492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 97.09
PF07992 201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 97.08
PLN02487 569 zeta-carotene desaturase 97.06
PRK07121 492 hypothetical protein; Validated 97.06
PLN02268 435 probable polyamine oxidase 97.05
PRK12416 463 protoporphyrinogen oxidase; Provisional 97.05
KOG2820|consensus 399 97.04
PRK07233 434 hypothetical protein; Provisional 97.04
TIGR02053 463 MerA mercuric reductase. This model represents the 97.04
PRK11728393 hydroxyglutarate oxidase; Provisional 97.02
PRK11883 451 protoporphyrinogen oxidase; Reviewed 97.02
TIGR01350 461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 96.99
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 96.98
COG3349 485 Uncharacterized conserved protein [Function unknow 96.97
COG0562 374 Glf UDP-galactopyranose mutase [Cell envelope biog 96.97
TIGR01813 439 flavo_cyto_c flavocytochrome c. This model describ 96.96
COG3573 552 Predicted oxidoreductase [General function predict 96.96
COG1232 444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 96.96
PRK10262 321 thioredoxin reductase; Provisional 96.96
PRK12834 549 putative FAD-binding dehydrogenase; Reviewed 96.94
PLN02507 499 glutathione reductase 96.94
PRK06327 475 dihydrolipoamide dehydrogenase; Validated 96.93
PTZ00052 499 thioredoxin reductase; Provisional 96.92
TIGR02734 502 crtI_fam phytoene desaturase. Phytoene is converte 96.92
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 96.91
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 96.91
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 96.9
TIGR02730493 carot_isom carotene isomerase. Members of this fam 96.9
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 96.9
PRK13748 561 putative mercuric reductase; Provisional 96.89
PRK12831 464 putative oxidoreductase; Provisional 96.89
PTZ00058 561 glutathione reductase; Provisional 96.89
PF13738 203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 96.89
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 96.87
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 96.87
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 96.87
PRK12837 513 3-ketosteroid-delta-1-dehydrogenase; Provisional 96.87
PRK15317 517 alkyl hydroperoxide reductase subunit F; Provision 96.87
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 96.86
TIGR02462 544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 96.86
PRK12842 574 putative succinate dehydrogenase; Reviewed 96.86
PLN02568 539 polyamine oxidase 96.86
PRK08401 466 L-aspartate oxidase; Provisional 96.86
PRK07804 541 L-aspartate oxidase; Provisional 96.85
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 96.83
PLN02172 461 flavin-containing monooxygenase FMO GS-OX 96.83
KOG2853|consensus 509 96.82
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 96.82
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 96.8
TIGR03140 515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 96.78
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 96.78
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 96.77
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 96.73
PLN02546 558 glutathione reductase 96.73
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 96.71
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 96.71
PLN02815 594 L-aspartate oxidase 96.7
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 96.69
PLN02576 496 protoporphyrinogen oxidase 96.69
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 96.69
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 96.67
PF01134 392 GIDA: Glucose inhibited division protein A; InterP 96.67
PRK06175 433 L-aspartate oxidase; Provisional 96.67
PRK12844 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 96.63
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 96.63
COG1148 622 HdrA Heterodisulfide reductase, subunit A and rela 96.63
KOG1276|consensus 491 96.57
PRK06567 1028 putative bifunctional glutamate synthase subunit b 96.53
PRK13977 576 myosin-cross-reactive antigen; Provisional 96.53
COG2303 542 BetA Choline dehydrogenase and related flavoprotei 96.52
PRK14727 479 putative mercuric reductase; Provisional 96.52
PRK07395 553 L-aspartate oxidase; Provisional 96.52
PRK12839 572 hypothetical protein; Provisional 96.51
TIGR00551 488 nadB L-aspartate oxidase. L-aspartate oxidase is t 96.51
TIGR01318 467 gltD_gamma_fam glutamate synthase small subunit fa 96.5
PRK12810 471 gltD glutamate synthase subunit beta; Reviewed 96.5
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 96.5
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 96.49
PLN02612567 phytoene desaturase 96.49
PLN02852 491 ferredoxin-NADP+ reductase 96.49
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 96.48
KOG0814|consensus237 96.48
PLN02676 487 polyamine oxidase 96.47
TIGR01810 532 betA choline dehydrogenase. This enzyme is a membe 96.45
COG1249 454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 96.44
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 96.44
PRK08275 554 putative oxidoreductase; Provisional 96.44
COG1053 562 SdhA Succinate dehydrogenase/fumarate reductase, f 96.43
TIGR01316 449 gltA glutamate synthase (NADPH), homotetrameric. T 96.43
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 96.43
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 96.4
PRK12779 944 putative bifunctional glutamate synthase subunit b 96.38
TIGR01438 484 TGR thioredoxin and glutathione reductase selenopr 96.38
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 96.37
TIGR01423 486 trypano_reduc trypanothione-disulfide reductase. T 96.37
PLN02785 587 Protein HOTHEAD 96.34
PRK12845 564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 96.34
PRK07233434 hypothetical protein; Provisional 96.33
PRK12416463 protoporphyrinogen oxidase; Provisional 96.33
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 96.32
PLN02328 808 lysine-specific histone demethylase 1 homolog 96.3
KOG0042|consensus 680 96.29
PLN02529 738 lysine-specific histone demethylase 1 96.27
PRK11749 457 dihydropyrimidine dehydrogenase subunit A; Provisi 96.26
TIGR00275 400 flavoprotein, HI0933 family. The model when search 96.26
PTZ00153 659 lipoamide dehydrogenase; Provisional 96.23
PRK08071 510 L-aspartate oxidase; Provisional 96.23
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 96.23
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 96.22
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 96.21
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 96.21
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 96.2
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 96.18
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 96.13
KOG2665|consensus 453 96.08
KOG1399|consensus 448 96.06
PRK12814 652 putative NADPH-dependent glutamate synthase small 96.05
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 96.04
PRK06912 458 acoL dihydrolipoamide dehydrogenase; Validated 95.98
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 95.97
KOG1238|consensus 623 95.96
PRK09077 536 L-aspartate oxidase; Provisional 95.96
PRK12778 752 putative bifunctional 2-polyprenylphenol hydroxyla 95.94
KOG2960|consensus 328 95.84
PRK12770 352 putative glutamate synthase subunit beta; Provisio 95.82
TIGR01317 485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 95.81
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 95.78
PF14597199 Lactamase_B_5: Metallo-beta-lactamase superfamily; 95.77
PRK12843 578 putative FAD-binding dehydrogenase; Reviewed 95.77
COG2015655 Alkyl sulfatase and related hydrolases [Secondary 95.75
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 95.72
PRK05257494 malate:quinone oxidoreductase; Validated 95.71
PRK07512 513 L-aspartate oxidase; Provisional 95.67
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 95.66
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 95.65
PTZ00188 506 adrenodoxin reductase; Provisional 95.55
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 95.5
PRK11883451 protoporphyrinogen oxidase; Reviewed 95.49
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 95.46
TIGR03467419 HpnE squalene-associated FAD-dependent desaturase. 95.43
COG2081408 Predicted flavoproteins [General function predicti 95.38
PLN03000 881 amine oxidase 95.37
KOG4254|consensus 561 95.29
PRK09754 396 phenylpropionate dioxygenase ferredoxin reductase 95.29
COG3634 520 AhpF Alkyl hydroperoxide reductase, large subunit 95.27
KOG0685|consensus 498 95.24
PRK07846 451 mycothione reductase; Reviewed 95.16
PRK07845 466 flavoprotein disulfide reductase; Reviewed 95.16
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 95.13
PLN02676487 polyamine oxidase 95.07
COG1252 405 Ndh NADH dehydrogenase, FAD-containing subunit [En 95.06
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 95.0
COG0029 518 NadB Aspartate oxidase [Coenzyme metabolism] 94.99
COG1206 439 Gid NAD(FAD)-utilizing enzyme possibly involved in 94.98
TIGR03452 452 mycothione_red mycothione reductase. Mycothiol, a 94.97
COG2248304 Predicted hydrolase (metallo-beta-lactamase superf 94.94
PF06039 488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 94.92
COG5212356 PDE1 Low-affinity cAMP phosphodiesterase [Signal t 94.91
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 94.85
PLN02976 1713 amine oxidase 94.84
TIGR00275400 flavoprotein, HI0933 family. The model when search 94.75
COG4529 474 Uncharacterized protein conserved in bacteria [Fun 94.69
KOG2852|consensus 380 94.63
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 94.62
PRK11259376 solA N-methyltryptophan oxidase; Provisional 94.61
COG0569 225 TrkA K+ transport systems, NAD-binding component [ 94.61
PRK09564 444 coenzyme A disulfide reductase; Reviewed 94.58
PRK13984 604 putative oxidoreductase; Provisional 94.56
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 94.51
PLN02976 1713 amine oxidase 94.5
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 94.5
COG2907 447 Predicted NAD/FAD-binding protein [General functio 94.5
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 94.37
KOG2415|consensus621 94.33
PTZ00318 424 NADH dehydrogenase-like protein; Provisional 94.25
PRK09897 534 hypothetical protein; Provisional 94.25
COG0493 457 GltD NADPH-dependent glutamate synthase beta chain 94.2
COG0579429 Predicted dehydrogenase [General function predicti 94.19
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 94.18
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 94.17
TIGR02485 432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 94.14
PF13434 341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 94.03
PF00996 438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 93.96
PTZ00383497 malate:quinone oxidoreductase; Provisional 93.78
KOG1335|consensus 506 93.75
PRK13512 438 coenzyme A disulfide reductase; Provisional 93.64
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 93.41
PLN02464627 glycerol-3-phosphate dehydrogenase 93.31
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 93.28
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 93.2
COG0446 415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 93.2
PRK05976 472 dihydrolipoamide dehydrogenase; Validated 93.05
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 92.8
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 92.69
PF01134392 GIDA: Glucose inhibited division protein A; InterP 92.66
KOG1800|consensus 468 92.57
KOG2820|consensus399 92.57
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 92.49
PRK04965 377 NADH:flavorubredoxin oxidoreductase; Provisional 92.49
PLN02487569 zeta-carotene desaturase 92.49
TIGR03169 364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 92.45
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 92.36
TIGR01421 450 gluta_reduc_1 glutathione-disulfide reductase, ani 92.34
KOG1137|consensus668 92.29
PRK06912 458 acoL dihydrolipoamide dehydrogenase; Validated 92.26
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 92.24
KOG4716|consensus 503 92.21
PRK06116450 glutathione reductase; Validated 92.14
PRK07251 438 pyridine nucleotide-disulfide oxidoreductase; Prov 92.11
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 92.11
PRK06115 466 dihydrolipoamide dehydrogenase; Reviewed 92.05
PRK13339497 malate:quinone oxidoreductase; Reviewed 91.98
PRK13512 438 coenzyme A disulfide reductase; Provisional 91.93
PRK05192618 tRNA uridine 5-carboxymethylaminomethyl modificati 91.53
KOG4736|consensus302 91.45
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 91.36
TIGR02053 463 MerA mercuric reductase. This model represents the 91.05
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 91.01
PRK06370 463 mercuric reductase; Validated 90.91
TIGR03385 427 CoA_CoA_reduc CoA-disulfide reductase. Members of 90.85
KOG2311|consensus 679 90.75
COG1252 405 Ndh NADH dehydrogenase, FAD-containing subunit [En 90.72
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 90.64
PRK06467 471 dihydrolipoamide dehydrogenase; Reviewed 90.59
PRK06249 313 2-dehydropantoate 2-reductase; Provisional 90.56
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 90.54
COG5044 434 MRS6 RAB proteins geranylgeranyltransferase compon 90.36
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 90.32
PRK07845466 flavoprotein disulfide reductase; Reviewed 90.3
PF13478136 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 90.26
PRK14989 847 nitrite reductase subunit NirD; Provisional 90.25
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 90.23
KOG2404|consensus 477 90.17
PLN02507499 glutathione reductase 89.97
COG1233487 Phytoene dehydrogenase and related proteins [Secon 89.94
PF03721 185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 89.92
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 89.91
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 89.84
KOG3923|consensus 342 89.74
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.72
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 89.68
PRK12770352 putative glutamate synthase subunit beta; Provisio 89.6
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 89.6
PTZ00058 561 glutathione reductase; Provisional 89.41
PLN02576496 protoporphyrinogen oxidase 89.35
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 89.29
PRK06129 308 3-hydroxyacyl-CoA dehydrogenase; Validated 89.15
KOG2844|consensus 856 89.04
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 88.66
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 88.63
PRK06719157 precorrin-2 dehydrogenase; Validated 88.63
PLN02568539 polyamine oxidase 88.32
PRK09897534 hypothetical protein; Provisional 88.26
PRK08293 287 3-hydroxybutyryl-CoA dehydrogenase; Validated 88.24
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 88.2
TIGR01470 205 cysG_Nterm siroheme synthase, N-terminal domain. T 88.14
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 88.13
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information 
Probab=100.00  E-value=1.8e-41  Score=353.12  Aligned_cols=342  Identities=40%  Similarity=0.689  Sum_probs=267.2

Q ss_pred             cccCcEEEEecCCCcceEEcCCccCccccceeeeHHHHHHHHHHHHhcC---CceEEeCCeEeEEecC----CCCCCceE
Q psy9964         137 MIKGTSKVWGHSSDDLLEFNKAHNYQDRISYIVENDLIIDAVTKKLNTL---NIDIVYQKKVAHYELP----EQPLNNVK  209 (595)
Q Consensus       137 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~R~~L~~~L~~~~~~~---gv~i~~~~~v~~v~~~----~~~~~~v~  209 (595)
                      .+...+.+|+..+...+.|+... ...+.++.++|..|++.|.+.+.+.   +++++++++|+++++.    ++++++++
T Consensus        83 ~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~i~~~~l~~~L~~~~~~~~~~~v~i~~~~~v~~i~~~~~~~~~~~~~v~  161 (437)
T TIGR01989        83 QPFGRMQVWDGCSLALIRFDRDN-GKEDMACIIENDNIQNSLYNRLQEYNGDNVKILNPARLISVTIPSKYPNDNSNWVH  161 (437)
T ss_pred             CceeeEEEecCCCCceEEeecCC-CCCceEEEEEHHHHHHHHHHHHHhCCCCCeEEecCCeeEEEEeccccccCCCCceE
Confidence            45567888887766667777654 3456789999999999999999874   5999999999999752    12457899


Q ss_pred             EEEcCCcEEEecEEEEecCCCchhhhhcCCCCcccCCCCeEEEEEEEeccCCCCceEEEEeCCCCcEEEeeCCCCCeEEE
Q psy9964         210 IKFESGESIECKLLLGTDGARSQVRNAMNVQYSNWSYDQKGIVATVKISTSPPNRTAWQRFTPSGTVALLPLSDEFSSLV  289 (595)
Q Consensus       210 v~~~dG~~~~adlvVgADG~~S~vR~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~p~~~~~~~~~  289 (595)
                      |++.+|++++||+||||||++|.||+.+++...+..|.+.++++.+.....+.....++.|.++|+++++|++++..+++
T Consensus       162 v~~~~g~~i~a~llVgADG~~S~vR~~~gi~~~g~~y~q~~~v~~v~~~~~~~~~~~~~~f~~~g~~~~lPl~~~~~~~~  241 (437)
T TIGR01989       162 ITLSDGQVLYTKLLIGADGSNSNVRKAANIDTTGWNYNQHAVVATLKLEEATENDVAWQRFLPTGPIALLPLPDNNSTLV  241 (437)
T ss_pred             EEEcCCCEEEeeEEEEecCCCChhHHHcCCCccceeeccEEEEEEEEcccCCCCCeEEEEECCCCCEEEeECCCCCEEEE
Confidence            99999999999999999999999999999998888898888888887654445567788889999999999999889999


Q ss_pred             EecCHhhHHHHhCCCchHHHHHHHHhc---CCCcchhhHHHHhhhhhhchhhhccc---cCCCcccCCCccceeccccce
Q psy9964         290 WATTPENAKALLQMPGESFVDALNSEF---NKPAELNESIQVATKFTHNVLEFFNL---STGNEQVVPPRVMSVEEKSRA  363 (595)
Q Consensus       290 ~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~  363 (595)
                      |..+..........+.++|.+.+...+   +...+.....+..   ++++.+.+..   ........++.+..+......
T Consensus       242 ~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~p~~~~~~~~---~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  318 (437)
T TIGR01989       242 WSTSPEEALRLLSLPPEDFVDALNAAFDLGYSDHPYSYLLDYA---MEKLNEDIGFRTEGSKSCFQVPPRVIGVVDKSRA  318 (437)
T ss_pred             EeCCHHHHHHHHcCCHHHHHHHHHHHhcccccccccccccccc---cccccccccccccccccccccCchhheeecccce
Confidence            999887777777777888888776666   1111110111111   1111111110   000011123333333333457


Q ss_pred             eeeccccccccccCCCEEEEccccccccCccchhhhhchHHHHHHHHHHHHhhhCCCCCCChHHHHHHHHHhhhccchHH
Q psy9964         364 AFPLGFGHSVRYIGPGCALLGDSAHRIHPLAGQGVNLGFGDIACLVQLSAESVSNGYPIGHPESLTKYESIRQRENLPVM  443 (595)
Q Consensus       364 ~~~~~~~~~~~~~~grvvLvGDAAH~~~P~~GqG~n~Al~Da~~La~~L~~~~~~~~~~~~~~~L~~Y~~~r~~~~~~~~  443 (595)
                      .||+....+++|..+||+|+|||||.|+|++|||+|+||+||.+|+++|.+....+.+.+...+|+.|+++|++++..++
T Consensus       319 ~~~~~~~~~~~~~~~rv~l~GDAAH~~~P~~GqG~n~~l~Da~~La~~L~~~~~~~~~~~~~~~L~~Y~~~R~~~~~~v~  398 (437)
T TIGR01989       319 AFPLGLGHADEYVTKRVALVGDAAHRVHPLAGQGVNLGFGDVASLVKALAEAVSVGADIGSISSLKPYERERYAKNVVLL  398 (437)
T ss_pred             eEEecccchhhccCCCEEEEchhhcCCCCChhhhHHHHHHHHHHHHHHHHHHHhcCCChhHHHHHHHHHHHHHHHHHHHH
Confidence            78888888999999999999999999999999999999999999999998877666543345799999999999999999


Q ss_pred             HHHHHHHHhhcCCchHHHHHHHHHHHhhccChhHHHHHH
Q psy9964         444 LSIDLMYRVYRSSLTPVKILGNLGFQLVNAVRPIKSILC  482 (595)
Q Consensus       444 ~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~  482 (595)
                      ..++.+.++|..++++...+|+.++..++.+|++|+.++
T Consensus       399 ~~t~~l~~l~~~~~~~~~~~R~~~l~~~~~~~~~k~~~~  437 (437)
T TIGR01989       399 GLVDKLHKLYATDFPPVVALRTFGLNLTNYIGPLKNFIM  437 (437)
T ss_pred             HHHHHHHHHHcCCccHHHHHHHHHHHHhhhCHHhHHhhC
Confidence            999999999999999999999999999999999999863

This model represents the monooxygenase responsible for the 4-hydroxylateion of the phenol ring in the aerobic biosynthesis of ubiquinone
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>KOG3855|consensus Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>KOG2614|consensus Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PF08491 SE: Squalene epoxidase; InterPro: IPR013698 This domain is found in squalene epoxidase (SE) and related proteins which are found in taxonomically diverse groups of eukaryotes and also in bacteria Back     alignment and domain information
>KOG1136|consensus Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>KOG1298|consensus Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>COG1782 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only] Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>TIGR03675 arCOG00543 arCOG00543 universal archaeal KH-domain/beta-lactamase-domain protein Back     alignment and domain information
>COG0595 mRNA degradation ribonucleases J1/J2 (metallo-beta-lactamase superfamily) [Translation, ribosomal structure and biogenesis; Replication, recombination and repair] Back     alignment and domain information
>TIGR00649 MG423 conserved hypothetical protein Back     alignment and domain information
>PRK00055 ribonuclease Z; Reviewed Back     alignment and domain information
>KOG3855|consensus Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>TIGR02651 RNase_Z ribonuclease Z Back     alignment and domain information
>COG1237 Metal-dependent hydrolases of the beta-lactamase superfamily II [General function prediction only] Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>TIGR02649 true_RNase_BN ribonuclease BN Back     alignment and domain information
>COG1234 ElaC Metal-dependent hydrolases of the beta-lactamase superfamily III [General function prediction only] Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK02113 putative hydrolase; Provisional Back     alignment and domain information
>PRK05184 pyrroloquinoline quinone biosynthesis protein PqqB; Provisional Back     alignment and domain information
>COG1236 YSH1 Predicted exonuclease of the beta-lactamase fold involved in RNA processing [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK11244 phnP carbon-phosphorus lyase complex accessory protein; Provisional Back     alignment and domain information
>KOG1137|consensus Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02108 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK02126 ribonuclease Z; Provisional Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PLN02469 hydroxyacylglutathione hydrolase Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>smart00849 Lactamase_B Metallo-beta-lactamase superfamily Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PF00753 Lactamase_B: Metallo-beta-lactamase superfamily; InterPro: IPR001279 Apart from the beta-lactamases and metallo-beta-lactamases, a number of other proteins contain this domain [] Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK10241 hydroxyacylglutathione hydrolase; Provisional Back     alignment and domain information
>PLN02398 hydroxyacylglutathione hydrolase Back     alignment and domain information
>PRK04286 hypothetical protein; Provisional Back     alignment and domain information
>PRK11921 metallo-beta-lactamase/flavodoxin domain-containing protein; Provisional Back     alignment and domain information
>TIGR03413 GSH_gloB hydroxyacylglutathione hydrolase Back     alignment and domain information
>PLN02962 hydroxyacylglutathione hydrolase Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00361 ComEC_Rec2 DNA internalization-related competence protein ComEC/Rec2 Back     alignment and domain information
>TIGR03307 PhnP phosphonate metabolism protein PhnP Back     alignment and domain information
>KOG2614|consensus Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK00685 metal-dependent hydrolase; Provisional Back     alignment and domain information
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional Back     alignment and domain information
>PRK11539 ComEC family competence protein; Provisional Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>COG2333 ComEC Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>KOG1298|consensus Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1235 PhnP Metal-dependent hydrolases of the beta-lactamase superfamily I [General function prediction only] Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>KOG0813|consensus Back     alignment and domain information
>KOG1135|consensus Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>COG0426 FpaA Uncharacterized flavoproteins [Energy production and conversion] Back     alignment and domain information
>COG0491 GloB Zn-dependent hydrolases, including glyoxylases [General function prediction only] Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PF12706 Lactamase_B_2: Beta-lactamase superfamily domain; PDB: 3BV6_F 1WW1_A 2E7Y_A 3RPC_D 3ZWF_A 3JXP_A 1XTO_A 2CBN_A 3G1P_B 3P2U_A Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>TIGR02650 RNase_Z_T_toga ribonuclease Z, Thermotoga type Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>KOG2121|consensus Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PF13483 Lactamase_B_3: Beta-lactamase superfamily domain; PDB: 1VJN_B 3KL7_A Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PF13691 Lactamase_B_4: tRNase Z endonuclease Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PRK11709 putative L-ascorbate 6-phosphate lactonase; Provisional Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>KOG2415|consensus Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>COG2220 Predicted Zn-dependent hydrolases of the beta-lactamase fold [General function prediction only] Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>KOG0029|consensus Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PF02112 PDEase_II: cAMP phosphodiesterases class-II; InterPro: IPR000396 Cyclic-AMP phosphodiesterase (3 Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>KOG2820|consensus Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>KOG2853|consensus Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>KOG1276|consensus Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>KOG0814|consensus Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>KOG2665|consensus Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>KOG1238|consensus Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>KOG2960|consensus Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PF14597 Lactamase_B_5: Metallo-beta-lactamase superfamily; PDB: 2P97_B Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>COG2015 Alkyl sulfatase and related hydrolases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>KOG4254|consensus Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0685|consensus Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>COG2248 Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>COG5212 PDE1 Low-affinity cAMP phosphodiesterase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2852|consensus Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2415|consensus Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>KOG1800|consensus Back     alignment and domain information
>KOG2820|consensus Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>KOG1137|consensus Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>KOG4716|consensus Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>KOG4736|consensus Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>KOG2311|consensus Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>KOG2404|consensus Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>KOG3923|consensus Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG2844|consensus Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query595
2i7t_A459 Structure Of Human Cpsf-73 Length = 459 2e-25
3af5_A651 The Crystal Structure Of An Archaeal Cpsf Subunit, 3e-15
2xr1_A640 Dimeric Archaeal Cleavage And Polyadenylation Speci 1e-14
2ycb_A636 Structure Of The Archaeal Beta-Casp Protein With N- 3e-14
3ie1_A431 Crystal Structure Of H380a Mutant Ttha0252 From The 4e-14
3ie2_A431 Crystal Structure Of H400v Mutant Ttha0252 From The 5e-14
3iek_A431 Crystal Structure Of Native Ttha0252 From Thermus T 5e-14
3idz_A431 Crystal Structure Of S378q Mutant Ttha0252 From The 5e-14
3ie0_A431 Crystal Structure Of S378y Mutant Ttha0252 From The 5e-14
2dkf_A431 Crystal Structure Of Ttha0252 From Thermus Thermoph 2e-13
3a4y_A431 Crystal Structure Of H61a Mutant Ttha0252 From Ther 6e-13
2x3n_A399 Crystal Structure Of Pqsl, A Probable Fad-Dependent 2e-05
1gpe_A 587 Glucose Oxidase From Penicillium Amagasakiense Leng 5e-04
>pdb|2I7T|A Chain A, Structure Of Human Cpsf-73 Length = 459 Back     alignment and structure 
Iteration: 1

 Score =  114 bits (284), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 62/156 (39%), Positives = 89/156 (57%), Gaps = 11/156 (7%)
Query: 3   EIKVTPLGAGQDVGRSCILVSMGGKNIMLDCGMHMGYHDDRKFPDFKFIAPQGPVTDMID 62
           ++ + PLGAGQ+VGRSCI++   G+ IMLDCG+H G       P    I P       ID
Sbjct: 11  QLLIRPLGAGQEVGRSCIILEFKGRKIMLDCGIHPGLEGMDALPYIDLIDPAE-----ID 65
Query: 63  CLIISHFHLDHCGALPYFTEMFGYAGPIYMTHPTKAIAPILLEDFRKISVEKKGDSNFFT 122
            L+ISHFHLDHCGALP+F +   + G  +MTH TKAI   LL D+ K+S     D   +T
Sbjct: 66  LLLISHFHLDHCGALPWFLQKTSFKGRTFMTHATKAIYRWLLSDYVKVS-NISADDMLYT 124
Query: 123 S---QMNILKIQILKYVMIKGTS--KVWGHSSDDLL 153
               + ++ KI+ + +  +K  +  K W + +  +L
Sbjct: 125 ETDLEESMDKIETINFHEVKEVAGIKFWCYHAGHVL 160
>pdb|3AF5|A Chain A, The Crystal Structure Of An Archaeal Cpsf Subunit, Ph1404 From Pyrococcus Horikoshii Length = 651 Back     alignment and structure
>pdb|2XR1|A Chain A, Dimeric Archaeal Cleavage And Polyadenylation Specificity Factor With N-Terminal Kh Domains (Kh-Cpsf) From Methanosarcina Mazei Length = 640 Back     alignment and structure
>pdb|2YCB|A Chain A, Structure Of The Archaeal Beta-Casp Protein With N-Terminal Kh Domains From Methanothermobacter Thermautotrophicus Length = 636 Back     alignment and structure
>pdb|3IE1|A Chain A, Crystal Structure Of H380a Mutant Ttha0252 From Thermus Thermophilus Hb8 Complexed With Rna Length = 431 Back     alignment and structure
>pdb|3IE2|A Chain A, Crystal Structure Of H400v Mutant Ttha0252 From Thermus Thermophilus Hb8 Length = 431 Back     alignment and structure
>pdb|3IEK|A Chain A, Crystal Structure Of Native Ttha0252 From Thermus Thermophilus Hb8 Length = 431 Back     alignment and structure
>pdb|3IDZ|A Chain A, Crystal Structure Of S378q Mutant Ttha0252 From Thermus Thermophilus Hb8 Length = 431 Back     alignment and structure
>pdb|3IE0|A Chain A, Crystal Structure Of S378y Mutant Ttha0252 From Thermus Thermophilus Hb8 Length = 431 Back     alignment and structure
>pdb|2DKF|A Chain A, Crystal Structure Of Ttha0252 From Thermus Thermophilus Hb8, A Rna Degradation Protein Of The Metallo-Beta-Lactamase Superfamily Length = 431 Back     alignment and structure
>pdb|3A4Y|A Chain A, Crystal Structure Of H61a Mutant Ttha0252 From Thermus Thermophilus Hb8 Length = 431 Back     alignment and structure
>pdb|2X3N|A Chain A, Crystal Structure Of Pqsl, A Probable Fad-Dependent Monooxygenase From Pseudomonas Aeruginosa Length = 399 Back     alignment and structure
>pdb|1GPE|A Chain A, Glucose Oxidase From Penicillium Amagasakiense Length = 587 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query595
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 8e-62
2x3n_A 399 Probable FAD-dependent monooxygenase; oxidoreducta 6e-14
3iek_A431 Ribonuclease TTHA0252; metallo beta lactamase fold 8e-51
3af5_A651 Putative uncharacterized protein PH1404; archaeal 1e-50
2i7t_A459 Cleavage and polyadenylation specificity factor 73 1e-49
2ycb_A636 Beta-CAsp RNAse, cleavage and polyadenylation spec 8e-48
2xr1_A640 Cleavage and polyadenylation specificity factor 1 3e-46
2i7x_A 717 Protein CFT2; polyadenylation, metallo-B-lactamase 3e-29
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 1e-16
1pn0_A665 Phenol 2-monooxygenase; two dimers, TLS refinement 1e-13
2az4_A429 Hypothetical protein EF2904; structural genomics, 3e-13
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 9e-12
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 2e-11
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 3e-11
2dkh_A639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 2e-10
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 2e-10
3bk2_A562 RNAse J, metal dependent hydrolase; endoribonuclea 5e-10
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 6e-10
3zq4_A555 Ribonuclease J 1, RNAse J1; hydrolase, RNA maturat 9e-10
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 3e-09
1zkp_A268 Hypothetical protein BA1088; zinc binding protein, 7e-09
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 8e-09
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 1e-07
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 1e-07
3aj3_A274 MLR6805 protein, 4-pyridoxolactonase; Zn-protein, 2e-07
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 3e-07
3dha_A254 N-acyl homoserine lactone hydrolase; zinc bimetall 5e-07
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 5e-07
2r2d_A276 AGR_PTI_140P, Zn-dependent hydrolases; lactonase, 1e-06
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 1e-06
1vme_A410 Flavoprotein; TM0755, structural genomics, JCSG, p 6e-06
2p4z_A284 Metal-dependent hydrolases of the beta-lactamase s 7e-06
2e7y_A280 TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, 1e-05
3g1p_A258 Protein PHNP; C-P lyase, phosphodiesterase, phosph 1e-05
1k07_A263 FEZ-1 beta-lactamase; monomer with alpha-beta/BETA 2e-05
1y44_A320 Ribonuclease Z; zinc-dependent metal hydrolase, hy 2e-05
2cbn_A306 Ribonuclease Z; phosphodiesterase beta lactamase t 2e-05
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 4e-05
3zwf_A368 Zinc phosphodiesterase ELAC protein 1; beta-lactam 7e-05
3m8t_A294 'BLR6230 protein; subclass B3 beta-lactamase, zinc 8e-05
1sml_A269 Protein (penicillinase); metallo-beta-lactamase, a 1e-04
3esh_A280 Protein similar to metal-dependent hydrolase; stru 1e-04
4ax1_B303 Metallo-beta-lactamase AIM-1; hydrolase, antibioti 2e-04
2vw8_A303 PA1000, PQSE; quinolone signal response protein, s 2e-04
1ztc_A221 Hypothetical protein TM0894; structural genomics, 2e-04
3hnn_A262 Putative diflavin flavoprotein A 5; PSI-2, protein 3e-04
2q9u_A414 A-type flavoprotein; flavodoxin like, beta lactama 4e-04
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 7e-04
3adr_A261 Putative uncharacterized protein ST1585; quorum se 7e-04
3jxp_A321 Coenzyme PQQ synthesis protein B; alpha-beta prote 9e-04
1p9e_A331 Methyl parathion hydrolase; Zn containing; 2.40A { 9e-04
2ohh_A404 Type A flavoprotein FPRA; beta-lactamase like doma 9e-04
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Length = 399 Back     alignment and structure
 Score =  208 bits (532), Expect = 8e-62
 Identities = 47/314 (14%), Positives = 110/314 (35%), Gaps = 38/314 (12%)

Query: 167 YIVENDLIIDAVTKKLNTL-NIDIVYQKKVAHYELPEQPLNNVKIKFESGESIECKLLLG 225
            ++  + +   V +K++    ++++++ ++   +  E+     +++   G  +  ++++G
Sbjct: 102 ILMPCESLRRLVLEKIDGEATVEMLFETRIEAVQRDERHAI-DQVRLNDGRVLRPRVVVG 160

Query: 226 TDGARSQVRNAM-NVQYSNWSYDQKGIVATVKISTSPPNRTAWQRFTPSGTVA-LLPLSD 283
            DG  S VR  + ++      Y    +V T  +                G +A   P+  
Sbjct: 161 ADGIASYVRRRLLDIDVERRPYPSPMLVGTFAL-APCVAERNRLYVDSQGGLAYFYPIGF 219

Query: 284 EFSSLVWATTPENAKALLQMPGESFVDALNSEFNKPAELNESIQVATKFTHNVLEFFNLS 343
           + + LV +   E A+ L+       +      F                           
Sbjct: 220 DRARLVVSFPREEARELMADTRGESLRRRLQRFVGDE----------------------- 256

Query: 344 TGNEQVVPPRVMSVEEKS-RAAFPLGFGHSVRYIGPGCALLGDSAHRIHPLAGQGVNLGF 402
                     + +V   S     P+G+ +  RY     A+LGD+ H +HP+ GQG+NL  
Sbjct: 257 ------SAEAIAAVTGTSRFKGIPIGYLNLDRYWADNVAMLGDAIHNVHPITGQGMNLAI 310

Query: 403 GDIACLVQLSAESVSNGYPIGHPESLTKYESIRQRENLPVMLSIDLMYRVYRSSLTPVKI 462
            D + L      ++ +   +   ++L  Y++ R   N  ++     +             
Sbjct: 311 EDASALADALDLALRDACALE--DALAGYQAERFPVNQAIVSYGHALATSL-EDRQRFAG 367

Query: 463 LGNLGFQLVNAVRP 476
           + +   Q  +    
Sbjct: 368 VFDTALQGSSRTPE 381
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Length = 399 Back     alignment and structure
>3iek_A Ribonuclease TTHA0252; metallo beta lactamase fold, endonuclease, hydrolase, metal- nuclease, RNA-binding, rRNA processing; HET: FLC; 2.05A {Thermus thermophilus} PDB: 2dkf_A* 3iel_A* 3iem_A* 2zdf_A* 3idz_A* 2zdd_A* 3ie0_A* 2zde_A* 3ie1_A* 2zdw_A* 3a4y_A* 2yvd_A* 3ie2_A* Length = 431 Back     alignment and structure
>3af5_A Putative uncharacterized protein PH1404; archaeal CPSF, beta-CAsp family, KH domain, ribonuclease, ME beta-lactamase superfamily, archaea; 2.60A {Pyrococcus horikoshii} PDB: 3af6_A* Length = 651 Back     alignment and structure
>2i7t_A Cleavage and polyadenylation specificity factor 73 kDa subunit; metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination; 2.10A {Homo sapiens} SCOP: d.157.1.10 PDB: 2i7v_A Length = 459 Back     alignment and structure
>2ycb_A Beta-CAsp RNAse, cleavage and polyadenylation specificity factor; hydrolase, KH, metallo-beta-lactamase; 3.10A {Methanothermobacter thermautotrophicusorganism_taxid} Length = 636 Back     alignment and structure
>2xr1_A Cleavage and polyadenylation specificity factor 1 subunit; hydrolase, metallo-beta-lactamase, beta-CAsp, RNA processing; 2.59A {Methanosarcina mazei} Length = 640 Back     alignment and structure
>2i7x_A Protein CFT2; polyadenylation, metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination, double-strand break repair; 2.50A {Saccharomyces cerevisiae} SCOP: d.157.1.10 Length = 717 Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Length = 398 Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Length = 665 Back     alignment and structure
>2az4_A Hypothetical protein EF2904; structural genomics, PSI, protein STR initiative, midwest center for structural genomics, MCSG, U function; 2.00A {Enterococcus faecalis} SCOP: d.157.1.10 Length = 429 Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Length = 499 Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Length = 500 Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Length = 570 Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Length = 639 Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Length = 512 Back     alignment and structure
>3bk2_A RNAse J, metal dependent hydrolase; endoribonuclease, exoribonuclease, metallo-beta-lactamase; HET: U5P; 2.10A {Thermus thermophilus} PDB: 3bk1_A* 3t3o_A* 3t3n_A* Length = 562 Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Length = 549 Back     alignment and structure
>3zq4_A Ribonuclease J 1, RNAse J1; hydrolase, RNA maturation; 3.00A {Bacillus subtilis} Length = 555 Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Length = 394 Back     alignment and structure
>1zkp_A Hypothetical protein BA1088; zinc binding protein, structural genomics, PSI, protein STRU initiative; 1.50A {Bacillus anthracis str} SCOP: d.157.1.9 Length = 268 Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Length = 591 Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Length = 535 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Length = 397 Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Length = 381 Back     alignment and structure
>3aj3_A MLR6805 protein, 4-pyridoxolactonase; Zn-protein, metallo-beta-lactamase, hydrolase; 1.58A {Mesorhizobium loti} PDB: 3aj0_A Length = 274 Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Length = 407 Back     alignment and structure
>3dha_A N-acyl homoserine lactone hydrolase; zinc bimetallohydrolase, quorum quenching; HET: C6L GOL; 0.95A {Bacillus thuringiensis serovar kurstakorganism_taxid} PDB: 3dhb_A* 3dhc_A* 2a7m_A* 2br6_A 2btn_A Length = 254 Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Length = 379 Back     alignment and structure
>2r2d_A AGR_PTI_140P, Zn-dependent hydrolases; lactonase, N-acyl hompserine lactone, DI-nuclear zinc center quenching, AIIB, phosphate; HET: PO4; 1.75A {Agrobacterium tumefaciens} Length = 276 Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421 Back     alignment and structure
>1vme_A Flavoprotein; TM0755, structural genomics, JCSG, protein STR initiative, PSI, joint center for structural genomics, ELEC transport; HET: MSE; 1.80A {Thermotoga maritima} SCOP: c.23.5.1 d.157.1.3 Length = 410 Back     alignment and structure
>2p4z_A Metal-dependent hydrolases of the beta-lactamase superfamily II; metal-dependent hydrolases of the beta-lactamase superfamily hydrolase; 2.10A {Thermoanaerobacter tengcongensis} Length = 284 Back     alignment and structure
>2e7y_A TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.97A {Thermotoga maritima} SCOP: d.157.1.7 PDB: 1ww1_A Length = 280 Back     alignment and structure
>3g1p_A Protein PHNP; C-P lyase, phosphodiesterase, phosphonate utilization, alkylphosphonate uptake; 1.40A {Escherichia coli} PDB: 3p2u_A Length = 258 Back     alignment and structure
>1k07_A FEZ-1 beta-lactamase; monomer with alpha-beta/BETA-alpha fold. two monomers PER AS UNIT., hydrolase; HET: GOL; 1.65A {Fluoribacter gormanii} SCOP: d.157.1.1 PDB: 1jt1_A* 1l9y_A Length = 263 Back     alignment and structure
>1y44_A Ribonuclease Z; zinc-dependent metal hydrolase, hydrolase; HET: MES; 2.10A {Bacillus subtilis} SCOP: d.157.1.7 PDB: 2fk6_A* Length = 320 Back     alignment and structure
>2cbn_A Ribonuclease Z; phosphodiesterase beta lactamase tRNAse Z, hydrolase, metal- binding, endonuclease, tRNA processing, zinc; 2.9A {Escherichia coli} SCOP: d.157.1.7 Length = 306 Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Length = 410 Back     alignment and structure
>3zwf_A Zinc phosphodiesterase ELAC protein 1; beta-lactamase, hydrolase, metal-binding, tRNA processing, zinc-binding, catabolism; 1.70A {Homo sapiens} Length = 368 Back     alignment and structure
>3m8t_A 'BLR6230 protein; subclass B3 beta-lactamase, zinc enzyme, sulfonamide complex hydrolase-hydrolase inhibitor complex; HET: 4NZ; 1.33A {Bradyrhizobium japonicum} PDB: 3lvz_A* 2gmn_A Length = 294 Back     alignment and structure
>1sml_A Protein (penicillinase); metallo-beta-lactamase, antibiotic resistance, binuclear zinc, hydrolase; 1.70A {Stenotrophomonas maltophilia} SCOP: d.157.1.1 PDB: 2aio_A* 2fm6_A 2fu6_A 2fu7_A* 2fu8_A* 2fu9_A* 2gfj_A* 2gfk_A* 2h6a_A 2hb9_A* 2qdt_A* 2qjs_A 2qin_A Length = 269 Back     alignment and structure
>3esh_A Protein similar to metal-dependent hydrolase; structural genomics, PSI-2, protein structure initiative; 2.50A {Staphylococcus aureus subsp} Length = 280 Back     alignment and structure
>4ax1_B Metallo-beta-lactamase AIM-1; hydrolase, antibiotic resistance, acquired B3, drug binding; 1.40A {Pseudomonas aeruginosa} PDB: 4awy_B 4awz_A 4ax0_B Length = 303 Back     alignment and structure
>2vw8_A PA1000, PQSE; quinolone signal response protein, signaling protein, SSPF; 1.45A {Pseudomonas aeruginosa PAO1} PDB: 2q0j_A 2q0i_A 3dh8_A* Length = 303 Back     alignment and structure
>1ztc_A Hypothetical protein TM0894; structural genomics, joint center for structural genomics, J protein structure initiative, PSI, hydrolase; HET: MSE; 2.10A {Thermotoga maritima} SCOP: d.157.1.11 Length = 221 Back     alignment and structure
>2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis} Length = 414 Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Length = 430 Back     alignment and structure
>3adr_A Putative uncharacterized protein ST1585; quorum sensing, quinolone signal, metallo-beta-lactamase FOL conserved hypothetical protein; HET: EPE; 1.80A {Sulfolobus tokodaii} Length = 261 Back     alignment and structure
>3jxp_A Coenzyme PQQ synthesis protein B; alpha-beta protein, PQQ biosynthesis, transport, biosyntheti; 2.20A {Pseudomonas putida} PDB: 1xto_A Length = 321 Back     alignment and structure
>1p9e_A Methyl parathion hydrolase; Zn containing; 2.40A {Pseudomonas SP} SCOP: d.157.1.5 Length = 331 Back     alignment and structure
>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidore; HET: FMN; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 2ohi_A* 2ohj_A* Length = 404 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query595
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 100.0
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 100.0
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 100.0
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 100.0
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 100.0
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 99.97
1pn0_A665 Phenol 2-monooxygenase; two dimers, TLS refinement 99.97
4hb9_A412 Similarities with probable monooxygenase; flavin, 99.97
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 99.96
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 99.96
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 99.96
2dkh_A639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 99.96
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 99.95
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 99.95
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 99.94
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 99.94
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 99.94
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 99.93
3atr_A453 Conserved archaeal protein; saturating double bond 99.93
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 99.92
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 99.92
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 99.91
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 99.88
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 99.88
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 99.86
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 99.85
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 99.85
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 99.78
2bry_A497 NEDD9 interacting protein with calponin homology a 99.59
3iek_A431 Ribonuclease TTHA0252; metallo beta lactamase fold 99.42
2i7t_A459 Cleavage and polyadenylation specificity factor 73 99.39
3zq4_A555 Ribonuclease J 1, RNAse J1; hydrolase, RNA maturat 99.36
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.34
3bk2_A562 RNAse J, metal dependent hydrolase; endoribonuclea 99.33
2az4_A429 Hypothetical protein EF2904; structural genomics, 99.31
2xr1_A640 Cleavage and polyadenylation specificity factor 1 99.3
2cbn_A306 Ribonuclease Z; phosphodiesterase beta lactamase t 99.3
2ycb_A636 Beta-CAsp RNAse, cleavage and polyadenylation spec 99.29
3zwf_A368 Zinc phosphodiesterase ELAC protein 1; beta-lactam 99.28
1y44_A320 Ribonuclease Z; zinc-dependent metal hydrolase, hy 99.23
3af5_A651 Putative uncharacterized protein PH1404; archaeal 99.22
1zkp_A268 Hypothetical protein BA1088; zinc binding protein, 99.22
3g1p_A258 Protein PHNP; C-P lyase, phosphodiesterase, phosph 99.17
2i7x_A 717 Protein CFT2; polyadenylation, metallo-B-lactamase 99.16
2zwr_A207 Metallo-beta-lactamase superfamily protein; hydrol 99.15
3dha_A254 N-acyl homoserine lactone hydrolase; zinc bimetall 99.14
3aj3_A274 MLR6805 protein, 4-pyridoxolactonase; Zn-protein, 99.14
3md7_A293 Beta-lactamase-like; ssgcid, hydrolase, structural 99.12
3jxp_A321 Coenzyme PQQ synthesis protein B; alpha-beta prote 99.12
3m8t_A294 'BLR6230 protein; subclass B3 beta-lactamase, zinc 99.06
3adr_A261 Putative uncharacterized protein ST1585; quorum se 99.05
1k07_A263 FEZ-1 beta-lactamase; monomer with alpha-beta/BETA 99.03
2xf4_A210 Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A 99.02
1sml_A269 Protein (penicillinase); metallo-beta-lactamase, a 99.0
1ztc_A221 Hypothetical protein TM0894; structural genomics, 98.99
2p4z_A284 Metal-dependent hydrolases of the beta-lactamase s 98.99
3esh_A280 Protein similar to metal-dependent hydrolase; stru 98.98
4ax1_B303 Metallo-beta-lactamase AIM-1; hydrolase, antibioti 98.95
2qed_A258 Hydroxyacylglutathione hydrolase; metallo-B- super 98.93
3iog_A227 Beta-lactamase; hydrolase, antibiotic resistance, 98.92
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 98.91
2r2d_A276 AGR_PTI_140P, Zn-dependent hydrolases; lactonase, 98.91
2zo4_A317 Metallo-beta-lactamase family protein; hydrolase; 98.9
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 98.9
3rp8_A 407 Flavoprotein monooxygenase; FAD-binding protein, o 98.88
3q6v_A233 Beta-lactamase; metalloenzyme, alpha-beta, hydrola 98.88
4dik_A410 Flavoprotein; TM0755, electron transport, DI-iron 98.87
4efz_A298 Metallo-beta-lactamase family protein; structural 98.86
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.86
1p9e_A331 Methyl parathion hydrolase; Zn containing; 2.40A { 98.84
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 98.84
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 98.84
1qh5_A260 Glyoxalase II, protein (hydroxyacylglutathione hyd 98.83
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.81
2vw8_A303 PA1000, PQSE; quinolone signal response protein, s 98.81
2gcu_A245 Putative hydroxyacylglutathione hydrolase 3; ethyl 98.81
3r2u_A466 Metallo-beta-lactamase family protein; structural 98.81
1xm8_A254 Glyoxalase II; structural genomics, protein struct 98.8
4hl2_A243 Beta-lactamase NDM-1; structural genomics, PSI-bio 98.8
4eyb_A270 Beta-lactamase NDM-1; metallo beta lactamase, anti 98.78
2bib_A547 CBPE, teichoic acid phosphorylcholine esterase/ ch 98.77
3l6n_A219 Metallo-beta-lactamase; zinc, hydolase, antibiotic 98.76
3c96_A 410 Flavin-containing monooxygenase; FAD, oxidoreducta 98.76
2p18_A311 Glyoxalase II; metalloprotein, beta sandwich, alph 98.76
1e5d_A402 Rubredoxin\:oxygen oxidoreductase; oxygenreductase 98.76
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 98.75
1m2x_A223 Class B carbapenemase BLAB-1; alpha-beta/BETA-alph 98.74
3hnn_A262 Putative diflavin flavoprotein A 5; PSI-2, protein 98.74
1jjt_A228 IMP-1 metallo beta-lactamase; metallo-beta-lactama 98.74
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 98.72
3alj_A 379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.72
2x3n_A 399 Probable FAD-dependent monooxygenase; oxidoreducta 98.7
1a7t_A232 Metallo-beta-lactamase; hydrolase (beta-lactamase) 98.7
3kl7_A235 Putative metal-dependent hydrolase; structural gen 98.69
4ad9_A289 Lactb2, beta-lactamase-like protein 2; hydrolase, 98.69
1mqo_A227 Beta-lactamase II; alpha-beta/BETA-alpha fold, hyd 98.69
1k0i_A 394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.69
2y8b_A265 Metallo-B-lactamase; hydrolase, cephalosporins, an 98.67
2ohh_A404 Type A flavoprotein FPRA; beta-lactamase like doma 98.65
2vou_A 397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.64
2e7y_A280 TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, 98.63
3rpc_A264 Possible metal-dependent hydrolase; structural gen 98.62
1ycg_A398 Nitric oxide reductase; DIIRON site, oxidoreductas 98.62
2fhx_A246 SPM-1; metallo-beta-lactamase, dinuclear zinc, ant 98.62
3oz2_A 397 Digeranylgeranylglycerophospholipid reductase; str 98.62
3nix_A 421 Flavoprotein/dehydrogenase; structural genomics, P 98.61
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.58
2q9u_A414 A-type flavoprotein; flavodoxin like, beta lactama 98.57
4hb9_A 412 Similarities with probable monooxygenase; flavin, 98.5
3h3e_A267 Uncharacterized protein TM1679; structural genomic 98.48
2p97_A201 Hypothetical protein; putative metal-dependent hyd 98.47
2xdo_A 398 TETX2 protein; tetracycline degradation, tigecycli 98.45
3bv6_A379 Metal-dependent hydrolase; metallo protein, beta-l 98.43
2wyl_A360 L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 98.42
2pyx_A 526 Tryptophan halogenase; structural genomics, JOI fo 98.41
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.41
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 98.4
3kkj_A 336 Amine oxidase, flavin-containing; oxidoreductase, 98.33
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 98.33
2cfu_A658 SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1 98.31
3cgv_A 397 Geranylgeranyl reductase related protein; NP_39399 98.3
2yhe_A668 SEC-alkyl sulfatase; hydrolase, inversion, metallo 97.63
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 98.27
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 98.24
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 98.21
2bry_A 497 NEDD9 interacting protein with calponin homology a 98.17
3atr_A 453 Conserved archaeal protein; saturating double bond 98.12
1vjn_A220 Zn-dependent hydrolase of metallo-beta-lactamase s 98.03
4fk1_A 304 Putative thioredoxin reductase; structural genomic 98.03
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 97.96
3ihm_A 430 Styrene monooxygenase A; rossman fold, anti-parall 97.96
3fpz_A 326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 97.92
4gcm_A 312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 97.9
3jsk_A 344 Cypbp37 protein; octameric thiazole synthase, bios 97.9
1c0p_A 363 D-amino acid oxidase; alpha-beta-alpha motif, flav 97.88
3v76_A 417 Flavoprotein; structural genomics, PSI-biology, NE 97.88
3c4a_A 381 Probable tryptophan hydroxylase VIOD; alpha-beta p 97.88
1yvv_A 336 Amine oxidase, flavin-containing; oxidoreductase, 97.84
2ivd_A 478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 97.82
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 97.81
3i6d_A 470 Protoporphyrinogen oxidase; protein-inhibitor comp 97.78
2cul_A 232 Glucose-inhibited division protein A-related PROT 97.78
1rp0_A 284 ARA6, thiazole biosynthetic enzyme; protein ligand 97.77
3dme_A 369 Conserved exported protein; structural genomics, P 97.73
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 97.73
1ryi_A 382 Glycine oxidase; flavoprotein, protein-inhibitor c 97.73
2oln_A 397 NIKD protein; flavoprotein, rossmann fold, oxidore 97.72
4a5l_A 314 Thioredoxin reductase; oxidoreductase, redox metab 97.71
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 97.7
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 97.69
2gqf_A 401 Hypothetical protein HI0933; structural genomics, 97.65
3lov_A 475 Protoporphyrinogen oxidase; structural genomics, J 97.65
2i0z_A 447 NAD(FAD)-utilizing dehydrogenases; structural geno 97.65
4gde_A 513 UDP-galactopyranose mutase; flavin adenine dinucle 97.64
2gag_B 405 Heterotetrameric sarcosine oxidase beta-subunit; f 97.64
4b87_A367 DNA cross-LINK repair 1A protein; dclre1A, DCLRE, 97.64
1y56_B 382 Sarcosine oxidase; dehydrogenase, protein-protein 97.64
2e1m_A 376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 97.64
3p1w_A 475 Rabgdi protein; GDI RAB, malaria, structural genom 97.63
2uzz_A 372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 97.62
3dje_A 438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 97.62
1sez_A 504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 97.62
2gf3_A 389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 97.61
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 97.61
2yg5_A 453 Putrescine oxidase; oxidoreductase, flavin; HET: F 97.61
3zdk_A336 5' exonuclease apollo; hydrolase; HET: TLA; 2.16A 97.6
2gjc_A 326 Thiazole biosynthetic enzyme, mitochondrial; gluta 97.59
2vvm_A 495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 97.59
3qj4_A 342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 97.58
2ywl_A180 Thioredoxin reductase related protein; uncharacter 97.57
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 97.55
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 97.52
1qo8_A 566 Flavocytochrome C3 fumarate reductase; oxidoreduct 97.52
3g3e_A 351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 97.52
3nks_A 477 Protoporphyrinogen oxidase; FAD containing protein 97.5
2bcg_G 453 Secretory pathway GDP dissociation inhibitor; RABG 97.5
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 97.5
2zbw_A 335 Thioredoxin reductase; redox protein, oxidoreducta 97.49
3nyc_A 381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 97.49
2ywl_A180 Thioredoxin reductase related protein; uncharacter 97.49
4a9w_A 357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 97.48
3k7m_X 431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 97.48
3urh_A 491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 97.47
2jae_A 489 L-amino acid oxidase; oxidoreductase, dimerisation 97.47
4at0_A 510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 97.46
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 97.46
3nlc_A 549 Uncharacterized protein VP0956; FAD-binding protei 97.45
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 97.42
3hdq_A 397 UDP-galactopyranose mutase; substrate and inhibito 97.41
3ka7_A 425 Oxidoreductase; structural genomics, PSI-2, protei 97.41
3ab1_A 360 Ferredoxin--NADP reductase; oxidoreductase, electr 97.41
3d1c_A 369 Flavin-containing putative monooxygenase; NP_37310 97.4
3itj_A 338 Thioredoxin reductase 1; disulfide B flavoprotein, 97.4
3axb_A 448 Putative oxidoreductase; dinucleotide-binding fold 97.4
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 97.39
3fbs_A 297 Oxidoreductase; structural genomics, PSI2, MCSG, p 97.39
3cty_A 319 Thioredoxin reductase; FAD, oxidoreductase, flavin 97.39
1rsg_A 516 FMS1 protein; FAD binding motif, oxidoreductase; H 97.39
1y0p_A 571 Fumarate reductase flavoprotein subunit; flavocyto 97.37
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 97.36
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 97.35
3o0h_A 484 Glutathione reductase; ssgcid, structur genomics, 97.35
2q7v_A 325 Thioredoxin reductase; rossman fold, FAD, flavopro 97.35
3nrn_A 421 Uncharacterized protein PF1083; alpha-beta protein 97.33
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 97.33
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 97.32
3f8d_A 323 Thioredoxin reductase (TRXB-3); redox protein, nuc 97.32
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 97.31
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 97.31
1d5t_A 433 Guanine nucleotide dissociation inhibitor; ultra-h 97.3
4dna_A 463 Probable glutathione reductase; structural genomic 97.3
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 97.3
1v59_A 478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 97.29
3lzw_A 332 Ferredoxin--NADP reductase 2; ferredoxin reductase 97.29
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 97.29
3ic9_A 492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 97.28
1trb_A 320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 97.28
3lad_A 476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.27
2a8x_A 464 Dihydrolipoyl dehydrogenase, E3 component of alpha 97.26
1vdc_A 333 NTR, NADPH dependent thioredoxin reductase; hypoth 97.26
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 97.25
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 97.24
2gv8_A 447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 97.24
3t37_A 526 Probable dehydrogenase; BET alpha beta fold, ADP b 97.23
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 97.23
2b9w_A 424 Putative aminooxidase; isomerase, conjugated linol 97.23
1s3e_A 520 Amine oxidase [flavin-containing] B; human monoami 97.23
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 97.22
3l8k_A 466 Dihydrolipoyl dehydrogenase; redox-active center, 97.22
3c4n_A 405 Uncharacterized protein DR_0571; alpha-beta protei 97.22
2iid_A 498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 97.21
1i8t_A 367 UDP-galactopyranose mutase; rossman fold, FAD, con 97.18
3g5s_A 443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 97.18
2bi7_A 384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 97.17
2q0l_A 311 TRXR, thioredoxin reductase; bacterial thiredoxin 97.17
3qfa_A 519 Thioredoxin reductase 1, cytoplasmic; protein-prot 97.15
3dk9_A 478 Grase, GR, glutathione reductase; flavoenzyme, nic 97.14
1fl2_A 310 Alkyl hydroperoxide reductase subunit F; reactive 97.13
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 97.11
2a87_A 335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 97.11
3qvp_A 583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 97.11
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 97.1
2hqm_A 479 GR, grase, glutathione reductase; glutathione redu 97.09
1kdg_A 546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 97.09
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 97.08
3s5w_A 463 L-ornithine 5-monooxygenase; class B flavin depend 97.07
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 97.07
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 97.07
1ojt_A 482 Surface protein; redox-active center, glycolysis, 97.06
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 97.06
1mo9_A 523 ORF3; nucleotide binding motifs, nucleotide bindin 97.05
1dxl_A 470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 97.05
2qae_A 468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 97.04
1zmd_A 474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 97.04
2e5v_A 472 L-aspartate oxidase; archaea, oxidoreductase; HET: 97.02
3dgz_A 488 Thioredoxin reductase 2; oxidoreductase, rossmann, 97.02
2eq6_A 464 Pyruvate dehydrogenase complex, dihydrolipoamide d 97.01
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 97.01
1ges_A 450 Glutathione reductase; oxidoreductase(flavoenzyme) 97.0
3dme_A369 Conserved exported protein; structural genomics, P 97.0
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 97.0
2cul_A232 Glucose-inhibited division protein A-related PROT 97.0
2r9z_A 463 Glutathione amide reductase; NAD, FAD, substrate s 97.0
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 96.99
1onf_A 500 GR, grase, glutathione reductase; oxidoreductase; 96.99
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 96.98
3r9u_A 315 Thioredoxin reductase; structural genomics, center 96.98
2yqu_A 455 2-oxoglutarate dehydrogenase E3 component; lipoami 96.97
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 96.97
1zk7_A 467 HGII, reductase, mercuric reductase; mercuric ION 96.96
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 96.96
3dgh_A 483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 96.95
1v0j_A 399 UDP-galactopyranose mutase; flavoprotein, isomeras 96.95
4dsg_A 484 UDP-galactopyranose mutase; rossmann fold, flavin 96.95
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 96.94
1ebd_A 455 E3BD, dihydrolipoamide dehydrogenase; redox-active 96.91
1lvl_A 458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 96.85
1fec_A 490 Trypanothione reductase; redox-active center, oxid 96.84
2vdc_G 456 Glutamate synthase [NADPH] small chain; oxidoreduc 96.82
3fim_B 566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 96.82
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thi 96.8
4b1b_A 542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 96.8
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 96.8
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 96.8
1d4d_A 572 Flavocytochrome C fumarate reductase; oxidoreducta 96.76
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 96.75
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 96.74
1ju2_A 536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 96.74
3lxd_A 415 FAD-dependent pyridine nucleotide-disulphide oxido 96.73
1q1r_A 431 Putidaredoxin reductase; glutathione reductase fol 96.73
3h28_A 430 Sulfide-quinone reductase; monotopic membrane prot 96.69
1gpe_A 587 Protein (glucose oxidase); oxidoreductase(flavopro 96.68
2wpf_A 495 Trypanothione reductase; oxidoreductase, trypanoso 96.68
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 96.65
2v3a_A 384 Rubredoxin reductase; alkane degradation, NADH oxi 96.64
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 96.63
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 96.63
2bc0_A 490 NADH oxidase; flavoprotein, pyridine nucleotide di 96.63
3h8l_A 409 NADH oxidase; membrane protein, complete form, ros 96.59
4gut_A 776 Lysine-specific histone demethylase 1B; histone de 96.59
1xhc_A 367 NADH oxidase /nitrite reductase; southe collaborat 96.57
1b37_A 472 Protein (polyamine oxidase); flavin-dependent amin 96.57
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 96.56
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 96.54
1xdi_A 499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 96.54
2gqf_A401 Hypothetical protein HI0933; structural genomics, 96.54
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 96.53
1n4w_A 504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 96.53
1o94_A 729 Tmadh, trimethylamine dehydrogenase; electron tran 96.52
1coy_A 507 Cholesterol oxidase; oxidoreductase(oxygen recepto 96.48
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 96.45
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 96.44
2jbv_A 546 Choline oxidase; alcohol oxidation, flavoenyzme ox 96.43
3fg2_P 404 Putative rubredoxin reductase; ferredoxin reductas 96.42
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 96.4
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 96.36
2gqw_A 408 Ferredoxin reductase; flavoprotein, oxidoreductase 96.33
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 96.33
3oc4_A 452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 96.31
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 96.31
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 96.31
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 96.3
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 96.24
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 96.21
3ef6_A 410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 96.2
2cdu_A 452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 96.2
3cgb_A 480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 96.19
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 96.18
3klj_A 385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 96.17
1m6i_A 493 Programmed cell death protein 8; apoptosis, AIF, o 96.15
1cjc_A 460 Protein (adrenodoxin reductase); flavoenzyme, MAD 96.14
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 96.1
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 96.09
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 95.97
1lqt_A 456 FPRA; NADP+ derivative, oxidoreductase, structural 95.96
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 95.93
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 95.91
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 95.89
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 95.86
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 95.85
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 95.83
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 95.82
1nhp_A 447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 95.79
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 95.79
4g6h_A 502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 95.74
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 95.67
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 95.55
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 95.54
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 95.51
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 95.49
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 95.49
4eqs_A 437 Coenzyme A disulfide reductase; oxidoreductase; HE 95.48
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 95.43
3vrd_B 401 FCCB subunit, flavocytochrome C flavin subunit; su 95.42
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 95.37
4b63_A 501 L-ornithine N5 monooxygenase; oxidoreductase, side 95.3
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 95.29
2zxi_A637 TRNA uridine 5-carboxymethylaminomethyl modificat 95.28
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 95.23
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 95.21
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 95.21
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 95.0
4gut_A776 Lysine-specific histone demethylase 1B; histone de 94.99
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 94.95
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 94.92
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 94.78
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 94.67
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 94.58
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 94.5
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 94.39
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 94.33
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 94.26
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 94.21
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 94.18
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 94.03
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 94.01
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 93.93
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 93.9
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 93.83
3klj_A 385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 93.77
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 93.76
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 93.75
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 93.66
1nhp_A 447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 93.57
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 93.53
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 93.48
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 93.46
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 93.45
1kf6_A602 Fumarate reductase flavoprotein; respiration, fuma 93.37
1fec_A490 Trypanothione reductase; redox-active center, oxid 93.36
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 93.31
1lss_A140 TRK system potassium uptake protein TRKA homolog; 93.31
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 93.22
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 93.21
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 93.13
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 93.1
1id1_A153 Putative potassium channel protein; RCK domain, E. 93.08
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 93.05
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 93.04
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 92.96
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 92.94
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 92.91
1lvl_A 458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 92.88
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 92.77
1xhc_A 367 NADH oxidase /nitrite reductase; southe collaborat 92.76
2gqw_A 408 Ferredoxin reductase; flavoprotein, oxidoreductase 92.6
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 92.59
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 92.56
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 92.55
4eqs_A 437 Coenzyme A disulfide reductase; oxidoreductase; HE 92.44
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 92.34
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 92.31
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 92.29
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 92.11
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 92.0
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 91.89
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 91.77
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 91.61
2bc0_A 490 NADH oxidase; flavoprotein, pyridine nucleotide di 91.44
3cgb_A 480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 91.42
4g65_A 461 TRK system potassium uptake protein TRKA; structur 91.39
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 91.33
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 91.23
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 91.2
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 91.18
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 91.05
4g6h_A 502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 90.92
1ojt_A482 Surface protein; redox-active center, glycolysis, 90.82
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 90.75
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 90.41
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 90.34
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 90.11
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 89.92
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 89.59
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 89.56
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 89.56
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 89.45
4dna_A463 Probable glutathione reductase; structural genomic 89.37
3dk9_A 478 Grase, GR, glutathione reductase; flavoenzyme, nic 89.32
2wdq_A588 Succinate dehydrogenase flavoprotein subunit; succ 89.12
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 88.89
3tl2_A 315 Malate dehydrogenase; center for structural genomi 88.76
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 88.58
3l4b_C 218 TRKA K+ channel protien TM1088B; potassium channel 88.49
3ado_A 319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 88.48
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 88.48
2h88_A621 Succinate dehydrogenase flavoprotein subunit; comp 88.41
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 88.24
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 88.09
3dfz_A 223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 87.99
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 87.98
1f0y_A 302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 87.69
3i83_A 320 2-dehydropantoate 2-reductase; structural genomics 87.64
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 87.56
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 87.53
3gvi_A 324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 87.51
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 87.32
1pzg_A 331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 87.31
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 87.24
2hjr_A 328 Malate dehydrogenase; malaria, structural genomics 87.07
1kyq_A 274 Met8P, siroheme biosynthesis protein Met8; homodim 86.95
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 86.8
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 86.66
3dtt_A 245 NADP oxidoreductase; structural genomics, joint ce 86.55
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 86.47
3hn2_A 312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 86.12
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 86.04
3qfa_A 519 Thioredoxin reductase 1, cytoplasmic; protein-prot 86.01
3ghy_A 335 Ketopantoate reductase protein; oxidoreductase, NA 85.65
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 85.64
4e12_A 283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 85.53
3l8k_A 466 Dihydrolipoyl dehydrogenase; redox-active center, 85.49
2raf_A 209 Putative dinucleotide-binding oxidoreductase; NP_7 85.33
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 85.28
3p7m_A 321 Malate dehydrogenase; putative dehydrogenase, enzy 85.24
1lld_A 319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 85.04
2v6b_A 304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 84.68
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 84.64
1ks9_A 291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 84.35
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 84.25
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 84.18
1jw9_B 249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 83.95
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 83.86
1y6j_A 318 L-lactate dehydrogenase; southeast collaboratory f 83.72
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 83.48
1t2d_A 322 LDH-P, L-lactate dehydrogenase; ternary complex, o 83.46
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 83.45
2ewd_A 317 Lactate dehydrogenase,; protein-substrate_cofactor 82.93
3pqe_A 326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 82.92
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 82.86
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 82.86
4dio_A 405 NAD(P) transhydrogenase subunit alpha PART 1; stru 82.78
3g17_A 294 Similar to 2-dehydropantoate 2-reductase; structur 82.46
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 82.33
1vg0_A650 RAB proteins geranylgeranyltransferase component A 82.31
1cjc_A 460 Protein (adrenodoxin reductase); flavoenzyme, MAD 82.24
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 82.04
3ego_A 307 Probable 2-dehydropantoate 2-reductase; structural 81.97
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 81.97
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 81.93
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
Probab=100.00  E-value=3.3e-33  Score=295.03  Aligned_cols=286  Identities=19%  Similarity=0.181  Sum_probs=217.4

Q ss_pred             ccceeeeHHHHHHHHHHHHhcCCceEEeCCeEeEEecCCCCCCceEEEEcCCc---EEEecEEEEecCCCchhhhhcCCC
Q psy9964         164 RISYIVENDLIIDAVTKKLNTLNIDIVYQKKVAHYELPEQPLNNVKIKFESGE---SIECKLLLGTDGARSQVRNAMNVQ  240 (595)
Q Consensus       164 ~~~~~i~R~~L~~~L~~~~~~~gv~i~~~~~v~~v~~~~~~~~~v~v~~~dG~---~~~adlvVgADG~~S~vR~~l~~~  240 (595)
                      ++++.++|..|++.|.+.+.+.|++|+++++|+++++   ++++|+|++++|+   ++++|+||||||.+|.||++++++
T Consensus        98 ~~~~~i~~~~l~~~L~~~~~~~gv~v~~~~~v~~i~~---~~~~v~v~~~~~~g~~~~~a~~vVgADG~~S~VR~~lg~~  174 (500)
T 2qa1_A           98 QAAKTVPQSVTETHLEQWATGLGADIRRGHEVLSLTD---DGAGVTVEVRGPEGKHTLRAAYLVGCDGGRSSVRKAAGFD  174 (500)
T ss_dssp             GCEEEEEHHHHHHHHHHHHHHTTCEEEETCEEEEEEE---ETTEEEEEEEETTEEEEEEESEEEECCCTTCHHHHHTTCC
T ss_pred             CceeecCHHHHHHHHHHHHHHCCCEEECCcEEEEEEE---cCCeEEEEEEcCCCCEEEEeCEEEECCCcchHHHHHcCCC
Confidence            4578999999999999999988999999999999986   4668999998886   899999999999999999999988


Q ss_pred             CcccCCCCeEEEEEEEeccCCCCceEEEEeCCCCcEEEeeCCCCCeEEEEecCHhh-HHHHhCCCchHHHHHHHHhcCCC
Q psy9964         241 YSNWSYDQKGIVATVKISTSPPNRTAWQRFTPSGTVALLPLSDEFSSLVWATTPEN-AKALLQMPGESFVDALNSEFNKP  319 (595)
Q Consensus       241 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~p~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~  319 (595)
                      .....+...++.+.+....++ .. ....+.++++++++|.+++..++++...... .......+.+++.+.+...+...
T Consensus       175 ~~~~~~~~~~~~~~~~~~~~~-~~-~~~~~~~~g~~~~~p~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~  252 (500)
T 2qa1_A          175 FPGTAATMEMYLADIKGVELQ-PR-MIGETLPGGMVMVGPLPGGITRIIVCERGTPPQRRETPPSWHEVADAWKRLTGDD  252 (500)
T ss_dssp             CCEECCCCEEEEEEEESCCCC-CE-EEEEEETTEEEEEEEETTTEEEEEEEETTCCC-----CCCHHHHHHHHHHHHSCC
T ss_pred             cCCCccceEEEEEEEEeCCCC-Cc-eEEEECCCcEEEEEEcCCCEEEEEEEcCCCCCccccCCCCHHHHHHHHHHhcCCC
Confidence            777677667777777654322 21 2334567889999999988777776643221 11112234444444433322110


Q ss_pred             cchhhHHHHhhhhhhchhhhccccCCCcccCCCccceeccccceeeeccccccccccCCCEEEEccccccccCccchhhh
Q psy9964         320 AELNESIQVATKFTHNVLEFFNLSTGNEQVVPPRVMSVEEKSRAAFPLGFGHSVRYIGPGCALLGDSAHRIHPLAGQGVN  399 (595)
Q Consensus       320 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~grvvLvGDAAH~~~P~~GqG~n  399 (595)
                                                    +.  +..  ..+...|+.....+++|..|||+|+|||||.|+|++|||+|
T Consensus       253 ------------------------------~~--~~~--~~~~~~~~~~~~~a~~~~~grv~L~GDAAH~~~P~~GqG~n  298 (500)
T 2qa1_A          253 ------------------------------IA--HAE--PVWVSAFGNATRQVTEYRRGRVILAGDSAHIHLPAGGQGMN  298 (500)
T ss_dssp             ------------------------------CT--TSE--EEEEEEEECCEEECSCSEETTEEECGGGTEECCCCSSCHHH
T ss_pred             ------------------------------CC--ccc--eeEEEEeccCcEEccccccCCEEEEEccccCCCCccccchh
Confidence                                          00  000  11223466666678899999999999999999999999999


Q ss_pred             hchHHHHHHHHHHHHhhhCCCCCCChHHHHHHHHHhhhccchHHHHHHHHHHhhcCCchHHHHHHHHHHHhhccChhHHH
Q psy9964         400 LGFGDIACLVQLSAESVSNGYPIGHPESLTKYESIRQRENLPVMLSIDLMYRVYRSSLTPVKILGNLGFQLVNAVRPIKS  479 (595)
Q Consensus       400 ~Al~Da~~La~~L~~~~~~~~~~~~~~~L~~Y~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~  479 (595)
                      +||+||.+|+++|...+. +..  .+.+|+.|+++|++++..++..++.+.+++.. ++....+|+.++..+ ..|.+++
T Consensus       299 ~gi~DA~~La~~La~~~~-g~~--~~~~L~~Y~~eR~~~~~~~~~~s~~~~~l~~~-~~~~~~~R~~~~~~~-~~~~~~~  373 (500)
T 2qa1_A          299 TSIQDAVNLGWKLGAVVN-GTA--TEELLDSYHSERHAVGKRLLMNTQAQGLLFLS-GPEVQPLRDVLTELI-QYGEVAR  373 (500)
T ss_dssp             HHHHHHHHHHHHHHHHHT-TSS--CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHS-CGGGHHHHHHHHHHH-TSHHHHH
T ss_pred             hhHHHHHHHHHHHHHHHc-CCC--ChHHHHHHHHHHHHHHHHHHHHHHHHHHHhcC-CchHHHHHHHHHHhh-cCHHHHH
Confidence            999999999999987664 333  57899999999999999999999999998875 566678898887766 6888888


Q ss_pred             HHHHHHHHHhhhhh
Q psy9964         480 ILCDIFMRTSMEKV  493 (595)
Q Consensus       480 ~~~~~~~~~~~~~~  493 (595)
                      .+.+.+++....|.
T Consensus       374 ~~~~~~~g~~~~Y~  387 (500)
T 2qa1_A          374 HLAGMVSGLEITYD  387 (500)
T ss_dssp             HHHHHHHSTTCCCC
T ss_pred             HHhhhhccCCCccC
Confidence            88888877665554
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3iek_A Ribonuclease TTHA0252; metallo beta lactamase fold, endonuclease, hydrolase, metal- nuclease, RNA-binding, rRNA processing; HET: FLC; 2.05A {Thermus thermophilus} SCOP: d.157.1.10 PDB: 2dkf_A* 3iel_A* 3iem_A* 2zdf_A* 3idz_A* 2zdd_A* 3ie0_A* 2zde_A* 3ie1_A* 2zdw_A* 3a4y_A* 2yvd_A* 3ie2_A* Back     alignment and structure
>2i7t_A Cleavage and polyadenylation specificity factor 73 kDa subunit; metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination; 2.10A {Homo sapiens} SCOP: d.157.1.10 PDB: 2i7v_A Back     alignment and structure
>3zq4_A Ribonuclease J 1, RNAse J1; hydrolase, RNA maturation; 3.00A {Bacillus subtilis} Back     alignment and structure
>3bk2_A RNAse J, metal dependent hydrolase; endoribonuclease, exoribonuclease, metallo-beta-lactamase; HET: U5P; 2.10A {Thermus thermophilus} PDB: 3bk1_A* 3t3o_A* 3t3n_A* Back     alignment and structure
>2az4_A Hypothetical protein EF2904; structural genomics, PSI, protein STR initiative, midwest center for structural genomics, MCSG, U function; 2.00A {Enterococcus faecalis} SCOP: d.157.1.10 Back     alignment and structure
>2xr1_A Cleavage and polyadenylation specificity factor 1 subunit; hydrolase, metallo-beta-lactamase, beta-CAsp, RNA processing; 2.59A {Methanosarcina mazei} Back     alignment and structure
>2cbn_A Ribonuclease Z; phosphodiesterase beta lactamase tRNAse Z, hydrolase, metal- binding, endonuclease, tRNA processing, zinc; 2.9A {Escherichia coli} SCOP: d.157.1.7 Back     alignment and structure
>2ycb_A Beta-CAsp RNAse, cleavage and polyadenylation specificity factor; hydrolase, KH, metallo-beta-lactamase; 3.10A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>3zwf_A Zinc phosphodiesterase ELAC protein 1; beta-lactamase, hydrolase, metal-binding, tRNA processing, zinc-binding, catabolism; 1.70A {Homo sapiens} Back     alignment and structure
>1y44_A Ribonuclease Z; zinc-dependent metal hydrolase, hydrolase; HET: MES; 2.10A {Bacillus subtilis} SCOP: d.157.1.7 PDB: 2fk6_A* Back     alignment and structure
>3af5_A Putative uncharacterized protein PH1404; archaeal CPSF, beta-CAsp family, KH domain, ribonuclease, ME beta-lactamase superfamily, archaea; 2.60A {Pyrococcus horikoshii} PDB: 3af6_A* Back     alignment and structure
>1zkp_A Hypothetical protein BA1088; zinc binding protein, structural genomics, PSI, protein STRU initiative; 1.50A {Bacillus anthracis str} SCOP: d.157.1.9 Back     alignment and structure
>3g1p_A Protein PHNP; C-P lyase, phosphodiesterase, phosphonate utilization, alkylphosphonate uptake; 1.40A {Escherichia coli} PDB: 3p2u_A Back     alignment and structure
>2i7x_A Protein CFT2; polyadenylation, metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination, double-strand break repair; 2.50A {Saccharomyces cerevisiae} SCOP: d.157.1.10 Back     alignment and structure
>2zwr_A Metallo-beta-lactamase superfamily protein; hydrolase; 2.20A {Thermus thermophilus} PDB: 2zzi_A Back     alignment and structure
>3dha_A N-acyl homoserine lactone hydrolase; zinc bimetallohydrolase, quorum quenching; HET: C6L GOL; 0.95A {Bacillus thuringiensis serovar kurstakorganism_taxid} PDB: 3dhb_A* 3dhc_A* 2a7m_A* 2br6_A 2btn_A Back     alignment and structure
>3aj3_A MLR6805 protein, 4-pyridoxolactonase; Zn-protein, metallo-beta-lactamase, hydrolase; 1.58A {Mesorhizobium loti} PDB: 3aj0_A Back     alignment and structure
>3md7_A Beta-lactamase-like; ssgcid, hydrolase, structural genomics, structural genomics center for infectious disease; HET: 5GP TLA; 1.27A {Brucella melitensis biovar abortus} PDB: 3qh8_A* 3py6_A* 3py5_A* Back     alignment and structure
>3jxp_A Coenzyme PQQ synthesis protein B; alpha-beta protein, PQQ biosynthesis, transport, biosyntheti; 2.20A {Pseudomonas putida} SCOP: d.157.1.6 PDB: 1xto_A Back     alignment and structure
>3m8t_A 'BLR6230 protein; subclass B3 beta-lactamase, zinc enzyme, sulfonamide complex hydrolase-hydrolase inhibitor complex; HET: 4NZ; 1.33A {Bradyrhizobium japonicum} PDB: 3lvz_A* 2gmn_A Back     alignment and structure
>3adr_A Putative uncharacterized protein ST1585; quorum sensing, quinolone signal, metallo-beta-lactamase FOL conserved hypothetical protein; HET: EPE; 1.80A {Sulfolobus tokodaii} Back     alignment and structure
>1k07_A FEZ-1 beta-lactamase; monomer with alpha-beta/BETA-alpha fold. two monomers PER AS UNIT., hydrolase; HET: GOL; 1.65A {Fluoribacter gormanii} SCOP: d.157.1.1 PDB: 1jt1_A* 1l9y_A Back     alignment and structure
>2xf4_A Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A {Salmonella enterica} Back     alignment and structure
>1sml_A Protein (penicillinase); metallo-beta-lactamase, antibiotic resistance, binuclear zinc, hydrolase; 1.70A {Stenotrophomonas maltophilia} SCOP: d.157.1.1 PDB: 2aio_A* 2fm6_A 2fu6_A 2fu7_A* 2fu8_A* 2fu9_A* 2gfj_A* 2gfk_A* 2h6a_A 2hb9_A* 2qdt_A* 2qjs_A 2qin_A Back     alignment and structure
>1ztc_A Hypothetical protein TM0894; structural genomics, joint center for structural genomics, J protein structure initiative, PSI, hydrolase; HET: MSE; 2.10A {Thermotoga maritima} SCOP: d.157.1.11 Back     alignment and structure
>2p4z_A Metal-dependent hydrolases of the beta-lactamase superfamily II; metal-dependent hydrolases of the beta-lactamase superfamily hydrolase; 2.10A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>3esh_A Protein similar to metal-dependent hydrolase; structural genomics, PSI-2, protein structure initiative; 2.50A {Staphylococcus aureus subsp} Back     alignment and structure
>4ax1_B Metallo-beta-lactamase AIM-1; hydrolase, antibiotic resistance, acquired B3, drug binding; 1.40A {Pseudomonas aeruginosa} PDB: 4awy_B 4awz_A 4ax0_B Back     alignment and structure
>2qed_A Hydroxyacylglutathione hydrolase; metallo-B- superfamily, salmonella typhimurium LT2; 1.45A {Salmonella typhimurium} SCOP: d.157.1.2 Back     alignment and structure
>3iog_A Beta-lactamase; hydrolase, antibiotic resistance, metal-binding; HET: SDF; 1.41A {Aeromonas hydrophila} SCOP: d.157.1.1 PDB: 1x8i_A 3fai_A* 3iof_A* 1x8h_A 2qds_A* 2gkl_A* 1x8g_A* 3f9o_A 3t9m_A 3sw3_A Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>2r2d_A AGR_PTI_140P, Zn-dependent hydrolases; lactonase, N-acyl hompserine lactone, DI-nuclear zinc center quenching, AIIB, phosphate; HET: PO4; 1.75A {Agrobacterium tumefaciens} Back     alignment and structure
>2zo4_A Metallo-beta-lactamase family protein; hydrolase; 2.10A {Thermus thermophilus} Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3q6v_A Beta-lactamase; metalloenzyme, alpha-beta, hydrolase; 1.37A {Serratia fonticola} PDB: 3sd9_A Back     alignment and structure
>4dik_A Flavoprotein; TM0755, electron transport, DI-iron protein; 1.75A {Thermotoga maritima} PDB: 4dil_A 1vme_A* Back     alignment and structure
>4efz_A Metallo-beta-lactamase family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>1p9e_A Methyl parathion hydrolase; Zn containing; 2.40A {Pseudomonas SP} SCOP: d.157.1.5 Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>1qh5_A Glyoxalase II, protein (hydroxyacylglutathione hydrolase); metallo-hydrolase; HET: GSH GBP; 1.45A {Homo sapiens} SCOP: d.157.1.2 PDB: 1qh3_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>2vw8_A PA1000, PQSE; quinolone signal response protein, signaling protein, SSPF; 1.45A {Pseudomonas aeruginosa PAO1} PDB: 2q0j_A 2q0i_A 3dh8_A* Back     alignment and structure
>2gcu_A Putative hydroxyacylglutathione hydrolase 3; ethylmalonic encephalopathy, ETHE1, structural genomics, protein structure initiative; 1.48A {Arabidopsis thaliana} Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>1xm8_A Glyoxalase II; structural genomics, protein structure initiative, CESG, AT2G31350, metallo-hydrolase, zinc/iron binuclear center; 1.74A {Arabidopsis thaliana} SCOP: d.157.1.2 PDB: 2q42_A Back     alignment and structure
>4hl2_A Beta-lactamase NDM-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ZZ7; 1.05A {Klebsiella pneumoniae} PDB: 4hl1_A* 4h0d_A* 4gyu_A* 4gyq_A 3q6x_A* 3spu_A 3rkj_A 3sfp_A* 3rkk_A* 3sbl_A* 3srx_A 3zr9_A 3s0z_A 3pg4_A Back     alignment and structure
>4eyb_A Beta-lactamase NDM-1; metallo beta lactamase, antibiotic, hydrolase-antibiotic COM; HET: 0WO; 1.16A {Klebsiella pneumoniae} PDB: 4ey2_A* 4eyf_A* 4exy_A 4exs_B 4eyl_A* 3spu_A 3q6x_A* 3rkj_A 3sfp_A* 3rkk_A* 3sbl_A* 3srx_A 3zr9_A 3s0z_A 3pg4_A Back     alignment and structure
>2bib_A CBPE, teichoic acid phosphorylcholine esterase/ choline protein; choline-binding protein, PCE, phosphorylcholine estera hydrolase; HET: PC BTB; 1.92A {Streptococcus pneumoniae} SCOP: b.109.1.1 d.157.1.8 PDB: 1wra_A* Back     alignment and structure
>3l6n_A Metallo-beta-lactamase; zinc, hydolase, antibiotics resistance, hydrolase; 1.65A {Chryseobacterium indologenes} SCOP: d.157.1.0 Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>2p18_A Glyoxalase II; metalloprotein, beta sandwich, alpha-helical domain, hydrola; HET: SPD; 1.80A {Leishmania infantum} PDB: 2p1e_A* Back     alignment and structure
>1e5d_A Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DIIRON-centre, flavoproteins, lactamase-fold; HET: FMN; 2.5A {Desulfovibrio gigas} SCOP: c.23.5.1 d.157.1.3 Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>1m2x_A Class B carbapenemase BLAB-1; alpha-beta/BETA-alpha fold., hydrolase; HET: MCO; 1.50A {Elizabethkingia meningoseptica} SCOP: d.157.1.1 Back     alignment and structure
>1jjt_A IMP-1 metallo beta-lactamase; metallo-beta-lactamase inhibitor, succinic acid inhibitor, I metallo-beta-lactamase, hydrolase; HET: BDS; 1.80A {Pseudomonas aeruginosa} SCOP: d.157.1.1 PDB: 1dd6_A* 1vgn_A* 2doo_A* 1wup_A 1wuo_A 1jje_A* 1ddk_A Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>1a7t_A Metallo-beta-lactamase; hydrolase (beta-lactamase), zinc; HET: MES; 1.85A {Bacteroides fragilis} SCOP: d.157.1.1 PDB: 1a8t_A* 2bmi_A 1kr3_A 1znb_A 2znb_A 3znb_A 4znb_A 1hlk_A* Back     alignment and structure
>3kl7_A Putative metal-dependent hydrolase; structural genomics, JOI for structural genomics, JCSG; 2.30A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>4ad9_A Lactb2, beta-lactamase-like protein 2; hydrolase, metallo-beta lactamase, mitochondria; 2.60A {Homo sapiens} Back     alignment and structure
>1mqo_A Beta-lactamase II; alpha-beta/BETA-alpha fold, hydrolase; HET: CIT; 1.35A {Bacillus cereus} SCOP: d.157.1.1 PDB: 1bc2_A 1bvt_A* 3i0v_A 3i11_A 3i13_A 3i14_A 3i15_A 2uyx_A 2bc2_A 3bc2_A 2bfl_A 2bfk_A 2bfz_B 2bg2_A 2bg7_A 2bg8_A 1dxk_A 3kns_A 3knr_A 2bfz_A ... Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>2y8b_A Metallo-B-lactamase; hydrolase, cephalosporins, antibiotic recognition; 1.70A {Pseudomonas aeruginosa} PDB: 2y8a_A 2y87_A 2yz3_A* 2whg_A* 2wrs_A* 1ko3_A 1ko2_A Back     alignment and structure
>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidore; HET: FMN; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 2ohi_A* 2ohj_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2e7y_A TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.97A {Thermotoga maritima} SCOP: d.157.1.7 PDB: 1ww1_A Back     alignment and structure
>3rpc_A Possible metal-dependent hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.49A {Veillonella parvula} Back     alignment and structure
>1ycg_A Nitric oxide reductase; DIIRON site, oxidoreductase; HET: FMN; 2.80A {Moorella thermoacetica} SCOP: c.23.5.1 d.157.1.3 PDB: 1ycf_A* 1ych_A* Back     alignment and structure
>2fhx_A SPM-1; metallo-beta-lactamase, dinuclear zinc, antibiotic resistanc hydrolase, metal binding protein; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3h3e_A Uncharacterized protein TM1679; structural genomics, surface entropy reduction, ISFI, beta- lactamase superfamily, PSI-2; 2.75A {Thermotoga maritima} Back     alignment and structure
>2p97_A Hypothetical protein; putative metal-dependent hydrolase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.157.1.12 Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3bv6_A Metal-dependent hydrolase; metallo protein, beta-lactamase like fold, MCSG, structural PSI-2, protein structure initiative; 1.80A {Vibrio cholerae o1 biovar eltor} Back     alignment and structure
>2wyl_A L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 2.59A {Escherichia coli} PDB: 2wym_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2cfu_A SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1DB; 1.9A {Pseudomonas aeruginosa} SCOP: d.106.1.3 d.157.1.13 PDB: 2cfz_A* 2cg2_A 2cg3_A* Back     alignment and structure
>2yhe_A SEC-alkyl sulfatase; hydrolase, inversion, metallo-beta-lactamase fold; 2.70A {Pseudomonas SP} Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>1vjn_A Zn-dependent hydrolase of metallo-beta-lactamase superfamily TM0207; metallo-hydrolase/oxidoreductase fold, structural genomics; 2.00A {Thermotoga maritima} SCOP: d.157.1.4 Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>4b87_A DNA cross-LINK repair 1A protein; dclre1A, DCLRE, interstrand crosslink repair, hydrolase, NIT mustard, cancer, chemotherapy, PSO2 homolog,; HET: DNA; 2.16A {Homo sapiens} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>3zdk_A 5' exonuclease apollo; hydrolase; HET: TLA; 2.16A {Homo sapiens} Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 595
d2i7ta1451 d.157.1.10 (A:9-459) Cleavage and polyadenylation 4e-34
d2dkfa1431 d.157.1.10 (A:1-431) Putative RNA-degradation prot 2e-30
d2i7xa1514 d.157.1.10 (A:1-422,A:626-717) Cleavage factor two 2e-26
d1wraa1305 d.157.1.8 (A:30-334) Teichoic acid phosphorylcholi 7e-12
d1pn0a1 360 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So 4e-08
d1pn0a1360 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So 2e-07
d1zkpa1244 d.157.1.9 (A:1-244) Hypothetical protein BA1088 (B 5e-08
d1p9ea_294 d.157.1.5 (A:) Methyl parathion hydrolase {Pseudom 4e-07
d2e7ya1280 d.157.1.7 (A:1-280) Ribonuclease Z (RNase Z) {Ther 4e-06
d1ztca1207 d.157.1.11 (A:1-207) Hypothetical protein TM0894 { 4e-05
d2az4a1183 d.157.1.10 (A:56-238) Hypothetical protein EF2904 4e-05
d1gpea1 391 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penic 6e-05
d1k0ia1 292 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr 9e-05
d1cf3a1 385 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Asper 1e-04
d2aioa1266 d.157.1.1 (A:23-311) Zn metallo-beta-lactamase {Xa 1e-04
d2gmha1 380 c.3.1.2 (A:4-236,A:336-482) Electron transfer flav 4e-04
d3c96a1 288 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps 5e-04
d3c96a1288 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps 0.001
d1vmea2250 d.157.1.3 (A:1-250) ROO-like flavoprotein TM0755, 5e-04
d2f5va1 379 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W 6e-04
d3coxa1 370 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of 0.001
d2gmna1264 d.157.1.1 (A:29-292) Zn metallo-beta-lactamase {Br 0.002
d1jnra2 356 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reduct 0.002
d1xtoa_304 d.157.1.6 (A:) Coenzyme PQQ synthesis protein B, P 0.002
d2i0za1 251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 0.003
>d2i7ta1 d.157.1.10 (A:9-459) Cleavage and polyadenylation specificity factor subunit 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 451 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Metallo-hydrolase/oxidoreductase
superfamily: Metallo-hydrolase/oxidoreductase
family: beta-CASP RNA-metabolising hydrolases
domain: Cleavage and polyadenylation specificity factor subunit 3
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  132 bits (333), Expect = 4e-34
 Identities = 54/109 (49%), Positives = 69/109 (63%), Gaps = 5/109 (4%)

Query: 3   EIKVTPLGAGQDVGRSCILVSMGGKNIMLDCGMHMGYHDDRKFPDFKFIAPQGPVTDMID 62
           ++ + PLGAGQ+VGRSCI++   G+ IMLDCG+H G       P    I P       ID
Sbjct: 3   QLLIRPLGAGQEVGRSCIILEFKGRKIMLDCGIHPGLEGMDALPYIDLIDP-----AEID 57

Query: 63  CLIISHFHLDHCGALPYFTEMFGYAGPIYMTHPTKAIAPILLEDFRKIS 111
            L+ISHFHLDHCGALP+F +   + G  +MTH TKAI   LL D+ K+S
Sbjct: 58  LLLISHFHLDHCGALPWFLQKTSFKGRTFMTHATKAIYRWLLSDYVKVS 106
>d2dkfa1 d.157.1.10 (A:1-431) Putative RNA-degradation protein TTHA0252 {Thermus thermophilus [TaxId: 274]} Length = 431 Back     information, alignment and structure
>d2i7xa1 d.157.1.10 (A:1-422,A:626-717) Cleavage factor two protein 2, CFT2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 514 Back     information, alignment and structure
>d1wraa1 d.157.1.8 (A:30-334) Teichoic acid phosphorylcholine esterase Pce (LytD), N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 305 Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 Back     information, alignment and structure
>d1zkpa1 d.157.1.9 (A:1-244) Hypothetical protein BA1088 (BAS1016) {Bacillus anthracis [TaxId: 1392]} Length = 244 Back     information, alignment and structure
>d1p9ea_ d.157.1.5 (A:) Methyl parathion hydrolase {Pseudomonas sp. WBC-3 [TaxId: 165468]} Length = 294 Back     information, alignment and structure
>d2e7ya1 d.157.1.7 (A:1-280) Ribonuclease Z (RNase Z) {Thermotoga maritima [TaxId: 2336]} Length = 280 Back     information, alignment and structure
>d1ztca1 d.157.1.11 (A:1-207) Hypothetical protein TM0894 {Thermotoga maritima [TaxId: 2336]} Length = 207 Back     information, alignment and structure
>d2az4a1 d.157.1.10 (A:56-238) Hypothetical protein EF2904 {Enterococcus faecalis [TaxId: 1351]} Length = 183 Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 391 Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 385 Back     information, alignment and structure
>d2aioa1 d.157.1.1 (A:23-311) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]} Length = 266 Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 Back     information, alignment and structure
>d1vmea2 d.157.1.3 (A:1-250) ROO-like flavoprotein TM0755, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 250 Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Length = 370 Back     information, alignment and structure
>d2gmna1 d.157.1.1 (A:29-292) Zn metallo-beta-lactamase {Bradyrhizobium japonicum [TaxId: 375]} Length = 264 Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 356 Back     information, alignment and structure
>d1xtoa_ d.157.1.6 (A:) Coenzyme PQQ synthesis protein B, PqqB {Pseudomonas putida [TaxId: 303]} Length = 304 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query595
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 99.76
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 99.72
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 99.63
d2i7ta1451 Cleavage and polyadenylation specificity factor su 99.51
d2dkfa1431 Putative RNA-degradation protein TTHA0252 {Thermus 99.5
d2cbna1305 Ribonuclease Z (RNase Z) {Escherichia coli [TaxId: 99.26
d1zkpa1244 Hypothetical protein BA1088 (BAS1016) {Bacillus an 99.22
d2i7xa1514 Cleavage factor two protein 2, CFT2 {Baker's yeast 99.2
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 99.2
d1y44a1307 Ribonuclease Z (RNase Z) {Bacillus subtilis [TaxId 99.19
d2aioa1266 Zn metallo-beta-lactamase {Xanthomonas maltophilia 99.12
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 99.11
d2gmna1264 Zn metallo-beta-lactamase {Bradyrhizobium japonicu 99.09
d1k0ia1 292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 99.05
d1p9ea_294 Methyl parathion hydrolase {Pseudomonas sp. WBC-3 99.0
d1ztca1207 Hypothetical protein TM0894 {Thermotoga maritima [ 99.0
d1k07a_262 Zn metallo-beta-lactamase {Fluoribacter gormanii, 99.0
d2q0ia1298 Quinolone signal response protein PqsE {Pseudomona 98.93
d1xtoa_304 Coenzyme PQQ synthesis protein B, PqqB {Pseudomona 98.93
d1vmea2250 ROO-like flavoprotein TM0755, N-terminal domain {T 98.9
d1wraa1305 Teichoic acid phosphorylcholine esterase Pce (LytD 98.9
d3c96a1 288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 98.89
d1x8ha_228 Zn metallo-beta-lactamase {Aeromonas hydrophila, C 98.77
d1ycga2249 Nitric oxide reductase N-terminal domain {Moorella 98.67
d1e5da2249 Rubredoxin oxygen:oxidoreductase (ROO), N-terminal 98.67
d1qh5a_260 Glyoxalase II (hydroxyacylglutathione hydrolase) { 98.65
d1jjta_220 Zn metallo-beta-lactamase {Pseudomonas aeruginosa, 98.64
d2voua1 265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.61
d1xm8a_254 Glyoxalase II (hydroxyacylglutathione hydrolase) { 98.58
d2qeda1251 Glyoxalase II (hydroxyacylglutathione hydrolase) { 98.51
d1ko3a_230 Zn metallo-beta-lactamase {Pseudomonas aeruginosa, 98.5
d1m2xa_219 Zn metallo-beta-lactamase {Chryseobacterium mening 98.5
d2e7ya1280 Ribonuclease Z (RNase Z) {Thermotoga maritima [Tax 98.49
d1mqoa_221 Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 98.41
d1znba_230 Zn metallo-beta-lactamase {Bacteroides fragilis [T 98.36
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.35
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 98.34
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 98.28
d2i0za1 251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 98.24
d2gmha1 380 Electron transfer flavoprotein-ubiquinone oxidored 98.23
d2az4a1183 Hypothetical protein EF2904 {Enterococcus faecalis 98.23
d2cfua2505 Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI 98.16
d2gf3a1 281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 98.15
d2gqfa1 253 Hypothetical protein HI0933 {Haemophilus influenza 98.14
d2p97a1200 Hypothetical protein Ava3068 {Anabaena variabilis 98.13
d1ryia1 276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 98.12
d3lada1 229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.11
d1rp0a1 278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.07
d1fl2a1 184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.05
d1gesa1 217 Glutathione reductase {Escherichia coli [TaxId: 56 98.05
d1ojta1 229 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.02
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.02
d1v59a1 233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.01
d1dxla1 221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.0
d1y0pa2 308 Flavocytochrome c3 (respiratory fumarate reductase 97.99
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 97.99
d1h6va1 235 Mammalian thioredoxin reductase {Rat (Rattus norve 97.99
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 97.99
d2bs2a2 336 Fumarate reductase {Wolinella succinogenes [TaxId: 97.95
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 97.9
d3grsa1 221 Glutathione reductase {Human (Homo sapiens) [TaxId 97.89
d1trba1 190 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.88
d2f5va1 379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 97.88
d1i8ta1 298 UDP-galactopyranose mutase, N-terminal domain {Esc 97.87
d1ebda1 223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.87
d2cula1 230 GidA-related protein TTHA1897 {Thermus thermophilu 97.87
d1vdca1 192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.86
d1c0pa1 268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 97.86
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 97.85
d1d4ca2 322 Flavocytochrome c3 (respiratory fumarate reductase 97.82
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 97.81
d1lvla1 220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 97.8
d1qo8a2 317 Flavocytochrome c3 (respiratory fumarate reductase 97.77
d1pj5a2 305 N,N-dimethylglycine oxidase {Arthrobacter globifor 97.73
d1chua2 305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 97.73
d1neka2 330 Succinate dehydogenase {Escherichia coli [TaxId: 5 97.69
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 97.69
d1w4xa1 298 Phenylacetone monooxygenase {Thermobifida fusca [T 97.64
d3coxa1 370 Cholesterol oxidase of GMC family {Brevibacterium 97.63
d1kdga1 360 Flavoprotein domain of flavocytochrome cellobiose 97.62
d1onfa1 259 Glutathione reductase {Plasmodium falciparum [TaxI 97.62
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 97.61
d1vjna_209 Hypothetical protein TM0207 {Thermotoga maritima [ 97.58
d1gpea1 391 Glucose oxidase {Penicillium amagasakiense [TaxId: 97.56
d2gjca1 311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 97.55
d1jnra2 356 Adenylylsulfate reductase A subunit {Archaeon Arch 97.54
d1cf3a1 385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 97.53
d1gtea4 196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 97.53
d1feca1 240 Trypanothione reductase {Crithidia fasciculata [Ta 97.52
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 97.51
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.5
d1aoga1 238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.49
d1djqa3 233 Trimethylamine dehydrogenase, middle domain {Methy 97.44
d1n4wa1 367 Cholesterol oxidase of GMC family {Streptomyces sp 97.42
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 97.41
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 97.41
d1mo9a1 261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 97.39
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 97.37
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 97.36
d1lqta2 239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 97.31
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 97.3
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 97.27
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.2
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 97.2
d1ju2a1 351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 97.2
d1cjca2 230 Adrenodoxin reductase of mitochondrial p450 system 97.19
d1kf6a2 311 Fumarate reductase {Escherichia coli [TaxId: 562]} 97.19
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 97.18
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 97.18
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 97.17
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 97.12
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 97.1
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 97.04
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 96.94
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 96.83
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 96.83
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 96.79
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 96.74
d1kifa1 246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 96.68
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 96.66
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 96.62
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 96.62
d1xdia1 233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 96.48
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 96.48
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 96.45
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 96.4
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 96.37
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 96.33
d1fcda1 186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 96.26
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 96.24
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 96.1
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 96.08
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 96.02
d1q1ra1 185 Putidaredoxin reductase {Pseudomonas putida [TaxId 95.95
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 95.86
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 95.76
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 95.7
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 95.5
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 95.32
d1m6ia1 213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 95.26
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 95.16
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 94.92
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 94.91
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 94.91
d1bg6a2 184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 94.73
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 94.57
d1nhpa1 198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 94.54
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 94.51
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 94.5
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 94.3
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 93.85
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 93.77
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 93.47
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 93.25
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 93.2
d1f0ya2 192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 93.11
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 93.08
d1vg0a1 491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 93.01
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 92.95
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 92.74
d1wdka3 186 Fatty oxidation complex alpha subunit, middle doma 92.39
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 91.93
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 91.78
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 91.51
d1mv8a2 202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 91.38
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 91.06
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 91.02
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 90.93
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 90.84
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 90.78
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 90.77
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 90.48
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 90.05
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 89.91
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 89.91
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 89.84
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 89.67
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 89.53
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 89.41
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 89.33
d1n1ea2 189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 89.31
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 89.25
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 89.2
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 89.2
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 88.67
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 88.6
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 88.5
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 88.41
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 87.96
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 87.65
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 87.35
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 87.05
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 87.01
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 86.62
d1id1a_153 Rck domain from putative potassium channel Kch {Es 86.6
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 86.47
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 85.78
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 85.52
d1jaya_ 212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 85.2
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 84.99
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 84.76
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 84.61
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 84.58
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 84.28
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 84.12
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 84.01
d1dlja2 196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 83.84
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 83.8
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 83.33
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 83.16
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 82.98
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 82.87
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 82.77
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 82.7
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 82.33
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 82.08
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 80.78
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 80.74
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 80.38
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Monooxygenase PhzS
species: Pseudomonas aeruginosa [TaxId: 287]

Probab=99.76  E-value=2.8e-18  Score=165.73  Aligned_cols=192  Identities=16%  Similarity=0.127  Sum_probs=142.7

Q ss_pred             HHhhhcccccCcEEEEecCCCcceEEcCCcc-CccccceeeeHHHHHHHHHHHHhc--CCceEEeCCeEeEEecCCCCCC
Q psy9964         130 IQILKYVMIKGTSKVWGHSSDDLLEFNKAHN-YQDRISYIVENDLIIDAVTKKLNT--LNIDIVYQKKVAHYELPEQPLN  206 (595)
Q Consensus       130 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~i~R~~L~~~L~~~~~~--~gv~i~~~~~v~~v~~~~~~~~  206 (595)
                      +.+.+..........++.++.....+..... ......+...+......+.+.+.+  .++.++++++++.++.   .++
T Consensus        61 ~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~---~~~  137 (288)
T d3c96a1          61 PALAATAIPTHELRYIDQSGATVWSEPRGVEAGNAYPQYSIHRGELQMILLAAVRERLGQQAVRTGLGVERIEE---RDG  137 (288)
T ss_dssp             HHHHHHSEEECEEEEECTTSCEEEEEECGGGGTCSSCEEEEEHHHHHHHHHHHHHHHHCTTSEEESEEEEEEEE---ETT
T ss_pred             hhhHhhhcccccceeEcCCCCEEEeccccccccccCcccccchhhhHHHHHHHHHHhccCeeeecCcEEEEeee---cCC
Confidence            3344444555566677777766555554432 223345566777777777766544  7889999999999985   578


Q ss_pred             ceEEEEcCCc----EEEecEEEEecCCCchhhhhcCCCCcccCCCCeEEEEEEEeccCCCCceEEEEeCCCCcEEEeeCC
Q psy9964         207 NVKIKFESGE----SIECKLLLGTDGARSQVRNAMNVQYSNWSYDQKGIVATVKISTSPPNRTAWQRFTPSGTVALLPLS  282 (595)
Q Consensus       207 ~v~v~~~dG~----~~~adlvVgADG~~S~vR~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~p~~  282 (595)
                      +++|++.||.    ++++|+||||||.+|.||+.+........+                                    
T Consensus       138 ~v~v~~~~g~~~~~~~~ad~vi~ADG~~S~vr~~~~~~~~~~~~------------------------------------  181 (288)
T d3c96a1         138 RVLIGARDGHGKPQALGADVLVGADGIHSAVRAHLHPDQRPLRD------------------------------------  181 (288)
T ss_dssp             EEEEEEEETTSCEEEEEESEEEECCCTTCHHHHHHCTTCCCCCC------------------------------------
T ss_pred             cEEEEEEcCCCCeEEEeeceeeccCCccceeeeeeccccccccc------------------------------------
Confidence            8999998873    799999999999999998775322100000                                    


Q ss_pred             CCCeEEEEecCHhhHHHHhCCCchHHHHHHHHhcCCCcchhhHHHHhhhhhhchhhhccccCCCcccCCCccceeccccc
Q psy9964         283 DEFSSLVWATTPENAKALLQMPGESFVDALNSEFNKPAELNESIQVATKFTHNVLEFFNLSTGNEQVVPPRVMSVEEKSR  362 (595)
Q Consensus       283 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  362 (595)
                                                                                                      
T Consensus       182 --------------------------------------------------------------------------------  181 (288)
T d3c96a1         182 --------------------------------------------------------------------------------  181 (288)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             eeeeccccccccccCCCEEEEccccccccCccchhhhhchHHHHHHHHHHHHhhhCCCCCCChHHHHHHHHHhhhccchH
Q psy9964         363 AAFPLGFGHSVRYIGPGCALLGDSAHRIHPLAGQGVNLGFGDIACLVQLSAESVSNGYPIGHPESLTKYESIRQRENLPV  442 (595)
Q Consensus       363 ~~~~~~~~~~~~~~~grvvLvGDAAH~~~P~~GqG~n~Al~Da~~La~~L~~~~~~~~~~~~~~~L~~Y~~~r~~~~~~~  442 (595)
                              ....|..++++++|||+|.++|+.|||+|+|++|+..|+++|.+.    .+  ...+|+.|++.|+|++..+
T Consensus       182 --------~~~~~~~~~~~~~gda~h~~~p~~g~G~~~ai~d~~~l~~~l~~~----~~--~~~al~~y~~~r~pr~~~~  247 (288)
T d3c96a1         182 --------PLPHWGRGRITLLGDAAHLMYPMGANGASQAILDGIELAAALARN----AD--VAAALREYEEARRPTANKI  247 (288)
T ss_dssp             --------CCSCCCBTTEEECTHHHHCCCSSTTCTHHHHHHHHHHHHHHHHHC----SS--HHHHHHHHHHHHHHHHHHH
T ss_pred             --------cccccccCcceecccccceeCCccccchhhhhhhHHHHHHHHhhC----CC--HHHHHHHHHHHHHHHHHHH
Confidence                    012345689999999999999999999999999999999999652    23  5789999999999999999


Q ss_pred             HHHHHHHHHhhc
Q psy9964         443 MLSIDLMYRVYR  454 (595)
Q Consensus       443 ~~~~~~~~~~~~  454 (595)
                      +..++...+.+.
T Consensus       248 ~~~~~~~~~~~~  259 (288)
T d3c96a1         248 ILANREREKEEW  259 (288)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             HHHHHHHHHhhc
Confidence            998887776543
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2i7ta1 d.157.1.10 (A:9-459) Cleavage and polyadenylation specificity factor subunit 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dkfa1 d.157.1.10 (A:1-431) Putative RNA-degradation protein TTHA0252 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2cbna1 d.157.1.7 (A:1-305) Ribonuclease Z (RNase Z) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zkpa1 d.157.1.9 (A:1-244) Hypothetical protein BA1088 (BAS1016) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d2i7xa1 d.157.1.10 (A:1-422,A:626-717) Cleavage factor two protein 2, CFT2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1y44a1 d.157.1.7 (A:1-307) Ribonuclease Z (RNase Z) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2aioa1 d.157.1.1 (A:23-311) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2gmna1 d.157.1.1 (A:29-292) Zn metallo-beta-lactamase {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p9ea_ d.157.1.5 (A:) Methyl parathion hydrolase {Pseudomonas sp. WBC-3 [TaxId: 165468]} Back     information, alignment and structure
>d1ztca1 d.157.1.11 (A:1-207) Hypothetical protein TM0894 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1k07a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Fluoribacter gormanii, (Legionella gormanii) FEZ-1 [TaxId: 464]} Back     information, alignment and structure
>d2q0ia1 d.157.1.14 (A:1-298) Quinolone signal response protein PqsE {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xtoa_ d.157.1.6 (A:) Coenzyme PQQ synthesis protein B, PqqB {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vmea2 d.157.1.3 (A:1-250) ROO-like flavoprotein TM0755, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wraa1 d.157.1.8 (A:30-334) Teichoic acid phosphorylcholine esterase Pce (LytD), N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1x8ha_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Aeromonas hydrophila, CphA [TaxId: 644]} Back     information, alignment and structure
>d1ycga2 d.157.1.3 (A:2-250) Nitric oxide reductase N-terminal domain {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1e5da2 d.157.1.3 (A:2-250) Rubredoxin oxygen:oxidoreductase (ROO), N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1qh5a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jjta_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, IMP-1 [TaxId: 287]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1xm8a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2qeda1 d.157.1.2 (A:1-251) Glyoxalase II (hydroxyacylglutathione hydrolase) {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ko3a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, VIM-2 [TaxId: 287]} Back     information, alignment and structure
>d1m2xa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Chryseobacterium meningosepticum, carbapenemase BLAB-1 [TaxId: 238]} Back     information, alignment and structure
>d2e7ya1 d.157.1.7 (A:1-280) Ribonuclease Z (RNase Z) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mqoa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1znba_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacteroides fragilis [TaxId: 817]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2az4a1 d.157.1.10 (A:56-238) Hypothetical protein EF2904 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2p97a1 d.157.1.12 (A:1-200) Hypothetical protein Ava3068 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1vjna_ d.157.1.4 (A:) Hypothetical protein TM0207 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure