Psyllid ID: psy9966
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1101 | 2.2.26 [Sep-21-2011] | |||||||
| Q5ZIH0 | 600 | Integrator complex subuni | yes | N/A | 0.388 | 0.713 | 0.639 | 1e-168 | |
| Q503E1 | 598 | Integrator complex subuni | yes | N/A | 0.388 | 0.715 | 0.630 | 1e-166 | |
| Q9CWS4 | 600 | Integrator complex subuni | yes | N/A | 0.389 | 0.715 | 0.623 | 1e-165 | |
| Q3MHC2 | 600 | Integrator complex subuni | yes | N/A | 0.389 | 0.715 | 0.621 | 1e-165 | |
| Q5TA45 | 600 | Integrator complex subuni | yes | N/A | 0.388 | 0.713 | 0.625 | 1e-164 | |
| Q2YDM2 | 599 | Integrator complex subuni | yes | N/A | 0.388 | 0.714 | 0.620 | 1e-164 | |
| Q5NVE6 | 600 | Integrator complex subuni | yes | N/A | 0.388 | 0.713 | 0.620 | 1e-164 | |
| Q54YL3 | 744 | Integrator complex subuni | yes | N/A | 0.278 | 0.412 | 0.617 | 1e-120 | |
| Q8GUU3 | 613 | Cleavage and polyadenylat | yes | N/A | 0.297 | 0.535 | 0.522 | 2e-96 | |
| P79101 | 684 | Cleavage and polyadenylat | no | N/A | 0.335 | 0.539 | 0.338 | 2e-57 |
| >sp|Q5ZIH0|INT11_CHICK Integrator complex subunit 11 OS=Gallus gallus GN=CPSF3L PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 593 bits (1530), Expect = e-168, Method: Compositional matrix adjust.
Identities = 278/435 (63%), Positives = 350/435 (80%), Gaps = 7/435 (1%)
Query: 1 MFQVKVGNQSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTIRDSKRCRERDFL 60
MFQ+KVG +S+VYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTIRDSKRCRERDFL
Sbjct: 163 MFQIKVGCESVVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTIRDSKRCRERDFL 222
Query: 61 KKVHECVDRGGKVLIPVFALGRAQELCILLETYWERMNLQAPIYFAVGLTEKATNYYKMF 120
KKVHE V+RGGKVLIPVFALGRAQELCILLET+WERMNL+APIYF+ GLTEKA +YYK+F
Sbjct: 223 KKVHETVERGGKVLIPVFALGRAQELCILLETFWERMNLKAPIYFSTGLTEKANHYYKLF 282
Query: 121 ITWTNQKIRKTFVQRNMFDFKHIRPFDKSFIDNPGPMVVFATPGMLHSGLSLIIFKKWAP 180
ITWTNQKIRKTFVQRNMF+FKHI+ FD++F DNPGPMVVFATPGMLH+G SL IF+KWA
Sbjct: 283 ITWTNQKIRKTFVQRNMFEFKHIKAFDRAFADNPGPMVVFATPGMLHAGQSLQIFRKWAG 342
Query: 181 VENNMLIMPGFCVQGTIGHKVLSGVKKLEFENKQIIDVKMAIEYMSFSAHADAKGIMQLI 240
E NM+IMPG+CVQGT+GHK+LSG +KLE E +QI++VKM +EYMSFSAHADAKGIMQLI
Sbjct: 343 NEKNMVIMPGYCVQGTVGHKILSGQRKLEMEGRQILEVKMQVEYMSFSAHADAKGIMQLI 402
Query: 241 QYCEPKNVLLVHGEASKMVFLKEKIKQEFNLDCFMPANGESCFVQTDMKISIDVSVNLLK 300
+ EP+NVLLVHGEA KM FLK+KI+QEF+++C+MPANGE+ + T+ I +D+S+ LLK
Sbjct: 403 RQAEPRNVLLVHGEAKKMEFLKQKIEQEFHVNCYMPANGETTTIFTNPSIPVDISLGLLK 462
Query: 301 EEAVKYNSEPPNPLKERQIHGVLVIKDSSISLMDVDEACKEVGISRHIVRFTSNVQISDS 360
E P+ K + +HG L++KD+S L+ ++A KE+G++ H +RFT V I D
Sbjct: 463 RETAI--GLLPDAKKPKLMHGTLIMKDNSFRLVSPEQALKELGLAEHQLRFTCRVHIQDP 520
Query: 361 SPINKTLELIYDQLLSYLQDKSQEYKIQLTESSLSIDSVLL--SVERIDDKNKRVFVTWP 418
++T+ +Y+ L L+D S ++ L + S++++S+L+ + D K + V+W
Sbjct: 521 RKEHETVLRVYNHLKGVLKDYSVQH---LPDGSITVESILIQATAHSEDQGTKVLLVSWT 577
Query: 419 NQDEEVGKIVLHVLK 433
QDEE+G + +LK
Sbjct: 578 YQDEELGSYLTSLLK 592
|
Catalytic component of the Integrator complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing. Mediates the snRNAs 3' cleavage. Gallus gallus (taxid: 9031) EC: 3EC: .EC: 1EC: .EC: 2EC: 7EC: .EC: - |
| >sp|Q503E1|INT11_DANRE Integrator complex subunit 11 OS=Danio rerio GN=cpsf3l PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9CWS4|INT11_MOUSE Integrator complex subunit 11 OS=Mus musculus GN=Cpsf3l PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q3MHC2|INT11_RAT Integrator complex subunit 11 OS=Rattus norvegicus GN=Cpsf3l PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q5TA45|INT11_HUMAN Integrator complex subunit 11 OS=Homo sapiens GN=CPSF3L PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q2YDM2|INT11_BOVIN Integrator complex subunit 11 OS=Bos taurus GN=CPSF3L PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q5NVE6|INT11_PONAB Integrator complex subunit 11 OS=Pongo abelii GN=CPSF3L PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q54YL3|INT11_DICDI Integrator complex subunit 11 homolog OS=Dictyostelium discoideum GN=ints11 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q8GUU3|CPS3B_ARATH Cleavage and polyadenylation specificity factor subunit 3-II OS=Arabidopsis thaliana GN=CPSF73-II PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|P79101|CPSF3_BOVIN Cleavage and polyadenylation specificity factor subunit 3 OS=Bos taurus GN=CPSF3 PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1101 | ||||||
| 357624104 | 595 | hypothetical protein KGM_18742 [Danaus p | 0.391 | 0.724 | 0.714 | 0.0 | |
| 91086147 | 595 | PREDICTED: similar to CG1972 CG1972-PA [ | 0.392 | 0.726 | 0.704 | 0.0 | |
| 242013971 | 572 | Endoribonuclease YSH1, putative [Pedicul | 0.390 | 0.751 | 0.718 | 0.0 | |
| 307215032 | 594 | Integrator complex subunit 11 [Harpegnat | 0.393 | 0.728 | 0.691 | 0.0 | |
| 380011463 | 595 | PREDICTED: integrator complex subunit 11 | 0.393 | 0.727 | 0.695 | 0.0 | |
| 340728535 | 595 | PREDICTED: integrator complex subunit 11 | 0.393 | 0.727 | 0.695 | 0.0 | |
| 307170840 | 595 | Integrator complex subunit 11 [Camponotu | 0.393 | 0.727 | 0.688 | 0.0 | |
| 383859338 | 494 | PREDICTED: integrator complex subunit 11 | 0.393 | 0.876 | 0.691 | 0.0 | |
| 383859336 | 595 | PREDICTED: integrator complex subunit 11 | 0.393 | 0.727 | 0.691 | 0.0 | |
| 156546030 | 595 | PREDICTED: integrator complex subunit 11 | 0.393 | 0.727 | 0.686 | 0.0 |
| >gi|357624104|gb|EHJ75000.1| hypothetical protein KGM_18742 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
Score = 694 bits (1791), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 311/435 (71%), Positives = 377/435 (86%), Gaps = 4/435 (0%)
Query: 1 MFQVKVGNQSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTIRDSKRCRERDFL 60
MF ++VG+QS+VYTGDYNMTPDRHLGAAWIDKCRPDLLI+ESTYATTIRDSKRCRERDFL
Sbjct: 163 MFWIRVGSQSVVYTGDYNMTPDRHLGAAWIDKCRPDLLISESTYATTIRDSKRCRERDFL 222
Query: 61 KKVHECVDRGGKVLIPVFALGRAQELCILLETYWERMNLQAPIYFAVGLTEKATNYYKMF 120
KKVHECV++GGKVLIPVFALGRAQELCILLETYWERMNL+ P+YFA+GLTEKA NYYKMF
Sbjct: 223 KKVHECVEKGGKVLIPVFALGRAQELCILLETYWERMNLKYPVYFALGLTEKANNYYKMF 282
Query: 121 ITWTNQKIRKTFVQRNMFDFKHIRPFDKSFIDNPGPMVVFATPGMLHSGLSLIIFKKWAP 180
ITWTNQKIRKTFVQRNMFDFKHI+PFDKS+IDNPG MVVFATPGMLH+GLSL IFKKWAP
Sbjct: 283 ITWTNQKIRKTFVQRNMFDFKHIKPFDKSYIDNPGAMVVFATPGMLHAGLSLNIFKKWAP 342
Query: 181 VENNMLIMPGFCVQGTIGHKVLSGVKKLEFENKQIIDVKMAIEYMSFSAHADAKGIMQLI 240
E NMLIMPGFCVQGT+GHK+L+G KK+EFEN+Q+++VKMA+EYMSFSAHADAKGIMQLI
Sbjct: 343 YEQNMLIMPGFCVQGTVGHKILNGAKKIEFENRQVVEVKMAVEYMSFSAHADAKGIMQLI 402
Query: 241 QYCEPKNVLLVHGEASKMVFLKEKIKQEFNLDCFMPANGESCFVQTDMKISIDVSVNLLK 300
QYCEPKNVLLVHGEA KM FLK+KI++EF + C+MPANGE+ + T KI IDVS+ LLK
Sbjct: 403 QYCEPKNVLLVHGEAQKMEFLKDKIEKEFKISCYMPANGETAIINTPTKIPIDVSLRLLK 462
Query: 301 EEAVKYNSEPPNPLKERQIHGVLVIKDSSISLMDVDEACKEVGISRHIVRFTSNVQISDS 360
EAV+YN++PP+P + R +HGVL +KD+ +S +D+DE C E+GI+RHI+RFTS V+ D+
Sbjct: 463 AEAVRYNAQPPDPKRRRVVHGVLCVKDNRLSFLDIDEMCDEIGINRHIIRFTSTVRFDDA 522
Query: 361 SPINKTLELIYDQLLSYLQDKSQEYKIQLTESSLSIDSVLLSVERIDDKNKRVFVTWPNQ 420
KT E +L + L +K Q + I +++ ++S++SVL+ VE DD K ++V+W NQ
Sbjct: 523 GSAIKTAE----KLKTLLAEKLQGWSITISDGNISVESVLIKVEGEDDNTKSIYVSWTNQ 578
Query: 421 DEEVGKIVLHVLKSM 435
DE++G +L +L+SM
Sbjct: 579 DEDLGSYILGLLQSM 593
|
Source: Danaus plexippus Species: Danaus plexippus Genus: Danaus Family: Nymphalidae Order: Lepidoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|91086147|ref|XP_969343.1| PREDICTED: similar to CG1972 CG1972-PA [Tribolium castaneum] gi|270009886|gb|EFA06334.1| hypothetical protein TcasGA2_TC009205 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|242013971|ref|XP_002427672.1| Endoribonuclease YSH1, putative [Pediculus humanus corporis] gi|212512102|gb|EEB14934.1| Endoribonuclease YSH1, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|307215032|gb|EFN89859.1| Integrator complex subunit 11 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|380011463|ref|XP_003689822.1| PREDICTED: integrator complex subunit 11-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|340728535|ref|XP_003402577.1| PREDICTED: integrator complex subunit 11-like [Bombus terrestris] gi|350421011|ref|XP_003492700.1| PREDICTED: integrator complex subunit 11-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|307170840|gb|EFN62951.1| Integrator complex subunit 11 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|383859338|ref|XP_003705152.1| PREDICTED: integrator complex subunit 11-like isoform 2 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|383859336|ref|XP_003705151.1| PREDICTED: integrator complex subunit 11-like isoform 1 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|156546030|ref|XP_001608037.1| PREDICTED: integrator complex subunit 11-like isoform 1 [Nasonia vitripennis] gi|345498393|ref|XP_003428220.1| PREDICTED: integrator complex subunit 11-like isoform 2 [Nasonia vitripennis] gi|345498395|ref|XP_003428221.1| PREDICTED: integrator complex subunit 11-like isoform 3 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1101 | ||||||
| FB|FBgn0039691 | 597 | IntS11 "Integrator 11" [Drosop | 0.391 | 0.721 | 0.682 | 2.2e-167 | |
| UNIPROTKB|F1NV30 | 600 | CPSF3L "Integrator complex sub | 0.390 | 0.716 | 0.632 | 1.3e-148 | |
| UNIPROTKB|Q5ZIH0 | 600 | CPSF3L "Integrator complex sub | 0.390 | 0.716 | 0.632 | 1.3e-148 | |
| MGI|MGI:1919207 | 600 | Cpsf3l "cleavage and polyadeny | 0.391 | 0.718 | 0.617 | 7.3e-146 | |
| UNIPROTKB|E2QY53 | 600 | CPSF3L "Uncharacterized protei | 0.390 | 0.716 | 0.618 | 9.3e-146 | |
| RGD|1306841 | 600 | Cpsf3l "cleavage and polyadeny | 0.391 | 0.718 | 0.615 | 1.5e-145 | |
| UNIPROTKB|F1RJE8 | 599 | CPSF3L "Uncharacterized protei | 0.390 | 0.717 | 0.616 | 8.4e-145 | |
| UNIPROTKB|E1B7Q9 | 598 | CPSF3L "Integrator complex sub | 0.390 | 0.719 | 0.614 | 1.1e-144 | |
| UNIPROTKB|Q2YDM2 | 599 | CPSF3L "Integrator complex sub | 0.390 | 0.717 | 0.614 | 1.1e-144 | |
| UNIPROTKB|G3V1S5 | 606 | CPSF3L "Integrator complex sub | 0.390 | 0.709 | 0.614 | 1.1e-144 |
| FB|FBgn0039691 IntS11 "Integrator 11" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 1628 (578.1 bits), Expect = 2.2e-167, P = 2.2e-167
Identities = 299/438 (68%), Positives = 365/438 (83%)
Query: 1 MFQVKVGNQSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTIRDSKRCRERDFL 60
MF +KVG+QS+VYTGDYNMTPDRHLGAAWIDKCRPDLLI+ESTYATTIRDSKRCRERDFL
Sbjct: 163 MFWIKVGSQSVVYTGDYNMTPDRHLGAAWIDKCRPDLLISESTYATTIRDSKRCRERDFL 222
Query: 61 KKVHECVDRGGKVLIPVFALGRAQELCILLETYWERMNLQAPIYFAVGLTEKATNYYKMF 120
KKVHECV +GGKVLIPVFALGRAQELCILLETYWERMNL+ PIYFA+GLTEKA YYKMF
Sbjct: 223 KKVHECVAKGGKVLIPVFALGRAQELCILLETYWERMNLKYPIYFALGLTEKANTYYKMF 282
Query: 121 ITWTNQKIRKTFVQRNMFDFKHIRPFDKSFIDNPGPMVVFATPGMLHSGLSLIIFKKWAP 180
ITWTNQKIRKTFV RNMFDFKHI+PFDK++IDNPG MVVFATPGMLH+GLSL IFKKWAP
Sbjct: 283 ITWTNQKIRKTFVHRNMFDFKHIKPFDKAYIDNPGAMVVFATPGMLHAGLSLQIFKKWAP 342
Query: 181 VENNMLIMPGFCVQGTIGHKVLSGVKKLEFENKQIIDVKMAIEYMSFSAHADAKGIMQLI 240
ENNM+IMPG+CVQGT+G+K+L G KK+EFEN+Q+++VKMA+EYMSFSAHADAKGIMQLI
Sbjct: 343 NENNMVIMPGYCVQGTVGNKILGGAKKVEFENRQVVEVKMAVEYMSFSAHADAKGIMQLI 402
Query: 241 QYCEPKNVLLVHGEASKMVFLKEKIKQEFNLDCFMPANGESCFVQTDMKISIDVSVNLLK 300
Q CEPKNV+LVHGEA KM FL+ KIK EFNL+ +MPANGE+C + T +KI +D SV+LLK
Sbjct: 403 QNCEPKNVMLVHGEAGKMKFLRSKIKDEFNLETYMPANGETCVISTPVKIPVDASVSLLK 462
Query: 301 EEAVKYNSEPPNPLKERQIHGVLVIKDSSISLMDVDEACKEVGISRHIVRFTSNVQISDS 360
EA YN++PP+P + R IHGVLV+KD+ I L ++ +A KE+GI+RH++RFTS V++ DS
Sbjct: 463 AEARSYNAQPPDPKRRRLIHGVLVMKDNRIMLQNLTDALKEIGINRHVMRFTSKVKMDDS 522
Query: 361 SPINKTLELIYDQLLSYLQDKSQEYKIQLTEXXXXXXXXXXXXERIDDKN---KRVFVTW 417
P+ +T E +L + L++K + + + E D+K+ K + ++W
Sbjct: 523 GPVIRTSE----RLKTLLEEKLAGWTVTMQENGSIAIESVEVKVEEDEKDPKQKNILISW 578
Query: 418 PNQDEEVGKIVLHVLKSM 435
NQDE++G +L+VL++M
Sbjct: 579 TNQDEDIGAYILNVLQNM 596
|
|
| UNIPROTKB|F1NV30 CPSF3L "Integrator complex subunit 11" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZIH0 CPSF3L "Integrator complex subunit 11" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1919207 Cpsf3l "cleavage and polyadenylation specific factor 3-like" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QY53 CPSF3L "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|1306841 Cpsf3l "cleavage and polyadenylation specific factor 3-like" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RJE8 CPSF3L "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1B7Q9 CPSF3L "Integrator complex subunit 11" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2YDM2 CPSF3L "Integrator complex subunit 11" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V1S5 CPSF3L "Integrator complex subunit 11" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q9CWS4 | INT11_MOUSE | 3, ., 1, ., 2, 7, ., - | 0.6238 | 0.3896 | 0.715 | yes | N/A |
| Q2YDM2 | INT11_BOVIN | 3, ., 1, ., 2, 7, ., - | 0.6206 | 0.3887 | 0.7145 | yes | N/A |
| Q5TA45 | INT11_HUMAN | 3, ., 1, ., 2, 7, ., - | 0.6252 | 0.3887 | 0.7133 | yes | N/A |
| Q8GUU3 | CPS3B_ARATH | 3, ., 1, ., 2, 7, ., - | 0.5225 | 0.2979 | 0.5350 | yes | N/A |
| Q5ZIH0 | INT11_CHICK | 3, ., 1, ., 2, 7, ., - | 0.6390 | 0.3887 | 0.7133 | yes | N/A |
| Q54YL3 | INT11_DICDI | 3, ., 1, ., 2, 7, ., - | 0.6175 | 0.2788 | 0.4126 | yes | N/A |
| Q5NVE6 | INT11_PONAB | 3, ., 1, ., 2, 7, ., - | 0.6206 | 0.3887 | 0.7133 | yes | N/A |
| Q503E1 | INT11_DANRE | 3, ., 1, ., 2, 7, ., - | 0.6307 | 0.3887 | 0.7157 | yes | N/A |
| Q3MHC2 | INT11_RAT | 3, ., 1, ., 2, 7, ., - | 0.6215 | 0.3896 | 0.715 | yes | N/A |
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.1.27 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1101 | |||
| COG1236 | 427 | COG1236, YSH1, Predicted exonuclease of the beta-l | 2e-64 | |
| TIGR03675 | 630 | TIGR03675, arCOG00543, arCOG00543 universal archae | 3e-47 | |
| COG1782 | 637 | COG1782, COG1782, Predicted metal-dependent RNase, | 5e-47 | |
| smart01027 | 126 | smart01027, Beta-Casp, Beta-Casp domain | 1e-38 | |
| pfam10996 | 124 | pfam10996, Beta-Casp, Beta-Casp domain | 3e-30 | |
| pfam07521 | 43 | pfam07521, RMMBL, RNA-metabolising metallo-beta-la | 2e-11 | |
| pfam13679 | 143 | pfam13679, Methyltransf_32, Methyltransferase doma | 1e-09 | |
| pfam13679 | 143 | pfam13679, Methyltransf_32, Methyltransferase doma | 8e-05 | |
| TIGR04122 | 326 | TIGR04122, Xnuc_lig_assoc, putative exonuclease, D | 0.001 | |
| pfam03069 | 316 | pfam03069, FmdA_AmdA, Acetamidase/Formamidase fami | 0.004 |
| >gnl|CDD|224157 COG1236, YSH1, Predicted exonuclease of the beta-lactamase fold involved in RNA processing [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Score = 224 bits (573), Expect = 2e-64
Identities = 97/284 (34%), Positives = 136/284 (47%), Gaps = 8/284 (2%)
Query: 1 MFQVKVGNQSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTIRDSKRCRERDFL 60
++V I+YTGD DR L A + C D+LI ESTY + ++ ER F+
Sbjct: 148 AILLEVDGGRILYTGDVKRRKDRLLNGAELPPC-IDVLIVESTYGDRLHPNRDEVERRFI 206
Query: 61 KKVHECVDRGGKVLIPVFALGRAQELCILLETYWERMNLQAPIYFAVGLTEKATNYYKMF 120
+ V ++RGG VLIP FALGRAQEL ++L PIY + A Y K
Sbjct: 207 ESVKAALERGGTVLIPAFALGRAQELLLILRELGFAG--DYPIYVDGPIARVALAYAKYP 264
Query: 121 ITWTNQKIRKTFVQRNMFDFKHIRPFDKSFIDNPGPMVVFATPGMLHSGLSLIIFKKWAP 180
I + K R + R + ID GP VV A PGML G S K
Sbjct: 265 IGLDLPDLLKVAESR-FRFVESRRNSMREGID-KGPAVVLAAPGMLKGGRSRYYLKHLLS 322
Query: 181 VENNMLIMPGFCVQGTIGHKVLSGVKKLEFENKQIIDVKMAIEYMSFSAHADAKGIMQLI 240
E N +++PG+ +GT+G +L G + I VK +E + FSAHAD +++ I
Sbjct: 323 DEKNWVLLPGYQAEGTLGRVLLEGGTSVH-IKGIEIKVKARVEELDFSAHADGDELLEFI 381
Query: 241 QYCEPKNVLLVHGEASKMVFLKEKIKQEF--NLDCFMPANGESC 282
+ P V+LVHGE L+ ++ +E + +PANGE
Sbjct: 382 KDISPPKVVLVHGEPEYGAALRARLLEELIGIRELELPANGEEY 425
|
Length = 427 |
| >gnl|CDD|188365 TIGR03675, arCOG00543, arCOG00543 universal archaeal KH-domain/beta-lactamase-domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|224696 COG1782, COG1782, Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|214983 smart01027, Beta-Casp, Beta-Casp domain | Back alignment and domain information |
|---|
| >gnl|CDD|220932 pfam10996, Beta-Casp, Beta-Casp domain | Back alignment and domain information |
|---|
| >gnl|CDD|203663 pfam07521, RMMBL, RNA-metabolising metallo-beta-lactamase | Back alignment and domain information |
|---|
| >gnl|CDD|222313 pfam13679, Methyltransf_32, Methyltransferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|222313 pfam13679, Methyltransf_32, Methyltransferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|200373 TIGR04122, Xnuc_lig_assoc, putative exonuclease, DNA ligase-associated | Back alignment and domain information |
|---|
| >gnl|CDD|202525 pfam03069, FmdA_AmdA, Acetamidase/Formamidase family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1101 | |||
| KOG1136|consensus | 501 | 100.0 | ||
| KOG2651|consensus | 476 | 100.0 | ||
| KOG1137|consensus | 668 | 100.0 | ||
| COG1782 | 637 | Predicted metal-dependent RNase, consists of a met | 100.0 | |
| TIGR03675 | 630 | arCOG00543 arCOG00543 universal archaeal KH-domain | 100.0 | |
| COG1236 | 427 | YSH1 Predicted exonuclease of the beta-lactamase f | 100.0 | |
| KOG1135|consensus | 764 | 99.97 | ||
| PF13679 | 141 | Methyltransf_32: Methyltransferase domain | 99.96 | |
| KOG1138|consensus | 653 | 99.95 | ||
| TIGR00649 | 422 | MG423 conserved hypothetical protein. Contains an | 99.93 | |
| PF10996 | 126 | Beta-Casp: Beta-Casp domain; InterPro: IPR022712 T | 99.86 | |
| COG0595 | 555 | mRNA degradation ribonucleases J1/J2 (metallo-beta | 99.7 | |
| PF07521 | 43 | RMMBL: RNA-metabolising metallo-beta-lactamase; In | 99.09 | |
| KOG2651|consensus | 476 | 98.89 | ||
| PF11718 | 216 | CPSF73-100_C: Pre-mRNA 3'-end-processing endonucle | 98.15 | |
| KOG1361|consensus | 481 | 98.1 | ||
| PF05206 | 259 | TRM13: Methyltransferase TRM13; InterPro: IPR00787 | 97.68 | |
| KOG2811|consensus | 420 | 97.01 | ||
| PF12847 | 112 | Methyltransf_18: Methyltransferase domain; PDB: 3G | 96.7 | |
| TIGR00138 | 181 | gidB 16S rRNA methyltransferase GidB. GidB (glucos | 96.34 | |
| PF13847 | 152 | Methyltransf_31: Methyltransferase domain; PDB: 3T | 96.29 | |
| COG2230 | 283 | Cfa Cyclopropane fatty acid synthase and related m | 96.22 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 96.16 | |
| TIGR00477 | 195 | tehB tellurite resistance protein TehB. Part of a | 96.15 | |
| PF02353 | 273 | CMAS: Mycolic acid cyclopropane synthetase; InterP | 95.92 | |
| PRK00107 | 187 | gidB 16S rRNA methyltransferase GidB; Reviewed | 95.89 | |
| PRK11036 | 255 | putative S-adenosyl-L-methionine-dependent methylt | 95.85 | |
| TIGR03587 | 204 | Pse_Me-ase pseudaminic acid biosynthesis-associate | 95.81 | |
| PF13489 | 161 | Methyltransf_23: Methyltransferase domain; PDB: 3J | 95.81 | |
| COG2227 | 243 | UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- | 95.76 | |
| TIGR02021 | 219 | BchM-ChlM magnesium protoporphyrin O-methyltransfe | 95.58 | |
| PLN02244 | 340 | tocopherol O-methyltransferase | 95.55 | |
| smart00650 | 169 | rADc Ribosomal RNA adenine dimethylases. | 95.54 | |
| PRK11207 | 197 | tellurite resistance protein TehB; Provisional | 95.54 | |
| TIGR00080 | 215 | pimt protein-L-isoaspartate(D-aspartate) O-methylt | 95.52 | |
| PRK08287 | 187 | cobalt-precorrin-6Y C(15)-methyltransferase; Valid | 95.51 | |
| PRK13942 | 212 | protein-L-isoaspartate O-methyltransferase; Provis | 95.5 | |
| PRK14896 | 258 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 95.5 | |
| TIGR00452 | 314 | methyltransferase, putative. Known examples to dat | 95.48 | |
| PRK00274 | 272 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 95.44 | |
| TIGR02469 | 124 | CbiT precorrin-6Y C5,15-methyltransferase (decarbo | 95.42 | |
| PRK13944 | 205 | protein-L-isoaspartate O-methyltransferase; Provis | 95.42 | |
| COG4106 | 257 | Tam Trans-aconitate methyltransferase [General fun | 95.39 | |
| PRK01683 | 258 | trans-aconitate 2-methyltransferase; Provisional | 95.3 | |
| PRK10258 | 251 | biotin biosynthesis protein BioC; Provisional | 95.27 | |
| PRK07402 | 196 | precorrin-6B methylase; Provisional | 95.25 | |
| PF08241 | 95 | Methyltransf_11: Methyltransferase domain; InterPr | 95.24 | |
| PRK11705 | 383 | cyclopropane fatty acyl phospholipid synthase; Pro | 95.21 | |
| PLN02396 | 322 | hexaprenyldihydroxybenzoate methyltransferase | 95.2 | |
| PRK14103 | 255 | trans-aconitate 2-methyltransferase; Provisional | 95.2 | |
| PF07522 | 110 | DRMBL: DNA repair metallo-beta-lactamase; InterPro | 95.17 | |
| PRK06202 | 232 | hypothetical protein; Provisional | 95.14 | |
| PRK15451 | 247 | tRNA cmo(5)U34 methyltransferase; Provisional | 95.09 | |
| PTZ00098 | 263 | phosphoethanolamine N-methyltransferase; Provision | 94.95 | |
| TIGR00755 | 253 | ksgA dimethyladenosine transferase. Alternate name | 94.95 | |
| PRK07580 | 230 | Mg-protoporphyrin IX methyl transferase; Validated | 94.95 | |
| PRK00312 | 212 | pcm protein-L-isoaspartate O-methyltransferase; Re | 94.88 | |
| PRK15068 | 322 | tRNA mo(5)U34 methyltransferase; Provisional | 94.82 | |
| PRK12335 | 287 | tellurite resistance protein TehB; Provisional | 94.79 | |
| TIGR00537 | 179 | hemK_rel_arch HemK-related putative methylase. The | 94.79 | |
| KOG1270|consensus | 282 | 94.78 | ||
| TIGR00740 | 239 | methyltransferase, putative. A simple BLAST search | 94.72 | |
| PRK05785 | 226 | hypothetical protein; Provisional | 94.67 | |
| PF05175 | 170 | MTS: Methyltransferase small domain; InterPro: IPR | 94.62 | |
| PTZ00338 | 294 | dimethyladenosine transferase-like protein; Provis | 94.56 | |
| PRK05134 | 233 | bifunctional 3-demethylubiquinone-9 3-methyltransf | 94.56 | |
| TIGR03438 | 301 | probable methyltransferase. This model represents | 94.55 | |
| TIGR00406 | 288 | prmA ribosomal protein L11 methyltransferase. Ribo | 94.5 | |
| TIGR02081 | 194 | metW methionine biosynthesis protein MetW. This pr | 94.4 | |
| PRK14968 | 188 | putative methyltransferase; Provisional | 94.36 | |
| PRK00377 | 198 | cbiT cobalt-precorrin-6Y C(15)-methyltransferase; | 94.28 | |
| PHA03411 | 279 | putative methyltransferase; Provisional | 94.22 | |
| PF03848 | 192 | TehB: Tellurite resistance protein TehB; InterPro: | 94.14 | |
| PLN02233 | 261 | ubiquinone biosynthesis methyltransferase | 94.1 | |
| PRK00517 | 250 | prmA ribosomal protein L11 methyltransferase; Revi | 94.04 | |
| PRK00121 | 202 | trmB tRNA (guanine-N(7)-)-methyltransferase; Revie | 94.02 | |
| PRK03522 | 315 | rumB 23S rRNA methyluridine methyltransferase; Rev | 93.99 | |
| PRK11088 | 272 | rrmA 23S rRNA methyltransferase A; Provisional | 93.95 | |
| TIGR03840 | 213 | TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d | 93.92 | |
| PF01135 | 209 | PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl | 93.91 | |
| TIGR02752 | 231 | MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me | 93.91 | |
| COG4123 | 248 | Predicted O-methyltransferase [General function pr | 93.88 | |
| smart00828 | 224 | PKS_MT Methyltransferase in polyketide synthase (P | 93.87 | |
| PRK13255 | 218 | thiopurine S-methyltransferase; Reviewed | 93.76 | |
| TIGR02072 | 240 | BioC biotin biosynthesis protein BioC. This enzyme | 93.64 | |
| PLN02585 | 315 | magnesium protoporphyrin IX methyltransferase | 93.55 | |
| PF07021 | 193 | MetW: Methionine biosynthesis protein MetW; InterP | 93.37 | |
| PF08242 | 99 | Methyltransf_12: Methyltransferase domain; InterPr | 93.37 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 93.33 | |
| PRK14967 | 223 | putative methyltransferase; Provisional | 93.28 | |
| PF13659 | 117 | Methyltransf_26: Methyltransferase domain; PDB: 3G | 93.27 | |
| PHA03412 | 241 | putative methyltransferase; Provisional | 93.22 | |
| TIGR03533 | 284 | L3_gln_methyl protein-(glutamine-N5) methyltransfe | 93.21 | |
| PRK11805 | 307 | N5-glutamine S-adenosyl-L-methionine-dependent met | 93.21 | |
| PRK08317 | 241 | hypothetical protein; Provisional | 93.07 | |
| TIGR03704 | 251 | PrmC_rel_meth putative protein-(glutamine-N5) meth | 93.05 | |
| TIGR00091 | 194 | tRNA (guanine-N(7)-)-methyltransferase. In E. coli | 93.02 | |
| cd02440 | 107 | AdoMet_MTases S-adenosylmethionine-dependent methy | 92.95 | |
| PRK13943 | 322 | protein-L-isoaspartate O-methyltransferase; Provis | 92.87 | |
| PRK09328 | 275 | N5-glutamine S-adenosyl-L-methionine-dependent met | 92.76 | |
| COG2518 | 209 | Pcm Protein-L-isoaspartate carboxylmethyltransfera | 92.7 | |
| PF13649 | 101 | Methyltransf_25: Methyltransferase domain; PDB: 3B | 92.65 | |
| TIGR01983 | 224 | UbiG ubiquinone biosynthesis O-methyltransferase. | 92.61 | |
| PRK00216 | 239 | ubiE ubiquinone/menaquinone biosynthesis methyltra | 92.53 | |
| TIGR00478 | 228 | tly hemolysin TlyA family protein. Hemolysins are | 92.49 | |
| COG2263 | 198 | Predicted RNA methylase [Translation, ribosomal st | 92.43 | |
| PF01209 | 233 | Ubie_methyltran: ubiE/COQ5 methyltransferase famil | 92.41 | |
| PF00398 | 262 | RrnaAD: Ribosomal RNA adenine dimethylase; InterPr | 92.38 | |
| PRK06922 | 677 | hypothetical protein; Provisional | 92.37 | |
| TIGR00536 | 284 | hemK_fam HemK family putative methylases. The gene | 92.32 | |
| COG0030 | 259 | KsgA Dimethyladenosine transferase (rRNA methylati | 92.24 | |
| PRK09489 | 342 | rsmC 16S ribosomal RNA m2G1207 methyltransferase; | 92.23 | |
| TIGR03534 | 251 | RF_mod_PrmC protein-(glutamine-N5) methyltransfera | 92.21 | |
| PLN02781 | 234 | Probable caffeoyl-CoA O-methyltransferase | 92.18 | |
| TIGR02650 | 277 | RNase_Z_T_toga ribonuclease Z, Thermotoga type. Me | 91.94 | |
| PRK10909 | 199 | rsmD 16S rRNA m(2)G966-methyltransferase; Provisio | 91.78 | |
| PRK13168 | 443 | rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe | 91.78 | |
| PRK14966 | 423 | unknown domain/N5-glutamine S-adenosyl-L-methionin | 91.76 | |
| PF08123 | 205 | DOT1: Histone methylation protein DOT1 ; InterPro: | 91.72 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 91.71 | |
| PRK04266 | 226 | fibrillarin; Provisional | 91.62 | |
| PRK04457 | 262 | spermidine synthase; Provisional | 91.53 | |
| PRK15001 | 378 | SAM-dependent 23S ribosomal RNA mG1835 methyltrans | 91.38 | |
| TIGR00479 | 431 | rumA 23S rRNA (uracil-5-)-methyltransferase RumA. | 91.34 | |
| TIGR02085 | 374 | meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer | 91.27 | |
| TIGR01934 | 223 | MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis | 91.08 | |
| PRK01544 | 506 | bifunctional N5-glutamine S-adenosyl-L-methionine- | 91.04 | |
| COG2242 | 187 | CobL Precorrin-6B methylase 2 [Coenzyme metabolism | 90.97 | |
| TIGR00438 | 188 | rrmJ cell division protein FtsJ. | 90.96 | |
| PF06325 | 295 | PrmA: Ribosomal protein L11 methyltransferase (Prm | 90.75 | |
| TIGR02716 | 306 | C20_methyl_CrtF C-20 methyltransferase BchU. Membe | 90.54 | |
| PRK10901 | 427 | 16S rRNA methyltransferase B; Provisional | 90.5 | |
| PRK14121 | 390 | tRNA (guanine-N(7)-)-methyltransferase; Provisiona | 90.41 | |
| COG2890 | 280 | HemK Methylase of polypeptide chain release factor | 90.32 | |
| PF05724 | 218 | TPMT: Thiopurine S-methyltransferase (TPMT); Inter | 90.15 | |
| TIGR01444 | 143 | fkbM_fam methyltransferase, FkbM family. Members o | 89.97 | |
| TIGR01177 | 329 | conserved hypothetical protein TIGR01177. This fam | 89.73 | |
| COG2813 | 300 | RsmC 16S RNA G1207 methylase RsmC [Translation, ri | 89.73 | |
| TIGR02143 | 353 | trmA_only tRNA (uracil-5-)-methyltransferase. This | 89.71 | |
| PF05401 | 201 | NodS: Nodulation protein S (NodS); InterPro: IPR00 | 89.71 | |
| COG2264 | 300 | PrmA Ribosomal protein L11 methylase [Translation, | 89.17 | |
| PF08003 | 315 | Methyltransf_9: Protein of unknown function (DUF16 | 89.12 | |
| PRK13256 | 226 | thiopurine S-methyltransferase; Reviewed | 89.06 | |
| PRK14902 | 444 | 16S rRNA methyltransferase B; Provisional | 89.04 | |
| PRK14904 | 445 | 16S rRNA methyltransferase B; Provisional | 88.98 | |
| KOG1541|consensus | 270 | 88.97 | ||
| PF02390 | 195 | Methyltransf_4: Putative methyltransferase ; Inter | 88.72 | |
| PRK11727 | 321 | 23S rRNA mA1618 methyltransferase; Provisional | 88.68 | |
| PF01596 | 205 | Methyltransf_3: O-methyltransferase; InterPro: IPR | 88.57 | |
| PRK11873 | 272 | arsM arsenite S-adenosylmethyltransferase; Reviewe | 88.5 | |
| TIGR00563 | 426 | rsmB ribosomal RNA small subunit methyltransferase | 88.26 | |
| TIGR00446 | 264 | nop2p NOL1/NOP2/sun family putative RNA methylase. | 88.26 | |
| PRK14903 | 431 | 16S rRNA methyltransferase B; Provisional | 88.11 | |
| TIGR00095 | 189 | RNA methyltransferase, RsmD family. This model rep | 87.65 | |
| PLN02490 | 340 | MPBQ/MSBQ methyltransferase | 87.56 | |
| PF00891 | 241 | Methyltransf_2: O-methyltransferase; InterPro: IPR | 87.54 | |
| KOG1271|consensus | 227 | 87.48 | ||
| COG2226 | 238 | UbiE Methylase involved in ubiquinone/menaquinone | 87.46 | |
| PRK05031 | 362 | tRNA (uracil-5-)-methyltransferase; Validated | 86.49 | |
| PRK11188 | 209 | rrmJ 23S rRNA methyltransferase J; Provisional | 86.47 | |
| KOG3420|consensus | 185 | 86.33 | ||
| PRK14901 | 434 | 16S rRNA methyltransferase B; Provisional | 86.06 | |
| TIGR03307 | 238 | PhnP phosphonate metabolism protein PhnP. This fam | 86.04 | |
| PF12706 | 194 | Lactamase_B_2: Beta-lactamase superfamily domain; | 85.92 | |
| PRK00050 | 296 | 16S rRNA m(4)C1402 methyltranserfase; Provisional | 85.85 | |
| PRK00811 | 283 | spermidine synthase; Provisional | 85.72 | |
| PLN02476 | 278 | O-methyltransferase | 84.89 | |
| PLN02672 | 1082 | methionine S-methyltransferase | 84.62 | |
| PF05958 | 352 | tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas | 84.44 | |
| COG4076 | 252 | Predicted RNA methylase [General function predicti | 84.16 | |
| PLN03075 | 296 | nicotianamine synthase; Provisional | 83.73 | |
| PRK11244 | 250 | phnP carbon-phosphorus lyase complex accessory pro | 81.27 | |
| KOG2899|consensus | 288 | 81.04 | ||
| PF03291 | 331 | Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 | 80.95 | |
| smart00138 | 264 | MeTrc Methyltransferase, chemotaxis proteins. Meth | 80.84 | |
| COG4122 | 219 | Predicted O-methyltransferase [General function pr | 80.82 | |
| KOG1499|consensus | 346 | 80.41 | ||
| PRK00685 | 228 | metal-dependent hydrolase; Provisional | 80.2 | |
| TIGR00417 | 270 | speE spermidine synthase. the SpeE subunit of sper | 80.05 |
| >KOG1136|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.2e-74 Score=619.83 Aligned_cols=333 Identities=64% Similarity=1.120 Sum_probs=310.5
Q ss_pred CEEEEECCEEEEEEcCCCCCCCCCCCCcccCCCCCcEEEEcCCCCCCCCCChhHHHHHHHHHHHHHHhCCCeEEEeecch
Q psy9966 1 MFQVKVGNQSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTIRDSKRCRERDFLKKVHECVDRGGKVLIPVFAL 80 (1101)
Q Consensus 1 Mf~Ie~~g~rIlYTGDf~~~~dr~L~~a~ip~~~~DvLI~ESTYg~~~~~~r~~rE~~f~~~I~etl~~GG~VLIPvFAl 80 (1101)
||+|..|+.+|+||||||+++||||++|++.+.+||+||+|||||++.++++..||++|++.|++++.+||+||||+|||
T Consensus 163 Mf~ikvGd~svvYTGDYnmTpDrHLGaA~id~~rpdlLIsESTYattiRdskr~rERdFLk~VhecVa~GGkvlIPvFAL 242 (501)
T KOG1136|consen 163 MFYIKVGDQSVVYTGDYNMTPDRHLGAAWIDKCRPDLLISESTYATTIRDSKRCRERDFLKKVHECVARGGKVLIPVFAL 242 (501)
T ss_pred EEEEEecceeEEEecCccCCcccccchhhhccccCceEEeeccceeeeccccchhHHHHHHHHHHHHhcCCeEEEEeeec
Confidence 89999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hHHHHHHHHHHHHHHhcCCCccEEEeChHHHHHHHHHHHhHhhhhHHHHHhhhhcCCCcCCCccccCccccCCCCCeEEE
Q psy9966 81 GRAQELCILLETYWERMNLQAPIYFAVGLTEKATNYYKMFITWTNQKIRKTFVQRNMFDFKHIRPFDKSFIDNPGPMVVF 160 (1101)
Q Consensus 81 GRaQELl~iL~~~w~~~~~~vPIy~~s~la~k~~~vy~~~~~~ln~~i~~~f~~~npF~fk~i~~~~~~~~~~~gp~VVi 160 (1101)
||||||+.+|+.||+++++++|||+.++++.+++.+|+.++.|.|++++++|..+|+|+|+|++++++...+.+||+|+|
T Consensus 243 GRAQElCiLLd~YWERm~lk~Piyfs~Glte~an~yyk~fiswtn~~v~k~~~~rNmfdfkhiKpfd~~~~~~pGp~VlF 322 (501)
T KOG1136|consen 243 GRAQELCILLDDYWERMNLKVPIYFSSGLTEKANMYYKMFISWTNENVKKKFVERNMFDFKHIKPFDRSYIEAPGPMVLF 322 (501)
T ss_pred chHHHHHHHHHHHHHhhccCCCccccccccchhchHhhhhhhhcccchhhhhccCCccccccCChhhhhhhcCCCCEEEE
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EcCCCCCCchHHHHHHHhCCCCCCeEEEecccCCCcchhhhhcCcceEEecCCeeEEEeeEEEEEecccCCCHHHHHHHH
Q psy9966 161 ATPGMLHSGLSLIIFKKWAPVENNMLIMPGFCVQGTIGHKVLSGVKKLEFENKQIIDVKMAIEYMSFSAHADAKGIMQLI 240 (1101)
Q Consensus 161 aspGmL~~G~s~~~~~~w~~d~~N~VI~tGy~~~GT~g~~Ll~g~k~i~l~~g~~i~v~~~V~~i~fSaHAD~~~l~~~I 240 (1101)
||||||.+|.|++.|++||+||.|+||++|||+.||.|.++++|++++++. |+.+.+++.|++++||+|||..+|+++|
T Consensus 323 atPGMLhaG~SLkvFK~W~~~~~NlvimPGYcV~GTvG~kvl~G~~kvei~-~~~~eirl~V~~maFSaHaDAkGIm~li 401 (501)
T KOG1136|consen 323 ATPGMLHAGFSLKVFKKWCPDPLNLVIMPGYCVAGTVGHKVLNGATKVEIY-GTKVEIRLKVEYMAFSAHADAKGIMQLI 401 (501)
T ss_pred cCCcccccccchHHHHhhCCCccceEeecCceeccchhhhhhCCccEEEEe-eeEEEEEEEEEEeeeccccCchhHHHHH
Confidence 999999999999999999999999999999999999999999999999998 7899999999999999999999999999
Q ss_pred HHhCCCEEEEecCChhHHHHHHHHHHHHcCCceeecCCCCEEEEecCceeeEecchhhHHHHHh----hcCCCCCCCCCc
Q psy9966 241 QYCEPKNVLLVHGEASKMVFLKEKIKQEFNLDCFMPANGESCFVQTDMKISIDVSVNLLKEEAV----KYNSEPPNPLKE 316 (1101)
Q Consensus 241 ~~l~Pk~VILVHGe~~~m~~Lk~~L~~e~gi~v~~P~nGe~v~l~~~~~~~v~~~~~ll~~~~~----~~~~~~p~~~~~ 316 (1101)
+.+.|+||++||||..+|..|+.++.+++++++|+|.|||++.|+..+.+.+.++.+.+....+ .-+...+.+...
T Consensus 402 ~~csPknVmlVHGE~~kM~~Lk~ki~~e~~ip~~mPaNGetv~i~s~~~i~~ri~~~~~~~~~k~~~k~s~~qlr~~~~r 481 (501)
T KOG1136|consen 402 KQCSPKNVMLVHGEKSKMKFLKEKIESEFDIPTFMPANGETVVISSTTYIKARIPDEFLVSLSKPNLKFSSTQLRVTDHR 481 (501)
T ss_pred HhcCcceEEEEeccchhhHHHHHhhHhhcCCceeeCCCCCEEEecccceeeecCcHHHHHHhcCcccccccccCCCCccc
Confidence 9999999999999999999999999999999999999999999999988888888777643211 101123344444
Q ss_pred cceeEEEEeeCCceeeec
Q psy9966 317 RQIHGVLVIKDSSISLMD 334 (1101)
Q Consensus 317 ~~~~G~Lv~~d~~~~l~~ 334 (1101)
....++++++|++.++++
T Consensus 482 ~~~g~~v~~kd~~~~i~~ 499 (501)
T KOG1136|consen 482 TADGVLVIEKDKKAKIVH 499 (501)
T ss_pred ccCceEEEEecchhhhcc
Confidence 555667777888887764
|
|
| >KOG2651|consensus | Back alignment and domain information |
|---|
| >KOG1137|consensus | Back alignment and domain information |
|---|
| >COG1782 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03675 arCOG00543 arCOG00543 universal archaeal KH-domain/beta-lactamase-domain protein | Back alignment and domain information |
|---|
| >COG1236 YSH1 Predicted exonuclease of the beta-lactamase fold involved in RNA processing [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1135|consensus | Back alignment and domain information |
|---|
| >PF13679 Methyltransf_32: Methyltransferase domain | Back alignment and domain information |
|---|
| >KOG1138|consensus | Back alignment and domain information |
|---|
| >TIGR00649 MG423 conserved hypothetical protein | Back alignment and domain information |
|---|
| >PF10996 Beta-Casp: Beta-Casp domain; InterPro: IPR022712 The beta-CASP domain is found C-terminal to the beta-lactamase domain in pre-mRNA 3'-end-processing endonuclease | Back alignment and domain information |
|---|
| >COG0595 mRNA degradation ribonucleases J1/J2 (metallo-beta-lactamase superfamily) [Translation, ribosomal structure and biogenesis; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF07521 RMMBL: RNA-metabolising metallo-beta-lactamase; InterPro: IPR011108 The metallo-beta-lactamase fold contains five sequence motifs | Back alignment and domain information |
|---|
| >KOG2651|consensus | Back alignment and domain information |
|---|
| >PF11718 CPSF73-100_C: Pre-mRNA 3'-end-processing endonuclease polyadenylation factor C-term; InterPro: IPR021718 This is the C-terminal conserved region of the pre-mRNA 3'-end-processing of the polyadenylation factor CPSF-73/CPSF-100 proteins | Back alignment and domain information |
|---|
| >KOG1361|consensus | Back alignment and domain information |
|---|
| >PF05206 TRM13: Methyltransferase TRM13; InterPro: IPR007871 This entry consists of eukaryotic and bacterial proteins that specifically methylates guanosine-4 in various tRNAs with a Gly(CCG), His or Pro signatures [] | Back alignment and domain information |
|---|
| >KOG2811|consensus | Back alignment and domain information |
|---|
| >PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A | Back alignment and domain information |
|---|
| >TIGR00138 gidB 16S rRNA methyltransferase GidB | Back alignment and domain information |
|---|
| >PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A | Back alignment and domain information |
|---|
| >COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00477 tehB tellurite resistance protein TehB | Back alignment and domain information |
|---|
| >PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) | Back alignment and domain information |
|---|
| >PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed | Back alignment and domain information |
|---|
| >PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase | Back alignment and domain information |
|---|
| >PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C | Back alignment and domain information |
|---|
| >COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase | Back alignment and domain information |
|---|
| >PLN02244 tocopherol O-methyltransferase | Back alignment and domain information |
|---|
| >smart00650 rADc Ribosomal RNA adenine dimethylases | Back alignment and domain information |
|---|
| >PRK11207 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase | Back alignment and domain information |
|---|
| >PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00452 methyltransferase, putative | Back alignment and domain information |
|---|
| >PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit | Back alignment and domain information |
|---|
| >PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01683 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10258 biotin biosynthesis protein BioC; Provisional | Back alignment and domain information |
|---|
| >PRK07402 precorrin-6B methylase; Provisional | Back alignment and domain information |
|---|
| >PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional | Back alignment and domain information |
|---|
| >PLN02396 hexaprenyldihydroxybenzoate methyltransferase | Back alignment and domain information |
|---|
| >PRK14103 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF07522 DRMBL: DNA repair metallo-beta-lactamase; InterPro: IPR011084 The metallo-beta-lactamase fold contains five sequence motifs | Back alignment and domain information |
|---|
| >PRK06202 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PTZ00098 phosphoethanolamine N-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00755 ksgA dimethyladenosine transferase | Back alignment and domain information |
|---|
| >PRK07580 Mg-protoporphyrin IX methyl transferase; Validated | Back alignment and domain information |
|---|
| >PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK15068 tRNA mo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK12335 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >TIGR00537 hemK_rel_arch HemK-related putative methylase | Back alignment and domain information |
|---|
| >KOG1270|consensus | Back alignment and domain information |
|---|
| >TIGR00740 methyltransferase, putative | Back alignment and domain information |
|---|
| >PRK05785 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases | Back alignment and domain information |
|---|
| >PTZ00338 dimethyladenosine transferase-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional | Back alignment and domain information |
|---|
| >TIGR03438 probable methyltransferase | Back alignment and domain information |
|---|
| >TIGR00406 prmA ribosomal protein L11 methyltransferase | Back alignment and domain information |
|---|
| >TIGR02081 metW methionine biosynthesis protein MetW | Back alignment and domain information |
|---|
| >PRK14968 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PHA03411 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB | Back alignment and domain information |
|---|
| >PLN02233 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK11088 rrmA 23S rRNA methyltransferase A; Provisional | Back alignment and domain information |
|---|
| >TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family | Back alignment and domain information |
|---|
| >PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 | Back alignment and domain information |
|---|
| >TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase | Back alignment and domain information |
|---|
| >COG4123 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes | Back alignment and domain information |
|---|
| >PRK13255 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02072 BioC biotin biosynthesis protein BioC | Back alignment and domain information |
|---|
| >PLN02585 magnesium protoporphyrin IX methyltransferase | Back alignment and domain information |
|---|
| >PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins | Back alignment and domain information |
|---|
| >PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >PRK14967 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A | Back alignment and domain information |
|---|
| >PHA03412 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific | Back alignment and domain information |
|---|
| >PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08317 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific | Back alignment and domain information |
|---|
| >TIGR00091 tRNA (guanine-N(7)-)-methyltransferase | Back alignment and domain information |
|---|
| >cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) | Back alignment and domain information |
|---|
| >PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A | Back alignment and domain information |
|---|
| >TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase | Back alignment and domain information |
|---|
| >PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00478 tly hemolysin TlyA family protein | Back alignment and domain information |
|---|
| >COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] | Back alignment and domain information |
|---|
| >PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e | Back alignment and domain information |
|---|
| >PRK06922 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00536 hemK_fam HemK family putative methylases | Back alignment and domain information |
|---|
| >COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific | Back alignment and domain information |
|---|
| >PLN02781 Probable caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >TIGR02650 RNase_Z_T_toga ribonuclease Z, Thermotoga type | Back alignment and domain information |
|---|
| >PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional | Back alignment and domain information |
|---|
| >PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >PRK04266 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >PRK04457 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA | Back alignment and domain information |
|---|
| >TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB | Back alignment and domain information |
|---|
| >TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases | Back alignment and domain information |
|---|
| >PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR00438 rrmJ cell division protein FtsJ | Back alignment and domain information |
|---|
| >PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences | Back alignment and domain information |
|---|
| >TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU | Back alignment and domain information |
|---|
| >PRK10901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >TIGR01444 fkbM_fam methyltransferase, FkbM family | Back alignment and domain information |
|---|
| >TIGR01177 conserved hypothetical protein TIGR01177 | Back alignment and domain information |
|---|
| >COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase | Back alignment and domain information |
|---|
| >PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins | Back alignment and domain information |
|---|
| >COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK13256 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK14902 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK14904 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >KOG1541|consensus | Back alignment and domain information |
|---|
| >PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 | Back alignment and domain information |
|---|
| >PRK11727 23S rRNA mA1618 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases | Back alignment and domain information |
|---|
| >PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB | Back alignment and domain information |
|---|
| >TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase | Back alignment and domain information |
|---|
| >PRK14903 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >TIGR00095 RNA methyltransferase, RsmD family | Back alignment and domain information |
|---|
| >PLN02490 MPBQ/MSBQ methyltransferase | Back alignment and domain information |
|---|
| >PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >KOG1271|consensus | Back alignment and domain information |
|---|
| >COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK05031 tRNA (uracil-5-)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional | Back alignment and domain information |
|---|
| >KOG3420|consensus | Back alignment and domain information |
|---|
| >PRK14901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >TIGR03307 PhnP phosphonate metabolism protein PhnP | Back alignment and domain information |
|---|
| >PF12706 Lactamase_B_2: Beta-lactamase superfamily domain; PDB: 3BV6_F 1WW1_A 2E7Y_A 3RPC_D 3ZWF_A 3JXP_A 1XTO_A 2CBN_A 3G1P_B 3P2U_A | Back alignment and domain information |
|---|
| >PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional | Back alignment and domain information |
|---|
| >PRK00811 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PLN02476 O-methyltransferase | Back alignment and domain information |
|---|
| >PLN02672 methionine S-methyltransferase | Back alignment and domain information |
|---|
| >PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 | Back alignment and domain information |
|---|
| >COG4076 Predicted RNA methylase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03075 nicotianamine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK11244 phnP carbon-phosphorus lyase complex accessory protein; Provisional | Back alignment and domain information |
|---|
| >KOG2899|consensus | Back alignment and domain information |
|---|
| >PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes | Back alignment and domain information |
|---|
| >smart00138 MeTrc Methyltransferase, chemotaxis proteins | Back alignment and domain information |
|---|
| >COG4122 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1499|consensus | Back alignment and domain information |
|---|
| >PRK00685 metal-dependent hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR00417 speE spermidine synthase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1101 | ||||
| 2i7t_A | 459 | Structure Of Human Cpsf-73 Length = 459 | 1e-57 | ||
| 3af5_A | 651 | The Crystal Structure Of An Archaeal Cpsf Subunit, | 3e-32 | ||
| 2ycb_A | 636 | Structure Of The Archaeal Beta-Casp Protein With N- | 3e-28 | ||
| 2xr1_A | 640 | Dimeric Archaeal Cleavage And Polyadenylation Speci | 9e-26 | ||
| 3a4y_A | 431 | Crystal Structure Of H61a Mutant Ttha0252 From Ther | 4e-21 | ||
| 3iek_A | 431 | Crystal Structure Of Native Ttha0252 From Thermus T | 4e-21 | ||
| 3idz_A | 431 | Crystal Structure Of S378q Mutant Ttha0252 From The | 2e-20 | ||
| 3ie0_A | 431 | Crystal Structure Of S378y Mutant Ttha0252 From The | 2e-20 | ||
| 3ie2_A | 431 | Crystal Structure Of H400v Mutant Ttha0252 From The | 5e-20 | ||
| 3ie1_A | 431 | Crystal Structure Of H380a Mutant Ttha0252 From The | 6e-20 | ||
| 2dkf_A | 431 | Crystal Structure Of Ttha0252 From Thermus Thermoph | 3e-19 |
| >pdb|2I7T|A Chain A, Structure Of Human Cpsf-73 Length = 459 | Back alignment and structure |
|
| >pdb|3AF5|A Chain A, The Crystal Structure Of An Archaeal Cpsf Subunit, Ph1404 From Pyrococcus Horikoshii Length = 651 | Back alignment and structure |
| >pdb|2YCB|A Chain A, Structure Of The Archaeal Beta-Casp Protein With N-Terminal Kh Domains From Methanothermobacter Thermautotrophicus Length = 636 | Back alignment and structure |
| >pdb|2XR1|A Chain A, Dimeric Archaeal Cleavage And Polyadenylation Specificity Factor With N-Terminal Kh Domains (Kh-Cpsf) From Methanosarcina Mazei Length = 640 | Back alignment and structure |
| >pdb|3A4Y|A Chain A, Crystal Structure Of H61a Mutant Ttha0252 From Thermus Thermophilus Hb8 Length = 431 | Back alignment and structure |
| >pdb|3IEK|A Chain A, Crystal Structure Of Native Ttha0252 From Thermus Thermophilus Hb8 Length = 431 | Back alignment and structure |
| >pdb|3IDZ|A Chain A, Crystal Structure Of S378q Mutant Ttha0252 From Thermus Thermophilus Hb8 Length = 431 | Back alignment and structure |
| >pdb|3IE0|A Chain A, Crystal Structure Of S378y Mutant Ttha0252 From Thermus Thermophilus Hb8 Length = 431 | Back alignment and structure |
| >pdb|3IE2|A Chain A, Crystal Structure Of H400v Mutant Ttha0252 From Thermus Thermophilus Hb8 Length = 431 | Back alignment and structure |
| >pdb|3IE1|A Chain A, Crystal Structure Of H380a Mutant Ttha0252 From Thermus Thermophilus Hb8 Complexed With Rna Length = 431 | Back alignment and structure |
| >pdb|2DKF|A Chain A, Crystal Structure Of Ttha0252 From Thermus Thermophilus Hb8, A Rna Degradation Protein Of The Metallo-Beta-Lactamase Superfamily Length = 431 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2i7t_A Cleavage and polyadenylation specificity factor 73 kDa subunit; metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination; 2.10A {Homo sapiens} SCOP: d.157.1.10 PDB: 2i7v_A Length = 459 | Back alignment and structure |
|---|
Score = 380 bits (979), Expect = e-121
Identities = 114/290 (39%), Positives = 175/290 (60%), Gaps = 9/290 (3%)
Query: 1 MFQVKVGNQSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTIRDSKRCRERDFL 60
MF +++ ++YTGD++ DRHL AA I +PD+LI ESTY T I + + RE F
Sbjct: 164 MFMIEIAGVKLLYTGDFSRQEDRHLMAAEIPNIKPDILIIESTYGTHIHEKREEREARFC 223
Query: 61 KKVHECVDRGGKVLIPVFALGRAQELCILLETYWERMNL--QAPIYFAVGLTEKATNYYK 118
VH+ V+RGG+ LIPVFALGRAQEL ++L+ YW+ PIY+A L +K Y+
Sbjct: 224 NTVHDIVNRGGRGLIPVFALGRAQELLLILDEYWQNHPELHDIPIYYASSLAKKCMAVYQ 283
Query: 119 MFITWTNQKIRKTFVQRNMFDFKHIRPFD-KSFIDNPGPMVVFATPGMLHSGLSLIIFKK 177
++ N KIRK N F FKHI D+ GP VV A+PGM+ SGLS +F+
Sbjct: 284 TYVNAMNDKIRKQININNPFVFKHISNLKSMDHFDDIGPSVVMASPGMMQSGLSRELFES 343
Query: 178 WAPVENNMLIMPGFCVQGTIGHKVLSGVKKLEFENKQIIDVKMAIEYMSFSAHADAKGIM 237
W + N +I+ G+CV+GT+ ++S +++ + Q + +KM+++Y+SFSAH D +
Sbjct: 344 WCTDKRNGVIIAGYCVEGTLAKHIMSEPEEITTMSGQKLPLKMSVDYISFSAHTDYQQTS 403
Query: 238 QLIQYCEPKNVLLVHGEASKMVFLKEKIKQEF------NLDCFMPANGES 281
+ I+ +P +V+LVHGE ++M LK + +E+ +++ P N E+
Sbjct: 404 EFIRALKPPHVILVHGEQNEMARLKAALIREYEDNDEVHIEVHNPRNTEA 453
|
| >3iek_A Ribonuclease TTHA0252; metallo beta lactamase fold, endonuclease, hydrolase, metal- nuclease, RNA-binding, rRNA processing; HET: FLC; 2.05A {Thermus thermophilus} PDB: 2dkf_A* 3iel_A* 3iem_A* 2zdf_A* 3idz_A* 2zdd_A* 3ie0_A* 2zde_A* 3ie1_A* 2zdw_A* 3a4y_A* 2yvd_A* 3ie2_A* Length = 431 | Back alignment and structure |
|---|
| >3af5_A Putative uncharacterized protein PH1404; archaeal CPSF, beta-CAsp family, KH domain, ribonuclease, ME beta-lactamase superfamily, archaea; 2.60A {Pyrococcus horikoshii} PDB: 3af6_A* Length = 651 | Back alignment and structure |
|---|
| >2ycb_A Beta-CAsp RNAse, cleavage and polyadenylation specificity factor; hydrolase, KH, metallo-beta-lactamase; 3.10A {Methanothermobacter thermautotrophicusorganism_taxid} Length = 636 | Back alignment and structure |
|---|
| >2xr1_A Cleavage and polyadenylation specificity factor 1 subunit; hydrolase, metallo-beta-lactamase, beta-CAsp, RNA processing; 2.59A {Methanosarcina mazei} Length = 640 | Back alignment and structure |
|---|
| >2i7x_A Protein CFT2; polyadenylation, metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination, double-strand break repair; 2.50A {Saccharomyces cerevisiae} SCOP: d.157.1.10 Length = 717 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1101 | |||
| 3iek_A | 431 | Ribonuclease TTHA0252; metallo beta lactamase fold | 100.0 | |
| 2i7t_A | 459 | Cleavage and polyadenylation specificity factor 73 | 100.0 | |
| 3af5_A | 651 | Putative uncharacterized protein PH1404; archaeal | 100.0 | |
| 2xr1_A | 640 | Cleavage and polyadenylation specificity factor 1 | 100.0 | |
| 2ycb_A | 636 | Beta-CAsp RNAse, cleavage and polyadenylation spec | 100.0 | |
| 2i7x_A | 717 | Protein CFT2; polyadenylation, metallo-B-lactamase | 99.97 | |
| 3zq4_A | 555 | Ribonuclease J 1, RNAse J1; hydrolase, RNA maturat | 99.95 | |
| 3bk2_A | 562 | RNAse J, metal dependent hydrolase; endoribonuclea | 99.94 | |
| 2az4_A | 429 | Hypothetical protein EF2904; structural genomics, | 99.79 | |
| 3zdk_A | 336 | 5' exonuclease apollo; hydrolase; HET: TLA; 2.16A | 99.71 | |
| 4b87_A | 367 | DNA cross-LINK repair 1A protein; dclre1A, DCLRE, | 99.66 | |
| 3tqs_A | 255 | Ribosomal RNA small subunit methyltransferase A; p | 96.7 | |
| 3gru_A | 295 | Dimethyladenosine transferase; rossman fold, ribos | 96.57 | |
| 3mti_A | 185 | RRNA methylase; SAM-dependent, PSI, MCSG, structur | 96.5 | |
| 2gb4_A | 252 | Thiopurine S-methyltransferase; 18204406, thiopuri | 96.45 | |
| 2yxd_A | 183 | Probable cobalt-precorrin-6Y C(15)-methyltransfer | 96.33 | |
| 1pjz_A | 203 | Thiopurine S-methyltransferase; polymorphism, S-ad | 96.29 | |
| 3ofk_A | 216 | Nodulation protein S; NODS, N-methyltransferase, S | 96.25 | |
| 4gek_A | 261 | TRNA (CMO5U34)-methyltransferase; structural genom | 96.25 | |
| 3njr_A | 204 | Precorrin-6Y methylase; methyltransferase, decarbo | 96.18 | |
| 1nkv_A | 256 | Hypothetical protein YJHP; structural genomics, PS | 96.15 | |
| 3orh_A | 236 | Guanidinoacetate N-methyltransferase; structura ge | 96.13 | |
| 3jwg_A | 219 | HEN1, methyltransferase type 12; 1.90A {Clostridiu | 96.03 | |
| 3u81_A | 221 | Catechol O-methyltransferase; neurotransmitter deg | 96.03 | |
| 3bus_A | 273 | REBM, methyltransferase; rebeccamycin synthesis; H | 96.03 | |
| 2esr_A | 177 | Methyltransferase; structural genomics, hypothetic | 96.01 | |
| 3duw_A | 223 | OMT, O-methyltransferase, putative; alternating of | 96.01 | |
| 3opn_A | 232 | Putative hemolysin; structural genomics, PSI-2, pr | 96.0 | |
| 3jwh_A | 217 | HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena | 95.99 | |
| 3fut_A | 271 | Dimethyladenosine transferase; methyltransferase, | 95.96 | |
| 2k4m_A | 153 | TR8_protein, UPF0146 protein MTH_1000; alpha+beta, | 95.93 | |
| 3tr6_A | 225 | O-methyltransferase; cellular processes; HET: SAH; | 95.91 | |
| 3lbf_A | 210 | Protein-L-isoaspartate O-methyltransferase; modifi | 95.89 | |
| 4dzr_A | 215 | Protein-(glutamine-N5) methyltransferase, release | 95.87 | |
| 3ntv_A | 232 | MW1564 protein; rossmann fold, putative methyltran | 95.87 | |
| 2fhp_A | 187 | Methylase, putative; alpha-beta-alpha sandwich, st | 95.85 | |
| 3hem_A | 302 | Cyclopropane-fatty-acyl-phospholipid synthase 2; p | 95.85 | |
| 3hm2_A | 178 | Precorrin-6Y C5,15-methyltransferase; alpha-beta-s | 95.83 | |
| 3c3p_A | 210 | Methyltransferase; NP_951602.1, structural genomic | 95.82 | |
| 3r3h_A | 242 | O-methyltransferase, SAM-dependent; structural gen | 95.82 | |
| 4azs_A | 569 | Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 | 95.79 | |
| 3tfw_A | 248 | Putative O-methyltransferase; PSI-biology, nysgrc, | 95.78 | |
| 3dr5_A | 221 | Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 | 95.78 | |
| 2gpy_A | 233 | O-methyltransferase; structural genomics, PSI, pro | 95.75 | |
| 1dus_A | 194 | MJ0882; hypothetical protein, methanococcus jannas | 95.74 | |
| 3p9n_A | 189 | Possible methyltransferase (methylase); RV2966C, a | 95.73 | |
| 3ftd_A | 249 | Dimethyladenosine transferase; KSGA, rossmann-like | 95.72 | |
| 2hnk_A | 239 | SAM-dependent O-methyltransferase; modified rossma | 95.72 | |
| 3e05_A | 204 | Precorrin-6Y C5,15-methyltransferase (decarboxyla; | 95.71 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 95.7 | |
| 2avd_A | 229 | Catechol-O-methyltransferase; structural genomics, | 95.7 | |
| 2p7i_A | 250 | Hypothetical protein; putative methyltransferase, | 95.68 | |
| 1kpg_A | 287 | CFA synthase;, cyclopropane-fatty-acyl-phospholipi | 95.66 | |
| 1ws6_A | 171 | Methyltransferase; structural genomics, riken stru | 95.64 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 95.64 | |
| 2o57_A | 297 | Putative sarcosine dimethylglycine methyltransfera | 95.63 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 95.62 | |
| 1l3i_A | 192 | Precorrin-6Y methyltransferase/putative decarboxyl | 95.62 | |
| 1sui_A | 247 | Caffeoyl-COA O-methyltransferase; rossmann fold, p | 95.61 | |
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 95.61 | |
| 1qam_A | 244 | ERMC' methyltransferase; rRNA methyltransferase ER | 95.6 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 95.58 | |
| 3thr_A | 293 | Glycine N-methyltransferase; GNMT, folate, methylt | 95.56 | |
| 3pfg_A | 263 | N-methyltransferase; N,N-dimethyltransferase, SAM | 95.54 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 95.53 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 95.51 | |
| 1wzn_A | 252 | SAM-dependent methyltransferase; structural genomi | 95.51 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 95.51 | |
| 3gdh_A | 241 | Trimethylguanosine synthase homolog; M7G, CAP, dim | 95.5 | |
| 3iv6_A | 261 | Putative Zn-dependent alcohol dehydrogenase; alpha | 95.5 | |
| 4hg2_A | 257 | Methyltransferase type 11; structural genomics, PS | 95.49 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 95.48 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 95.47 | |
| 2yxe_A | 215 | Protein-L-isoaspartate O-methyltransferase; rossma | 95.47 | |
| 1ne2_A | 200 | Hypothetical protein TA1320; structural genomics, | 95.47 | |
| 3cbg_A | 232 | O-methyltransferase; cyanobacterium; HET: SAH FER | 95.42 | |
| 1wy7_A | 207 | Hypothetical protein PH1948; seven-stranded beta s | 95.42 | |
| 2p8j_A | 209 | S-adenosylmethionine-dependent methyltransferase; | 95.42 | |
| 1zq9_A | 285 | Probable dimethyladenosine transferase; SGC, struc | 95.41 | |
| 1jg1_A | 235 | PIMT;, protein-L-isoaspartate O-methyltransferase; | 95.4 | |
| 2bm8_A | 236 | Cephalosporin hydroxylase CMCI; cephamycin biosynt | 95.4 | |
| 4htf_A | 285 | S-adenosylmethionine-dependent methyltransferase; | 95.4 | |
| 2h1r_A | 299 | Dimethyladenosine transferase, putative; SGC toron | 95.38 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 95.37 | |
| 3vc1_A | 312 | Geranyl diphosphate 2-C-methyltransferase; rossman | 95.35 | |
| 1vbf_A | 231 | 231AA long hypothetical protein-L-isoaspartate O- | 95.34 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 95.3 | |
| 2fca_A | 213 | TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac | 95.28 | |
| 3lpm_A | 259 | Putative methyltransferase; structural genomics, p | 95.28 | |
| 3g5t_A | 299 | Trans-aconitate 3-methyltransferase; structural ge | 95.28 | |
| 3uzu_A | 279 | Ribosomal RNA small subunit methyltransferase A; s | 95.27 | |
| 2fk8_A | 318 | Methoxy mycolic acid synthase 4; S-adenosylmethion | 95.27 | |
| 3m33_A | 226 | Uncharacterized protein; structural genomics, PSI- | 95.27 | |
| 2avn_A | 260 | Ubiquinone/menaquinone biosynthesis methyltransfe | 95.24 | |
| 1zx0_A | 236 | Guanidinoacetate N-methyltransferase; structural g | 95.24 | |
| 3q87_B | 170 | N6 adenine specific DNA methylase; SAM-methyltrans | 95.23 | |
| 1nv8_A | 284 | HEMK protein; class I adoMet-dependent methyltrans | 95.23 | |
| 1yzh_A | 214 | TRNA (guanine-N(7)-)-methyltransferase; alpha-beta | 95.22 | |
| 3bxo_A | 239 | N,N-dimethyltransferase; desosamine, sugar, carboh | 95.22 | |
| 2ift_A | 201 | Putative methylase HI0767; NESG, Y767_haein, struc | 95.21 | |
| 3mq2_A | 218 | 16S rRNA methyltransferase; methyltranferase, ribo | 95.21 | |
| 3c3y_A | 237 | Pfomt, O-methyltransferase; plant secondary metabo | 95.19 | |
| 3hp7_A | 291 | Hemolysin, putative; structural genomics, APC64019 | 95.13 | |
| 3m70_A | 286 | Tellurite resistance protein TEHB homolog; structu | 95.11 | |
| 3cc8_A | 230 | Putative methyltransferase; structural genomics, j | 95.1 | |
| 3ege_A | 261 | Putative methyltransferase from antibiotic biosyn | 95.09 | |
| 1y8c_A | 246 | S-adenosylmethionine-dependent methyltransferase; | 95.09 | |
| 2pbf_A | 227 | Protein-L-isoaspartate O-methyltransferase beta-A | 95.04 | |
| 3lcc_A | 235 | Putative methyl chloride transferase; halide methy | 95.01 | |
| 3gu3_A | 284 | Methyltransferase; alpha-beta protein, structural | 95.0 | |
| 2vdw_A | 302 | Vaccinia virus capping enzyme D1 subunit; nucleoti | 95.0 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 94.99 | |
| 1qyr_A | 252 | KSGA, high level kasugamycin resistance protein, S | 94.99 | |
| 3fpf_A | 298 | Mtnas, putative uncharacterized protein; thermonic | 94.98 | |
| 3mgg_A | 276 | Methyltransferase; NYSGXRC, PSI-II, protein struct | 94.97 | |
| 3ckk_A | 235 | TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- | 94.97 | |
| 3bzb_A | 281 | Uncharacterized protein; RED ALGA, protein structu | 94.93 | |
| 3dli_A | 240 | Methyltransferase; PSI-II, NYSGXRC, structural gen | 94.9 | |
| 3e23_A | 211 | Uncharacterized protein RPA2492; alpha-beta protei | 94.89 | |
| 3eey_A | 197 | Putative rRNA methylase; rRNA methylation, S-adeno | 94.88 | |
| 1xtp_A | 254 | LMAJ004091AAA; SGPP, structural genomics, PSI, pro | 94.88 | |
| 1xdz_A | 240 | Methyltransferase GIDB; MCSG, protein structure in | 94.87 | |
| 3bkx_A | 275 | SAM-dependent methyltransferase; YP_807781.1, cycl | 94.86 | |
| 2fpo_A | 202 | Methylase YHHF; structural genomics, putative meth | 94.85 | |
| 2kw5_A | 202 | SLR1183 protein; structural genomics, northeast st | 94.84 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 94.83 | |
| 1u2z_A | 433 | Histone-lysine N-methyltransferase, H3 lysine-79 s | 94.83 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 94.81 | |
| 1jsx_A | 207 | Glucose-inhibited division protein B; methyltransf | 94.8 | |
| 2nyu_A | 196 | Putative ribosomal RNA methyltransferase 2; SAM, s | 94.79 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 94.77 | |
| 3bgv_A | 313 | MRNA CAP guanine-N7 methyltransferase; alternative | 94.77 | |
| 1vl5_A | 260 | Unknown conserved protein BH2331; putative methylt | 94.76 | |
| 3g07_A | 292 | 7SK snRNA methylphosphate capping enzyme; structur | 94.76 | |
| 3p2e_A | 225 | 16S rRNA methylase; methyltransferase, transferase | 94.7 | |
| 2ozv_A | 260 | Hypothetical protein ATU0636; structural genomics, | 94.7 | |
| 3dxy_A | 218 | TRNA (guanine-N(7)-)-methyltransferase; rossmann f | 94.7 | |
| 2yqz_A | 263 | Hypothetical protein TTHA0223; RNA methyltransfera | 94.68 | |
| 3g2m_A | 299 | PCZA361.24; SAM-dependent methyltransferase, glyco | 94.66 | |
| 1r18_A | 227 | Protein-L-isoaspartate(D-aspartate)-O-methyltrans; | 94.63 | |
| 3g89_A | 249 | Ribosomal RNA small subunit methyltransferase G; 1 | 94.54 | |
| 3ccf_A | 279 | Cyclopropane-fatty-acyl-phospholipid synthase; YP_ | 94.52 | |
| 1i1n_A | 226 | Protein-L-isoaspartate O-methyltransferase; S-aden | 94.52 | |
| 1xxl_A | 239 | YCGJ protein; structural genomics, protein structu | 94.51 | |
| 3kr9_A | 225 | SAM-dependent methyltransferase; class I rossmann- | 94.51 | |
| 3gnl_A | 244 | Uncharacterized protein, DUF633, LMOF2365_1472; st | 94.48 | |
| 2fyt_A | 340 | Protein arginine N-methyltransferase 3; structural | 94.48 | |
| 2h00_A | 254 | Methyltransferase 10 domain containing protein; st | 94.47 | |
| 1m6y_A | 301 | S-adenosyl-methyltransferase MRAW; SAM-dependent m | 94.46 | |
| 1fbn_A | 230 | MJ fibrillarin homologue; MJ proteins, ribosomal R | 94.45 | |
| 2plw_A | 201 | Ribosomal RNA methyltransferase, putative; malaria | 94.44 | |
| 3sm3_A | 235 | SAM-dependent methyltransferases; NESG, structural | 94.44 | |
| 3evz_A | 230 | Methyltransferase; NYSGXRC, NEW YORK SGX research | 94.43 | |
| 3dh0_A | 219 | SAM dependent methyltransferase; cystal structure, | 94.42 | |
| 2g72_A | 289 | Phenylethanolamine N-methyltransferase; HET: SAM F | 94.39 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 94.37 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 94.36 | |
| 3ggd_A | 245 | SAM-dependent methyltransferase; YP_325210.1, stru | 94.31 | |
| 1ej0_A | 180 | FTSJ; methyltransferase, adoMet, adenosyl methioni | 94.3 | |
| 1p91_A | 269 | Ribosomal RNA large subunit methyltransferase A; R | 94.29 | |
| 3lec_A | 230 | NADB-rossmann superfamily protein; PSI, MCSG, stru | 94.29 | |
| 2b25_A | 336 | Hypothetical protein; structural genomics, methyl | 94.29 | |
| 1nt2_A | 210 | Fibrillarin-like PRE-rRNA processing protein; adeM | 94.28 | |
| 1uwv_A | 433 | 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m | 94.27 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 94.24 | |
| 3mb5_A | 255 | SAM-dependent methyltransferase; RNA methyltransfe | 94.22 | |
| 2y1w_A | 348 | Histone-arginine methyltransferase CARM1; histone | 94.18 | |
| 1yub_A | 245 | Ermam, rRNA methyltransferase; MLS antibiotics; NM | 94.16 | |
| 3uwp_A | 438 | Histone-lysine N-methyltransferase, H3 lysine-79; | 94.13 | |
| 2yvl_A | 248 | TRMI protein, hypothetical protein; tRNA, methyltr | 94.09 | |
| 2vdv_E | 246 | TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl | 94.07 | |
| 3d2l_A | 243 | SAM-dependent methyltransferase; ZP_00538691.1, st | 94.04 | |
| 3q7e_A | 349 | Protein arginine N-methyltransferase 1; HET: SAH; | 94.01 | |
| 2qe6_A | 274 | Uncharacterized protein TFU_2867; putative methylt | 94.0 | |
| 4e2x_A | 416 | TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s | 93.98 | |
| 1i9g_A | 280 | Hypothetical protein RV2118C; mtase, adoMet, cryst | 93.96 | |
| 1dl5_A | 317 | Protein-L-isoaspartate O-methyltransferase; isoasp | 93.96 | |
| 1g6q_1 | 328 | HnRNP arginine N-methyltransferase; SAM-binding do | 93.94 | |
| 2p35_A | 259 | Trans-aconitate 2-methyltransferase; SAM dependent | 93.89 | |
| 2b3t_A | 276 | Protein methyltransferase HEMK; translation termin | 93.88 | |
| 4dcm_A | 375 | Ribosomal RNA large subunit methyltransferase G; 2 | 93.88 | |
| 2pwy_A | 258 | TRNA (adenine-N(1)-)-methyltransferase; mtase, ado | 93.84 | |
| 3dou_A | 191 | Ribosomal RNA large subunit methyltransferase J; c | 93.8 | |
| 2gs9_A | 211 | Hypothetical protein TT1324; methyl transferase, s | 93.79 | |
| 2nxc_A | 254 | L11 mtase, ribosomal protein L11 methyltransferase | 93.71 | |
| 2frn_A | 278 | Hypothetical protein PH0793; structural genomics, | 93.69 | |
| 3ocj_A | 305 | Putative exported protein; structural genomics, PS | 93.69 | |
| 1ri5_A | 298 | MRNA capping enzyme; methyltransferase, M7G, messe | 93.67 | |
| 3r0q_C | 376 | Probable protein arginine N-methyltransferase 4.2; | 93.62 | |
| 3b3j_A | 480 | Histone-arginine methyltransferase CARM1; protein | 93.49 | |
| 1o9g_A | 250 | RRNA methyltransferase; antibiotic resistance, Se- | 93.48 | |
| 1g8a_A | 227 | Fibrillarin-like PRE-rRNA processing protein; rRNA | 93.38 | |
| 2i62_A | 265 | Nicotinamide N-methyltransferase; structural genom | 93.38 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 93.35 | |
| 1yb2_A | 275 | Hypothetical protein TA0852; structural genomics, | 93.31 | |
| 3a27_A | 272 | TYW2, uncharacterized protein MJ1557; wybutosine m | 93.24 | |
| 3giw_A | 277 | Protein of unknown function DUF574; rossmann-fold | 93.06 | |
| 2ipx_A | 233 | RRNA 2'-O-methyltransferase fibrillarin; FBL, stru | 93.01 | |
| 2r6z_A | 258 | UPF0341 protein in RSP 3' region; alpha-beta prote | 92.95 | |
| 3tma_A | 354 | Methyltransferase; thump domain; 2.05A {Thermus th | 92.95 | |
| 3dmg_A | 381 | Probable ribosomal RNA small subunit methyltransf; | 92.91 | |
| 2f8l_A | 344 | Hypothetical protein LMO1582; structural genomics, | 92.89 | |
| 1o54_A | 277 | SAM-dependent O-methyltransferase; TM0748, structu | 92.77 | |
| 2igt_A | 332 | SAM dependent methyltransferase; alpha-beta sandwi | 92.76 | |
| 2a14_A | 263 | Indolethylamine N-methyltransferase; SGC,INMT, str | 92.72 | |
| 1x19_A | 359 | CRTF-related protein; methyltransferase, bacterioc | 92.68 | |
| 1ixk_A | 315 | Methyltransferase; open beta sheet; 1.90A {Pyrococ | 92.63 | |
| 3k6r_A | 278 | Putative transferase PH0793; structural genomics, | 92.54 | |
| 3tm4_A | 373 | TRNA (guanine N2-)-methyltransferase TRM14; rossma | 92.51 | |
| 2jjq_A | 425 | Uncharacterized RNA methyltransferase pyrab10780; | 92.33 | |
| 3gjy_A | 317 | Spermidine synthase; APC62791, structural genomics | 92.21 | |
| 3ajd_A | 274 | Putative methyltransferase MJ0026; tRNA, M5C, ross | 92.18 | |
| 4fsd_A | 383 | Arsenic methyltransferase; rossmann fold; 1.75A {C | 92.01 | |
| 1mjf_A | 281 | Spermidine synthase; spermidine synthetase, struct | 92.0 | |
| 3dp7_A | 363 | SAM-dependent methyltransferase; structural genomi | 91.94 | |
| 1xj5_A | 334 | Spermidine synthase 1; structural genomics, protei | 91.92 | |
| 3bt7_A | 369 | TRNA (uracil-5-)-methyltransferase; methyluridine, | 91.92 | |
| 3mcz_A | 352 | O-methyltransferase; adomet_mtases, S-adenosylmeth | 91.87 | |
| 2zfu_A | 215 | Nucleomethylin, cerebral protein 1; nucleolar prot | 91.8 | |
| 1uir_A | 314 | Polyamine aminopropyltransferase; spermidien synth | 91.68 | |
| 4hc4_A | 376 | Protein arginine N-methyltransferase 6; HRMT1L6, S | 91.58 | |
| 2ip2_A | 334 | Probable phenazine-specific methyltransferase; pyo | 91.5 | |
| 1iy9_A | 275 | Spermidine synthase; rossmann fold, structural gen | 91.43 | |
| 2r3s_A | 335 | Uncharacterized protein; methyltransferase domain, | 91.32 | |
| 4df3_A | 233 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 91.26 | |
| 3adn_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 91.24 | |
| 3bwc_A | 304 | Spermidine synthase; SAM, SGPP, structura genomics | 90.93 | |
| 2ih2_A | 421 | Modification methylase TAQI; DNA, DNA methyltransf | 90.85 | |
| 2o07_A | 304 | Spermidine synthase; structural genomics, structur | 90.74 | |
| 2pt6_A | 321 | Spermidine synthase; transferase, structural genom | 90.73 | |
| 2pjd_A | 343 | Ribosomal RNA small subunit methyltransferase C; g | 90.63 | |
| 1inl_A | 296 | Spermidine synthase; beta-barrel, rossman fold, st | 90.57 | |
| 3gwz_A | 369 | MMCR; methyltransferase, mitomycin, S-adenosyl met | 90.48 | |
| 3ll7_A | 410 | Putative methyltransferase; methytransferase, stru | 90.41 | |
| 2i7c_A | 283 | Spermidine synthase; transferase, structural genom | 90.17 | |
| 2b2c_A | 314 | Spermidine synthase; beta-alpha, transferase; 2.50 | 90.13 | |
| 2cmg_A | 262 | Spermidine synthase; transferase, putrescine amino | 90.04 | |
| 1qzz_A | 374 | RDMB, aclacinomycin-10-hydroxylase; anthracycline, | 90.04 | |
| 2zig_A | 297 | TTHA0409, putative modification methylase; methylt | 90.03 | |
| 2yx1_A | 336 | Hypothetical protein MJ0883; methyl transferase, t | 89.71 | |
| 3fzg_A | 200 | 16S rRNA methylase; methyltransferase, plasmid, tr | 89.59 | |
| 1vlm_A | 219 | SAM-dependent methyltransferase; possible histamin | 89.58 | |
| 2oyr_A | 258 | UPF0341 protein YHIQ; alpha-beta protein, structur | 89.47 | |
| 1sqg_A | 429 | SUN protein, FMU protein; rossmann-fold, mixed bet | 89.21 | |
| 3id6_C | 232 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 89.15 | |
| 1tw3_A | 360 | COMT, carminomycin 4-O-methyltransferase; anthracy | 89.02 | |
| 2oxt_A | 265 | Nucleoside-2'-O-methyltransferase; flavivirus, vir | 88.96 | |
| 3m6w_A | 464 | RRNA methylase; rRNA methyltransferase, 5-methylcy | 88.95 | |
| 2b78_A | 385 | Hypothetical protein SMU.776; structure genomics, | 88.85 | |
| 3c0k_A | 396 | UPF0064 protein YCCW; PUA domain, adoMet dependent | 88.62 | |
| 2yxl_A | 450 | PH0851 protein, 450AA long hypothetical FMU protei | 88.54 | |
| 2dul_A | 378 | N(2),N(2)-dimethylguanosine tRNA methyltransferas; | 88.54 | |
| 2wa2_A | 276 | Non-structural protein 5; transferase, S-adenosyl- | 88.41 | |
| 2frx_A | 479 | Hypothetical protein YEBU; rossmann-type S-adenosy | 88.25 | |
| 3i53_A | 332 | O-methyltransferase; CO-complex, rossmann-like fol | 88.22 | |
| 2b9e_A | 309 | NOL1/NOP2/SUN domain family, member 5 isoform 2; m | 88.14 | |
| 1fp2_A | 352 | Isoflavone O-methyltransferase; protein-product co | 88.04 | |
| 4dmg_A | 393 | Putative uncharacterized protein TTHA1493; rRNA, m | 87.85 | |
| 3p9c_A | 364 | Caffeic acid O-methyltransferase; S-adenosylmethio | 87.2 | |
| 3reo_A | 368 | (ISO)eugenol O-methyltransferase; directed evoluti | 86.9 | |
| 3m4x_A | 456 | NOL1/NOP2/SUN family protein; mtase domain, PUA do | 86.62 | |
| 2e7y_A | 280 | TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, | 86.5 | |
| 2as0_A | 396 | Hypothetical protein PH1915; RNA methyltransferase | 86.25 | |
| 1wxx_A | 382 | TT1595, hypothetical protein TTHA1280; thermus the | 86.0 | |
| 3g1p_A | 258 | Protein PHNP; C-P lyase, phosphodiesterase, phosph | 85.94 | |
| 1fp1_D | 372 | Isoliquiritigenin 2'-O-methyltransferase; protein- | 85.87 | |
| 2aot_A | 292 | HMT, histamine N-methyltransferase; classic methyl | 85.36 | |
| 2qm3_A | 373 | Predicted methyltransferase; putative methyltransf | 84.4 | |
| 3k0b_A | 393 | Predicted N6-adenine-specific DNA methylase; methy | 83.79 | |
| 2p41_A | 305 | Type II methyltransferase; vizier, viral enzymes i | 83.68 | |
| 3frh_A | 253 | 16S rRNA methylase; methyltransferase domain, heli | 83.62 | |
| 1zg3_A | 358 | Isoflavanone 4'-O-methyltransferase; rossman fold, | 83.47 | |
| 3ldu_A | 385 | Putative methylase; structural genomics, PSI-2, pr | 83.37 | |
| 1zkp_A | 268 | Hypothetical protein BA1088; zinc binding protein, | 82.73 | |
| 2qfm_A | 364 | Spermine synthase; spermidine aminopropyltransfera | 81.88 | |
| 4a6d_A | 353 | Hydroxyindole O-methyltransferase; melatonin, circ | 81.73 | |
| 3rpc_A | 264 | Possible metal-dependent hydrolase; structural gen | 81.38 | |
| 3lst_A | 348 | CALO1 methyltransferase; calicheamicin, enediyne, | 81.13 | |
| 1wg8_A | 285 | Predicted S-adenosylmethionine-dependent methyltra | 80.4 | |
| 2wyl_A | 360 | L-ascorbate-6-phosphate lactonase ULAG; hydrolase; | 80.36 | |
| 2cbn_A | 306 | Ribonuclease Z; phosphodiesterase beta lactamase t | 80.03 |
| >3iek_A Ribonuclease TTHA0252; metallo beta lactamase fold, endonuclease, hydrolase, metal- nuclease, RNA-binding, rRNA processing; HET: FLC; 2.05A {Thermus thermophilus} SCOP: d.157.1.10 PDB: 2dkf_A* 3iel_A* 3iem_A* 2zdf_A* 3idz_A* 2zdd_A* 3ie0_A* 2zde_A* 3ie1_A* 2zdw_A* 3a4y_A* 2yvd_A* 3ie2_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.9e-52 Score=491.13 Aligned_cols=278 Identities=27% Similarity=0.435 Sum_probs=254.8
Q ss_pred CEEEEECCEEEEEEcCCCCCCCCCCCCcccCCCCCcEEEEcCCCCCCCCCChhHHHHHHHHHHHHHHhCCCeEEEeecch
Q psy9966 1 MFQVKVGNQSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTIRDSKRCRERDFLKKVHECVDRGGKVLIPVFAL 80 (1101)
Q Consensus 1 Mf~Ie~~g~rIlYTGDf~~~~dr~L~~a~ip~~~~DvLI~ESTYg~~~~~~r~~rE~~f~~~I~etl~~GG~VLIPvFAl 80 (1101)
+|+|+.++++|+||||++..+++++.... ...++|+||+|||||++.|+++..++.+|.+.|.+++++||+||||+||+
T Consensus 147 ~~~i~~~~~~ilfsGD~~~~~~~~l~~~~-~~~~~D~LI~EsTy~~~~h~~~~~~~~~l~~~i~~~~~~gg~vlIp~fa~ 225 (431)
T 3iek_A 147 FVVAQGEGRTLVYSGDLGNREKDVLPDPS-LPPLADLVLAEGTYGDRPHRPYRETVREFLEILEKTLSQGGKVLIPTFAV 225 (431)
T ss_dssp EEEEEETTEEEEECCCCCCTTSSSSCCCC-BCCCCSEEEEECTTTTCCCCCHHHHHHHHHHHHHHHHHTTCEEEEECCTT
T ss_pred EEEEEECCEEEEEeCCCCCCCCcccCCcc-ccCCccEEEEEcccCCcCCCChHHHHHHHHHHHHHHHHcCCeEEEEeccc
Confidence 57899999999999999998887774333 23589999999999999999999999999999999999999999999999
Q ss_pred hHHHHHHHHHHHHHHhcCCCccEEEeChHHHHHHHHHHHhHhhhhHHHHHhhhh-cCCCcCCCccccC-----ccccCCC
Q psy9966 81 GRAQELCILLETYWERMNLQAPIYFAVGLTEKATNYYKMFITWTNQKIRKTFVQ-RNMFDFKHIRPFD-----KSFIDNP 154 (1101)
Q Consensus 81 GRaQELl~iL~~~w~~~~~~vPIy~~s~la~k~~~vy~~~~~~ln~~i~~~f~~-~npF~fk~i~~~~-----~~~~~~~ 154 (1101)
||+|||+.+|+++|++. .++|||++|||+.+++++|+.|.+||++++++.+.. .|||.|++++.+. +.+.+.+
T Consensus 226 gR~qell~~l~~~~~~~-~~~pi~~~s~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~pf~~~~~~~~~~~~~~~~~~~~~ 304 (431)
T 3iek_A 226 ERAQEILYVLYTHGHRL-PRAPIYLDSPMAGRVLSLYPRLVRYFSEEVQAHFLQGKNPFRPAGLEVVEHTEASKALNRAP 304 (431)
T ss_dssp THHHHHHHHHHHHGGGS-CCCCEEEECHHHHHHHHHGGGGGGGSCHHHHHHHHTTSCTTCCTTEEECCSHHHHHHHHHSC
T ss_pred hHHHHHHHHHHHHHHhc-cCCCEEEeChHHHHHHHHHHHhHHHHHHHHHHHHhcCCCCCCCCCeEEeCCHHHHHHHhcCC
Confidence 99999999999999873 479999999999999999999999999999887754 7999999987764 2245568
Q ss_pred CCeEEEEcCCCCCCchHHHHHHHhCCCCCCeEEEecccCCCcchhhhhcCcceEEecCCeeEEEeeEEEEE-ecccCCCH
Q psy9966 155 GPMVVFATPGMLHSGLSLIIFKKWAPVENNMLIMPGFCVQGTIGHKVLSGVKKLEFENKQIIDVKMAIEYM-SFSAHADA 233 (1101)
Q Consensus 155 gp~VViaspGmL~~G~s~~~~~~w~~d~~N~VI~tGy~~~GT~g~~Ll~g~k~i~l~~g~~i~v~~~V~~i-~fSaHAD~ 233 (1101)
+||||||+||||++|+++++|++|++|++|+|||||||++||+|++|++|++++++. |+.++++|+|+++ +||||||+
T Consensus 305 ~p~viia~~gm~~~G~~~~~l~~~~~~~~n~ii~~gyq~~gt~g~~l~~~~~~v~~~-g~~~~v~a~v~~~~~~saHad~ 383 (431)
T 3iek_A 305 GPMVVLAGSGMLAGGRILHHLKHGLSDPRNALVFVGYQPQGGLGAEIIARPPAVRIL-GEEVPLRASVHTLGGFSGHAGQ 383 (431)
T ss_dssp SSEEEEESCTTSSSSHHHHHHHHHTTCTTCEEEECSCCCTTSHHHHHHTCCSEEEET-TEEEECCSEEEECGGGCSSCCH
T ss_pred CCeEEEecCCCCCCChHHHHHHHhcCCCCCeEEEECCCCCCChHHHhhcCCcEEEEC-CEEEEEEEEEEEECCccccCCH
Confidence 999999999999999999999999999999999999999999999999999999987 7899999999999 79999999
Q ss_pred HHHHHHHHHhCCCEEEEecCChhHHHHHHHHHHHHcCCceeecCCCCEEEE
Q psy9966 234 KGIMQLIQYCEPKNVLLVHGEASKMVFLKEKIKQEFNLDCFMPANGESCFV 284 (1101)
Q Consensus 234 ~~l~~~I~~l~Pk~VILVHGe~~~m~~Lk~~L~~e~gi~v~~P~nGe~v~l 284 (1101)
+||++|++..+ +||+||||++++..|+++|.++++ ++++|++||++++
T Consensus 384 ~~l~~~~~~~~--~v~lvHge~~~~~~l~~~l~~~~~-~~~~p~~~~~~~~ 431 (431)
T 3iek_A 384 DELLDWLQGEP--RVVLVHGEEEKLLALGKLLALRGQ-EVSLARFGEGVPV 431 (431)
T ss_dssp HHHHHHHTTCS--EEEEESSCHHHHHHHHHHHHHTTC-EEEECCTTCCEEC
T ss_pred HHHHHHHHhCC--eEEEECCCHHHHHHHHHHHHHhCC-cEEECCCCCEEeC
Confidence 99999999774 999999999999999999998866 9999999999874
|
| >2i7t_A Cleavage and polyadenylation specificity factor 73 kDa subunit; metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination; 2.10A {Homo sapiens} SCOP: d.157.1.10 PDB: 2i7v_A | Back alignment and structure |
|---|
| >3af5_A Putative uncharacterized protein PH1404; archaeal CPSF, beta-CAsp family, KH domain, ribonuclease, ME beta-lactamase superfamily, archaea; 2.60A {Pyrococcus horikoshii} PDB: 3af6_A* | Back alignment and structure |
|---|
| >2xr1_A Cleavage and polyadenylation specificity factor 1 subunit; hydrolase, metallo-beta-lactamase, beta-CAsp, RNA processing; 2.59A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2ycb_A Beta-CAsp RNAse, cleavage and polyadenylation specificity factor; hydrolase, KH, metallo-beta-lactamase; 3.10A {Methanothermobacter thermautotrophicusorganism_taxid} | Back alignment and structure |
|---|
| >2i7x_A Protein CFT2; polyadenylation, metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination, double-strand break repair; 2.50A {Saccharomyces cerevisiae} SCOP: d.157.1.10 | Back alignment and structure |
|---|
| >3zq4_A Ribonuclease J 1, RNAse J1; hydrolase, RNA maturation; 3.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3bk2_A RNAse J, metal dependent hydrolase; endoribonuclease, exoribonuclease, metallo-beta-lactamase; HET: U5P; 2.10A {Thermus thermophilus} PDB: 3bk1_A* 3t3o_A* 3t3n_A* | Back alignment and structure |
|---|
| >2az4_A Hypothetical protein EF2904; structural genomics, PSI, protein STR initiative, midwest center for structural genomics, MCSG, U function; 2.00A {Enterococcus faecalis} SCOP: d.157.1.10 | Back alignment and structure |
|---|
| >3zdk_A 5' exonuclease apollo; hydrolase; HET: TLA; 2.16A {Homo sapiens} | Back alignment and structure |
|---|
| >4b87_A DNA cross-LINK repair 1A protein; dclre1A, DCLRE, interstrand crosslink repair, hydrolase, NIT mustard, cancer, chemotherapy, PSO2 homolog,; HET: DNA; 2.16A {Homo sapiens} | Back alignment and structure |
|---|
| >3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* | Back alignment and structure |
|---|
| >3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* | Back alignment and structure |
|---|
| >2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* | Back alignment and structure |
|---|
| >2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* | Back alignment and structure |
|---|
| >4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* | Back alignment and structure |
|---|
| >3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 | Back alignment and structure |
|---|
| >3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A | Back alignment and structure |
|---|
| >3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... | Back alignment and structure |
|---|
| >3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} | Back alignment and structure |
|---|
| >2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* | Back alignment and structure |
|---|
| >3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A | Back alignment and structure |
|---|
| >3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* | Back alignment and structure |
|---|
| >2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} | Back alignment and structure |
|---|
| >3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* | Back alignment and structure |
|---|
| >3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} | Back alignment and structure |
|---|
| >3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* | Back alignment and structure |
|---|
| >3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 | Back alignment and structure |
|---|
| >3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* | Back alignment and structure |
|---|
| >2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} | Back alignment and structure |
|---|
| >3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* | Back alignment and structure |
|---|
| >2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A | Back alignment and structure |
|---|
| >1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* | Back alignment and structure |
|---|
| >1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* | Back alignment and structure |
|---|
| >2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 | Back alignment and structure |
|---|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* | Back alignment and structure |
|---|
| >1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* | Back alignment and structure |
|---|
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* | Back alignment and structure |
|---|
| >3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* | Back alignment and structure |
|---|
| >1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} | Back alignment and structure |
|---|
| >3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* | Back alignment and structure |
|---|
| >3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} | Back alignment and structure |
|---|
| >1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* | Back alignment and structure |
|---|
| >2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* | Back alignment and structure |
|---|
| >4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} | Back alignment and structure |
|---|
| >2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* | Back alignment and structure |
|---|
| >1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* | Back alignment and structure |
|---|
| >3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* | Back alignment and structure |
|---|
| >1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} | Back alignment and structure |
|---|
| >3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} | Back alignment and structure |
|---|
| >3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} | Back alignment and structure |
|---|
| >3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A | Back alignment and structure |
|---|
| >2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A | Back alignment and structure |
|---|
| >3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* | Back alignment and structure |
|---|
| >3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} | Back alignment and structure |
|---|
| >2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* | Back alignment and structure |
|---|
| >1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* | Back alignment and structure |
|---|
| >2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* | Back alignment and structure |
|---|
| >2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A | Back alignment and structure |
|---|
| >3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* | Back alignment and structure |
|---|
| >1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* | Back alignment and structure |
|---|
| >3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* | Back alignment and structure |
|---|
| >1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* | Back alignment and structure |
|---|
| >3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* | Back alignment and structure |
|---|
| >3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* | Back alignment and structure |
|---|
| >2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 | Back alignment and structure |
|---|
| >1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* | Back alignment and structure |
|---|
| >1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A | Back alignment and structure |
|---|
| >2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* | Back alignment and structure |
|---|
| >1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 | Back alignment and structure |
|---|
| >3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 | Back alignment and structure |
|---|
| >1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* | Back alignment and structure |
|---|
| >2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A | Back alignment and structure |
|---|
| >1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* | Back alignment and structure |
|---|
| >2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E | Back alignment and structure |
|---|
| >3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} | Back alignment and structure |
|---|
| >3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* | Back alignment and structure |
|---|
| >2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} | Back alignment and structure |
|---|
| >4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* | Back alignment and structure |
|---|
| >1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 | Back alignment and structure |
|---|
| >1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 | Back alignment and structure |
|---|
| >2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* | Back alignment and structure |
|---|
| >4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* | Back alignment and structure |
|---|
| >2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* | Back alignment and structure |
|---|
| >3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A | Back alignment and structure |
|---|
| >1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A | Back alignment and structure |
|---|
| >2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* | Back alignment and structure |
|---|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* | Back alignment and structure |
|---|
| >2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* | Back alignment and structure |
|---|
| >2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 | Back alignment and structure |
|---|
| >2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 | Back alignment and structure |
|---|
| >1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* | Back alignment and structure |
|---|
| >1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* | Back alignment and structure |
|---|
| >2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* | Back alignment and structure |
|---|
| >3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A | Back alignment and structure |
|---|
| >4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A | Back alignment and structure |
|---|
| >1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* | Back alignment and structure |
|---|
| >3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A | Back alignment and structure |
|---|
| >3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} | Back alignment and structure |
|---|
| >3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* | Back alignment and structure |
|---|
| >4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} | Back alignment and structure |
|---|
| >2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* | Back alignment and structure |
|---|
| >2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* | Back alignment and structure |
|---|
| >2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* | Back alignment and structure |
|---|
| >2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* | Back alignment and structure |
|---|
| >2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* | Back alignment and structure |
|---|
| >3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* | Back alignment and structure |
|---|
| >3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* | Back alignment and structure |
|---|
| >2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A | Back alignment and structure |
|---|
| >1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* | Back alignment and structure |
|---|
| >2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A | Back alignment and structure |
|---|
| >2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* | Back alignment and structure |
|---|
| >3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A | Back alignment and structure |
|---|
| >1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A | Back alignment and structure |
|---|
| >3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* | Back alignment and structure |
|---|
| >1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* | Back alignment and structure |
|---|
| >2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} | Back alignment and structure |
|---|
| >3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* | Back alignment and structure |
|---|
| >2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* | Back alignment and structure |
|---|
| >3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* | Back alignment and structure |
|---|
| >2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* | Back alignment and structure |
|---|
| >2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* | Back alignment and structure |
|---|
| >2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* | Back alignment and structure |
|---|
| >4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* | Back alignment and structure |
|---|
| >3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* | Back alignment and structure |
|---|
| >3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} | Back alignment and structure |
|---|
| >2e7y_A TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.97A {Thermotoga maritima} SCOP: d.157.1.7 PDB: 1ww1_A | Back alignment and structure |
|---|
| >2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 | Back alignment and structure |
|---|
| >1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* | Back alignment and structure |
|---|
| >3g1p_A Protein PHNP; C-P lyase, phosphodiesterase, phosphonate utilization, alkylphosphonate uptake; 1.40A {Escherichia coli} PDB: 3p2u_A | Back alignment and structure |
|---|
| >1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* | Back alignment and structure |
|---|
| >2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* | Back alignment and structure |
|---|
| >2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} | Back alignment and structure |
|---|
| >3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* | Back alignment and structure |
|---|
| >3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* | Back alignment and structure |
|---|
| >1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* | Back alignment and structure |
|---|
| >3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >1zkp_A Hypothetical protein BA1088; zinc binding protein, structural genomics, PSI, protein STRU initiative; 1.50A {Bacillus anthracis str} SCOP: d.157.1.9 | Back alignment and structure |
|---|
| >4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* | Back alignment and structure |
|---|
| >3rpc_A Possible metal-dependent hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.49A {Veillonella parvula} | Back alignment and structure |
|---|
| >3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 | Back alignment and structure |
|---|
| >2wyl_A L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 2.59A {Escherichia coli} PDB: 2wym_A* | Back alignment and structure |
|---|
| >2cbn_A Ribonuclease Z; phosphodiesterase beta lactamase tRNAse Z, hydrolase, metal- binding, endonuclease, tRNA processing, zinc; 2.9A {Escherichia coli} SCOP: d.157.1.7 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1101 | ||||
| d2i7xa1 | 514 | d.157.1.10 (A:1-422,A:626-717) Cleavage factor two | 8e-55 | |
| d2dkfa1 | 431 | d.157.1.10 (A:1-431) Putative RNA-degradation prot | 4e-45 | |
| d2i7ta1 | 451 | d.157.1.10 (A:9-459) Cleavage and polyadenylation | 2e-44 |
| >d2i7xa1 d.157.1.10 (A:1-422,A:626-717) Cleavage factor two protein 2, CFT2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 514 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Metallo-hydrolase/oxidoreductase superfamily: Metallo-hydrolase/oxidoreductase family: beta-CASP RNA-metabolising hydrolases domain: Cleavage factor two protein 2, CFT2 species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 197 bits (502), Expect = 8e-55
Identities = 42/352 (11%), Positives = 99/352 (28%), Gaps = 74/352 (21%)
Query: 1 MFQVKVGNQSIVYTGDYNMTPDRHLGAA--------WIDKCRPDLLITESTYATTIRDSK 52
++ + ++ +VY +N T D L AA + I +
Sbjct: 164 IWCISTYSEKLVYAKRWNHTRDNILNAASILDATGKPLSTLMRPSAIITTLDRFGSSQPF 223
Query: 53 RCRERDFLKKVHECVDRGGKVLIPVFALGRAQELCILLETYWERMNL-----QAPIYFAV 107
+ R + F + + + G V+IPV G+ +L + Q P+
Sbjct: 224 KKRSKIFKDTLKKGLSSDGSVIIPVDMSGKFLDLFTQVHELLFESTKINAHTQVPVLILS 283
Query: 108 GLTEKATNYYKMFITWTNQKIRKTFVQR---NMFDFKHIRPFDKS--FIDNPGPMVVFAT 162
+ Y K + W + + KT+ R + F+ PG + F +
Sbjct: 284 YARGRTLTYAKSMLEWLSPSLLKTWENRNNTSPFEIGSRIKIIAPNELSKYPGSKICFVS 343
Query: 163 PGMLHSGLSLIIFKKWAPVENNMLIM--PGFCVQGTIGHKVLSGVKKLE----------- 209
L + K E LI+ P F ++ + +
Sbjct: 344 EVG---ALINEVIIKVGNSEKTTLILTKPSFECASSLDKILEIVEQDERNWKTFPEDGKS 400
Query: 210 ---------------------------------------FENKQIIDVKMAIEYMSFSAH 230
+ + +K ++ ++ +
Sbjct: 401 FLCDNYISIDTIKEEPLSKEETNFDNLDYLKIDKTLSKRTISTVNVQLKCSVVILNLQSL 460
Query: 231 ADAKGIMQLIQYCEPKNVLLVHGEASKMVFLKEKIKQEFNLDCFMPANGESC 282
D + + + + ++L + + + K+ ++ N++ +
Sbjct: 461 VDQRSASIIWPSLKSRKIVLSAPKQIQNEEITAKLIKK-NIEVVNMPLNKIV 511
|
| >d2dkfa1 d.157.1.10 (A:1-431) Putative RNA-degradation protein TTHA0252 {Thermus thermophilus [TaxId: 274]} Length = 431 | Back information, alignment and structure |
|---|
| >d2i7ta1 d.157.1.10 (A:9-459) Cleavage and polyadenylation specificity factor subunit 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 451 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1101 | |||
| d2i7xa1 | 514 | Cleavage factor two protein 2, CFT2 {Baker's yeast | 100.0 | |
| d2dkfa1 | 431 | Putative RNA-degradation protein TTHA0252 {Thermus | 100.0 | |
| d2i7ta1 | 451 | Cleavage and polyadenylation specificity factor su | 100.0 | |
| d1nkva_ | 245 | Hypothetical Protein YjhP {Escherichia coli [TaxId | 97.21 | |
| d1pjza_ | 201 | Thiopurine S-methyltransferase {Pseudomonas syring | 97.2 | |
| d1ve3a1 | 226 | Hypothetical protein PH0226 {Archaeon Pyrococcus h | 97.02 | |
| d2o57a1 | 282 | Putative sarcosine dimethylglycine methyltransfera | 97.01 | |
| d2bzga1 | 229 | Thiopurine S-methyltransferase {Human (Homo sapien | 97.0 | |
| d2avna1 | 246 | Hypothetical methyltransferase TM1389 {Thermotoga | 96.76 | |
| d1kpia_ | 291 | CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | 96.71 | |
| d1l3ia_ | 186 | Precorrin-6Y methyltransferase (CbiT) {Archaeon Me | 96.67 | |
| d2fk8a1 | 280 | Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri | 96.65 | |
| d1xxla_ | 234 | Hypothetical protein YcgJ {Bacillus subtilis [TaxI | 96.61 | |
| d1im8a_ | 225 | Hypothetical protein HI0319 (YecO) {Haemophilus in | 96.57 | |
| d1kpga_ | 285 | CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | 96.5 | |
| d1wzna1 | 251 | Hypothetical methyltransferase PH1305 {Archaeon Py | 96.5 | |
| d1y8ca_ | 246 | Putative methyltransferase CAC2371 {Clostridium ac | 96.46 | |
| d2ex4a1 | 222 | Adrenal gland protein AD-003 (C9orf32) {Human (Hom | 96.45 | |
| d1wy7a1 | 201 | Hypothetical protein PH1948 {Archaeon Pyrococcus h | 96.29 | |
| d2nxca1 | 254 | PrmA-like protein TTHA0656 (TT0836) {Thermus therm | 96.28 | |
| d1xvaa_ | 292 | Glycine N-methyltransferase {Rat (Rattus norvegicu | 96.25 | |
| d2az4a1 | 183 | Hypothetical protein EF2904 {Enterococcus faecalis | 96.21 | |
| d1zx0a1 | 229 | Guanidinoacetate methyltransferase {Human (Homo sa | 96.21 | |
| d1vl5a_ | 231 | Hypothetical protein BH2331 {Bacillus halodurans [ | 96.19 | |
| d2p7ia1 | 225 | Hypothetical protein ECA1738 {Erwinia carotovora [ | 96.14 | |
| d2i6ga1 | 198 | Putative methyltransferase TehB {Salmonella typhim | 96.12 | |
| d1ne2a_ | 197 | Hypothetical protein Ta1320 {Archaeon Thermoplasma | 95.99 | |
| d1ri5a_ | 252 | mRNA cap (Guanine N-7) methyltransferase {Fungus ( | 95.94 | |
| d1vbfa_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Sulfolo | 95.86 | |
| d2gh1a1 | 281 | Methyltransferase BC2162 {Bacillus cereus [TaxId: | 95.85 | |
| d1dusa_ | 194 | Hypothetical protein MJ0882 {Archaeon Methanococcu | 95.83 | |
| d1p91a_ | 268 | rRNA methyltransferase RlmA {Escherichia coli [Tax | 95.6 | |
| d1u2za_ | 406 | Catalytic, N-terminal domain of histone methyltran | 95.44 | |
| d1dl5a1 | 213 | Protein-L-isoaspartyl O-methyltransferase {Thermot | 95.3 | |
| d1o54a_ | 266 | Hypothetical protein TM0748 {Thermotoga maritima [ | 95.3 | |
| d1jg1a_ | 215 | Protein-L-isoaspartyl O-methyltransferase {Archaeo | 95.24 | |
| d1i1na_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Human ( | 95.18 | |
| d1xtpa_ | 254 | Hypothetical protein Lmaj004091aaa (LmjF30.0810) { | 95.05 | |
| d1qama_ | 235 | rRNA adenine dimethylase {Bacillus subtilis, Ermc' | 94.83 | |
| d1qyra_ | 252 | High level kasugamycin resistance protein KsgA {Es | 94.72 | |
| d1nw3a_ | 328 | Catalytic, N-terminal domain of histone methyltran | 94.58 | |
| d1g6q1_ | 328 | Arginine methyltransferase, HMT1 {Baker's yeast (S | 94.4 | |
| d2fyta1 | 311 | Protein arginine N-methyltransferase 3, PRMT3 {Hum | 94.36 | |
| d1nt2a_ | 209 | Fibrillarin homologue {Archaeon Archaeoglobus fulg | 94.29 | |
| d1i9ga_ | 264 | Probable methyltransferase Rv2118c {Mycobacterium | 94.25 | |
| d1yb2a1 | 250 | Hypothetical protein Ta0852 {Thermoplasma acidophi | 94.09 | |
| d1g8sa_ | 230 | Fibrillarin homologue {Archaeon Methanococcus jann | 94.09 | |
| d1yuba_ | 245 | rRNA adenine dimethylase {Streptococcus pneumoniae | 94.02 | |
| d1r18a_ | 223 | Protein-L-isoaspartyl O-methyltransferase {Fruit f | 93.93 | |
| d1oria_ | 316 | Protein arginine N-methyltransferase 1, PRMT1 {Rat | 93.71 | |
| d1tw3a2 | 253 | Carminomycin 4-O-methyltransferase {Streptomyces p | 93.63 | |
| d1yzha1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep | 93.6 | |
| d2a14a1 | 257 | Indolethylamine N-methyltransferase, INMT {Human ( | 93.59 | |
| d2frna1 | 260 | Hypothetical protein PH0793 {Pyrococcus horikoshii | 93.46 | |
| d2fcaa1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil | 93.43 | |
| d1jqea_ | 280 | Histamine methyltransferase {Human (Homo sapiens) | 93.35 | |
| d1vlma_ | 208 | Possible histamine N-methyltransferase TM1293 {The | 93.24 | |
| d1zq9a1 | 278 | Probable dimethyladenosine transferase {Human (Hom | 93.14 | |
| d2b25a1 | 324 | Hypothetical protein FLJ20628 {Human (Homo sapiens | 92.92 | |
| d2esra1 | 152 | Putative methyltransferase SPy1538 {Streptococcus | 92.9 | |
| d1qzza2 | 256 | Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu | 92.83 | |
| d2cl5a1 | 214 | Catechol O-methyltransferase, COMT {Rat (Rattus no | 92.69 | |
| d2b3ta1 | 274 | N5-glutamine methyltransferase, HemK {Escherichia | 92.48 | |
| d2g72a1 | 263 | Phenylethanolamine N-methyltransferase, PNMTase {H | 92.42 | |
| d1ws6a1 | 171 | Methyltransferase TTHA0928 {Thermus thermophilus [ | 91.08 | |
| d2avda1 | 219 | COMT domain-containing protein 1, COMTD1 {Human (H | 90.97 | |
| d1uwva2 | 358 | rRNA (Uracil-5-)-methyltransferase RumA, catalytic | 90.16 | |
| d1g8aa_ | 227 | Fibrillarin homologue {Archaeon Pyrococcus horikos | 90.08 | |
| d1nv8a_ | 271 | N5-glutamine methyltransferase, HemK {Thermotoga m | 89.17 | |
| d1m6ya2 | 192 | TM0872, methyltransferase domain {Thermotoga marit | 88.67 | |
| d2f8la1 | 328 | Hypothetical protein Lmo1582 {Listeria monocytogen | 88.66 | |
| d2ih2a1 | 223 | DNA methylase TaqI, N-terminal domain {Thermus aqu | 88.0 | |
| d2h00a1 | 250 | Methyltransferase 10 domain containing protein MET | 87.99 | |
| d1kyza2 | 243 | Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra | 87.62 | |
| d1zkpa1 | 244 | Hypothetical protein BA1088 (BAS1016) {Bacillus an | 86.9 | |
| d1fp1d2 | 244 | Chalcone O-methyltransferase {Alfalfa (Medicago sa | 85.57 | |
| d1susa1 | 227 | Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag | 84.85 | |
| d1fp2a2 | 244 | Isoflavone O-methyltransferase {Alfalfa (Medicago | 84.49 | |
| d2fhpa1 | 182 | Putative methylase EF2452 {Enterococcus faecalis [ | 84.47 | |
| d2fpoa1 | 183 | Methylase YhhF {Escherichia coli [TaxId: 562]} | 83.07 | |
| d2as0a2 | 324 | Hypothetical protein PH1915, middle and C-terminal | 81.84 | |
| d1zkpa1 | 244 | Hypothetical protein BA1088 (BAS1016) {Bacillus an | 81.39 |
| >d2i7xa1 d.157.1.10 (A:1-422,A:626-717) Cleavage factor two protein 2, CFT2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Metallo-hydrolase/oxidoreductase superfamily: Metallo-hydrolase/oxidoreductase family: beta-CASP RNA-metabolising hydrolases domain: Cleavage factor two protein 2, CFT2 species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=100.00 E-value=3.3e-45 Score=435.78 Aligned_cols=281 Identities=15% Similarity=0.189 Sum_probs=246.2
Q ss_pred CEEEEECCEEEEEEcCCCCCCCCCCCCccc--------CCCCCcEEEEcCCCCCCCCCChhHHHHHHHHHHHHHHhCCCe
Q psy9966 1 MFQVKVGNQSIVYTGDYNMTPDRHLGAAWI--------DKCRPDLLITESTYATTIRDSKRCRERDFLKKVHECVDRGGK 72 (1101)
Q Consensus 1 Mf~Ie~~g~rIlYTGDf~~~~dr~L~~a~i--------p~~~~DvLI~ESTYg~~~~~~r~~rE~~f~~~I~etl~~GG~ 72 (1101)
||.|+.++++|+|||||+..++++++++.+ +....|.+++|+||+...++++..++.+|.+.|.+++++||+
T Consensus 164 ~~~I~~~~~~IvytGD~~~~~~~~l~~~~~~~~~~~~~~~~~~~~lli~~t~~~~~~~~~~~~~~~l~~~i~~~~~~gG~ 243 (514)
T d2i7xa1 164 IWCISTYSEKLVYAKRWNHTRDNILNAASILDATGKPLSTLMRPSAIITTLDRFGSSQPFKKRSKIFKDTLKKGLSSDGS 243 (514)
T ss_dssp EEEEECSSCEEEECSSCCSSCCSSCCCCTTBCTTSCBCSTTSSCSEEEECCSCCCCSSCHHHHHHHHHHHHHHHTSTTCE
T ss_pred EEEEEECCeEEEEEeccCCCCCccCCCccccccccccccccCCCEEEEEcCCCCCCCCChHHHHHHHHHHHHHHHhCCCE
Confidence 589999999999999999999999986654 235677888999999988889999999999999999999999
Q ss_pred EEEeecchhHHHHHHHHHHHHHHhcC-----CCccEEEeChHHHHHHHHHHHhHhhhhHHHHHhhh---hcCCCcCCCcc
Q psy9966 73 VLIPVFALGRAQELCILLETYWERMN-----LQAPIYFAVGLTEKATNYYKMFITWTNQKIRKTFV---QRNMFDFKHIR 144 (1101)
Q Consensus 73 VLIPvFAlGRaQELl~iL~~~w~~~~-----~~vPIy~~s~la~k~~~vy~~~~~~ln~~i~~~f~---~~npF~fk~i~ 144 (1101)
||||+||+||+|||+.+|+++|++.. .++|||++++++.+++++|+.+.+||++++++.+. ..+||.|++++
T Consensus 244 VlIP~fa~gR~QEil~~l~~~~~~~~~~~~~~~~pI~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~pf~~~~~~ 323 (514)
T d2i7xa1 244 VIIPVDMSGKFLDLFTQVHELLFESTKINAHTQVPVLILSYARGRTLTYAKSMLEWLSPSLLKTWENRNNTSPFEIGSRI 323 (514)
T ss_dssp EEEEECTTTHHHHHHHHHHHHHTTC-------CCCEEEECTTTTHHHHHHHTCGGGSCHHHHHHHHSSSSCCTTCCTTTE
T ss_pred EEEEEcCchHHHHHHHHHHHHHHHHHhhccCCCceEEEEChHHHHHHHHHHHhHhhcCHHHHHHHhhhcCCCchhccCce
Confidence 99999999999999999999997542 37899999999999999999999999999988874 35899999987
Q ss_pred ccC--ccccCCCCCeEEEEcCCCCCCchHHHHHHHhCCCCCCeEEEe--cccCCCcchhhhhcCcc--------------
Q psy9966 145 PFD--KSFIDNPGPMVVFATPGMLHSGLSLIIFKKWAPVENNMLIMP--GFCVQGTIGHKVLSGVK-------------- 206 (1101)
Q Consensus 145 ~~~--~~~~~~~gp~VViaspGmL~~G~s~~~~~~w~~d~~N~VI~t--Gy~~~GT~g~~Ll~g~k-------------- 206 (1101)
.+. +++.+.++|||||||+|| |.++++|++|++|++|+|||| ||+.+||+++.+....+
T Consensus 324 ~i~~~~~l~~~~~p~VIiat~~~---G~~~~~l~~~a~d~~n~Vi~t~~g~~~~~t~~~~~~~~~~~~~~~~~~~~~~~~ 400 (514)
T d2i7xa1 324 KIIAPNELSKYPGSKICFVSEVG---ALINEVIIKVGNSEKTTLILTKPSFECASSLDKILEIVEQDERNWKTFPEDGKS 400 (514)
T ss_dssp EECCGGGGGGCCSCEEEEEESCH---HHHHHHHHHHSSCTTEEEEECSSCCTTCHHHHHHHHHHHTCC--------CCCC
T ss_pred eccCHHHHHhccCCcEEEEcCCC---chHHHHHHHHhcCCCCEEEEecCCCcccccHHHHHhhhhhhccccccccccccc
Confidence 764 345567899999999986 999999999999999999998 99999999987753110
Q ss_pred -----eEE-------------------------------ecCCeeEEEeeEEEEEecccCCCHHHHHHHHHHhCCCEEEE
Q psy9966 207 -----KLE-------------------------------FENKQIIDVKMAIEYMSFSAHADAKGIMQLIQYCEPKNVLL 250 (1101)
Q Consensus 207 -----~i~-------------------------------l~~g~~i~v~~~V~~i~fSaHAD~~~l~~~I~~l~Pk~VIL 250 (1101)
... ..++..++++|+|..++||||||+++++.|++.++|++|||
T Consensus 401 ~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~v~~i~~SgHad~~el~~~~~~~~P~~vvl 480 (514)
T d2i7xa1 401 FLCDNYISIDTIKEEPLSKEETNFDNLDYLKIDKTLSKRTISTVNVQLKCSVVILNLQSLVDQRSASIIWPSLKSRKIVL 480 (514)
T ss_dssp EECCEEEEEEEEEEEESCSCCCCCSCCGGGSCSSCCEEEEEEEEEEEECSEEEECCCCCSCCHHHHHHHGGGSCCSEEEE
T ss_pred cccCcceeecccccccccccccCcccccccccccccceeecccceEEEEEEEEEEEeeecCCHHHHHHHHHhhCCCEEEE
Confidence 000 01134578999999999999999999999999999999999
Q ss_pred ecCChhHHHHHHHHHHHHcCCceeecCCCCEEEEe
Q psy9966 251 VHGEASKMVFLKEKIKQEFNLDCFMPANGESCFVQ 285 (1101)
Q Consensus 251 VHGe~~~m~~Lk~~L~~e~gi~v~~P~nGe~v~l~ 285 (1101)
||||+.++..|++.|.++ |++|++|++||+|+++
T Consensus 481 vHGe~~~~~~~a~~l~~~-g~~v~~p~~g~~ie~~ 514 (514)
T d2i7xa1 481 SAPKQIQNEEITAKLIKK-NIEVVNMPLNKIVEFS 514 (514)
T ss_dssp CSCGGGSCHHHHHHHHHT-TCEEEECCSSCCEEEC
T ss_pred eCCCHHHHHHHHHHHHHC-CCeEEecCCCCEEeeC
Confidence 999999999999998876 9999999999999874
|
| >d2dkfa1 d.157.1.10 (A:1-431) Putative RNA-degradation protein TTHA0252 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2i7ta1 d.157.1.10 (A:9-459) Cleavage and polyadenylation specificity factor subunit 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} | Back information, alignment and structure |
|---|
| >d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2az4a1 d.157.1.10 (A:56-238) Hypothetical protein EF2904 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} | Back information, alignment and structure |
|---|
| >d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} | Back information, alignment and structure |
|---|
| >d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1zkpa1 d.157.1.9 (A:1-244) Hypothetical protein BA1088 (BAS1016) {Bacillus anthracis [TaxId: 1392]} | Back information, alignment and structure |
|---|
| >d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1zkpa1 d.157.1.9 (A:1-244) Hypothetical protein BA1088 (BAS1016) {Bacillus anthracis [TaxId: 1392]} | Back information, alignment and structure |
|---|