Psyllid ID: psy1007


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-----
MEKKSKKAAKEKAVIFFSRRCSHLAIKNTIFALSSGHGKCGVSVIRVSGPDTLNALKSMACYPDQKVPKPRYASLRNIVDPVSKVVLDEGLCLWFPRHGKCGVSVIRVSGPDTLNALKSMACYPDQKVSKPRYASLRNIVDPVSEVVLDEGLCLWFPKPNSFTGEDCCEFQVHGSIAVINAILGALTKLPGLRPAEPGEFSKRAFFNNKLDLTQTEALGDLIQAETELQRQKALHQMKGNLKQLYSEWRQLILESLASVEAYIDFSEDEIIEDNILNTVRSQVVQLHGSIEKHIELSNKCGVRIRSGIKSVICLASVEAYIDFSEDEIIEDNILNTVRSQVVQLHGSIEKHIELSNKCGVRIRSGIKSVIVGEPNVGKSSLMNFLCQKQISIVTSIPGTTRDVIEKHLDIGGYPVILLDTAGLRTTTSDIIETEGNLLEKNNQQR
cccccHHHHccccEEEEEcccccccccccEEEEcccccccEEEEEEEEcccHHHHHHHHHcccccccccccEEEEEEEEcccccccccccEEEEcccccccEEEEEEEEcccHHHHHHHHHccccccccccEEEEEEEEEccccccEEcEEEEEEcccccccccccEEEEcccccHHHHHHHHHHHHcccccccccccccHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEccccccccHHHHHHccccccccccccccccEEEEEEEEEccEEEEEEEccccccccccHHHHHHHHHHHHHHcc
ccccHHHHHHHHHHHHHEccHcHHcccEEEEEEEccccccEEEEEEEcccccHHHHHHHcccccccccccHHHHHHHcccccccccccEEEEEEcccccccEEEEEEEccHHHHHHHHHHHcccccccccccEEEEcccEccccccEEEEEEEEEcccccccccccEEEEEccccHHHHHHHHHHHHHcccccccccccccHHHHHcccccHHHHHHHHHHHHHcHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHccEEEEEccEEEEEEEcccccccccccccccHHHHHHHHHHHcccEEEccHcccHcccccEEEEEccccccHHHHHHHHHcccEEEcccccccccccEEEEEEEccEEEEEEcccccccccHHHHHHHHHHHHHHHHcc
MEKKSKKAAKEKAVIFFSRRCSHLAIKNTIFALssghgkcgvsVIRVSGPDTLNALKsmacypdqkvpkpryaslrnivdpvskvvldeglclwfprhgkcgvsvirvsgpdtLNALKsmacypdqkvskpryaslrnivdpvsevvldeglclwfpkpnsftgedccefqvHGSIAVINAILGAltklpglrpaepgefskraffnnkldltqTEALGDLIQAETELQRQKALHQMKGNLKQLYSEWRQLILESLASVEAYidfsedeiiednILNTVRSQVVQLHGSIEKHIELSNKCGVRIRSGIKSVICLASVEAYidfsedeiiednILNTVRSQVVQLHGSIEKHIELSNKCgvrirsgiksvivgepnvgksslMNFLCQKQISivtsipgttrDVIEKHldiggypvilldtaglrtttSDIIETEGNlleknnqqr
mekkskkaakeKAVIFFSRRCSHLAIKNTIFALSSGHGKCGVSVIRVSGPDTLNALKSMACYPDQKVPKPRYASLRNIVDPVSKVVLDEGLCLWFPRHGKCGVSVIRVSGPDTLNALKSMACYPDQKVSKPRYASLRNIVDPVSEVVLDEGLCLWFPKPNSFTGEDCCEFQVHGSIAVINAILGALTKLPGLRPAEPGEFSKRAFFNNKLDLTQTEALGDLIQAETELQRQKALHQMKGNLKQLYSEWRQLILESLASVEAYIDFSEDEIIEDNILNTVRSQVVQLHGSIEKHIELSNKCGVRIRSGIKSVICLASVEAYIDFSEDEIIEDNILNTVRSQVVQLHGSIEkhielsnkCGVRIRSGIKSVIVGEPNVGKSSLMNFLCQKQISIVTSIPGTTRDVIEKHLDIGGYPVILLDTAGLRTTTSDIietegnlleknnqqr
MekkskkaakekaVIFFSRRCSHLAIKNTIFALSSGHGKCGVSVIRVSGPDTLNALKSMACYPDQKVPKPRYASLRNIVDPVSKVVLDEGLCLWFPRHGKCGVSVIRVSGPDTLNALKSMACYPDQKVSKPRYASLRNIVDPVSEVVLDEGLCLWFPKPNSFTGEDCCEFQVHGSIAVINAILGALTKLPGLRPAEPGEFSKRAFFNNKLDLTQTEALGDLIQAETELQRQKALHQMKGNLKQLYSEWRQLILESLASVEAYIDFSEDEIIEDNILNTVRSQVVQLHGSIEKHIELSNKCGVRIRSGIKSVICLASVEAYIDFSEDEIIEDNILNTVRSQVVQLHGSIEKHIELSNKCGVRIRSGIKSVIVGEPNVGKSSLMNFLCQKQISIVTSIPGTTRDVIEKHLDIGGYPVILLDTAGLRTTTSDIIETEGNLLEKNNQQR
************AVIFFSRRCSHLAIKNTIFALSSGHGKCGVSVIRVSGPDTLNALKSMACYPDQKVPKPRYASLRNIVDPVSKVVLDEGLCLWFPRHGKCGVSVIRVSGPDTLNALKSMACYPDQKVSKPRYASLRNIVDPVSEVVLDEGLCLWFPKPNSFTGEDCCEFQVHGSIAVINAILGALTKLPGLRPA***EFSKRAFFNNKLDLTQTEALGDLIQAETELQRQKALHQMKGNLKQLYSEWRQLILESLASVEAYIDFSEDEIIEDNILNTVRSQVVQLHGSIEKHIELSNKCGVRIRSGIKSVICLASVEAYIDFSEDEIIEDNILNTVRSQVVQLHGSIEKHIELSNKCGVRIRSGIKSVIVGEPNVGKSSLMNFLCQKQISIVTSIPGTTRDVIEKHLDIGGYPVILLDTAGLRTTTSDIIE*************
************************AIKNTIFALSSGHGKCGVSVIRVSGPDTLNALKSMACYPDQKVPKPRYASLRNIVDPVSKVVLDEGLCLWFPRHGKCGVSVIRVSGPDTLNALKSMACYPDQKVSKPRYASLRNIVDPVSEVVLDEGLCLWFPKPNSFTGEDCCEFQVHGSIAVINAILGALTKLPGLRPAEPGEFSKRAFFNNKLDLTQTEALGDLIQAETE***************QLYSEWRQLILESLASVEAYIDFSEDEIIEDNILNTVRSQVVQLHGSIEKHIELSNKCGVRIRSGIKSVICLASVEAYIDFSEDEIIEDNILNTVRSQVVQLHGSIEKHIELSNKCGVRIRSGIKSVIVGEPNVGKSSLMNFLCQKQISIVTSIPGTTRDVIEKHLDIGGYPVILLDTAGLRTTTSDIIETEGNLLEKN****
***********KAVIFFSRRCSHLAIKNTIFALSSGHGKCGVSVIRVSGPDTLNALKSMACYPDQKVPKPRYASLRNIVDPVSKVVLDEGLCLWFPRHGKCGVSVIRVSGPDTLNALKSMACYPDQKVSKPRYASLRNIVDPVSEVVLDEGLCLWFPKPNSFTGEDCCEFQVHGSIAVINAILGALTKLPGLRPAEPGEFSKRAFFNNKLDLTQTEALGDLIQAETELQRQKALHQMKGNLKQLYSEWRQLILESLASVEAYIDFSEDEIIEDNILNTVRSQVVQLHGSIEKHIELSNKCGVRIRSGIKSVICLASVEAYIDFSEDEIIEDNILNTVRSQVVQLHGSIEKHIELSNKCGVRIRSGIKSVIVGEPNVGKSSLMNFLCQKQISIVTSIPGTTRDVIEKHLDIGGYPVILLDTAGLRTTTSDIIETEGNLLEKNNQQR
*****KKAAKEKAVIFFSRRCSHLAIKNTIFALSSGHGKCGVSVIRVSGPDTLNALKSMACYPDQKVPKPRYASLRNIVDPVSKVVLDEGLCLWFPRHGKCGVSVIRVSGPDTLNALKSMACYPDQKVSKPRYASLRNIVDPVSEVVLDEGLCLWFPKPNSFTGEDCCEFQVHGSIAVINAILGALTKLPGLRPAEPGEFSKRAFFNNKLDLTQTEALGDLIQAETELQRQKALHQMKGNLKQLYSEWRQLILESLASVEAYIDFSEDEIIEDNILNTVRSQVVQLHGSIEKHIELSNKCGVRIRSGIKSVICLASVEAYIDFSEDEIIEDNILNTVRSQVVQLHGSIEKHIELSNKCGVRIRSGIKSVIVGEPNVGKSSLMNFLCQKQISIVTSIPGTTRDVIEKHLDIGGYPVILLDTAGLRTTTSDIIETEGNLLEKN****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKKSKKAAKEKAVIFFSRRCSHLAIKNTIFALSSGHGKCGVSVIRVSGPDTLNALKSMACYPDQKVPKPRYASLRNIVDPVSKVVLDEGLCLWFPRHGKCGVSVIRVSGPDTLNALKSMACYPDQKVSKPRYASLRNIVDPVSEVVLDEGLCLWFPKPNSFTGEDCCEFQVHGSIAVINAILGALTKLPGLRPAEPGEFSKRAFFNNKLDLTQTEALGDLIQAETELQRQKALHQMKGNLKQLYSEWRQLILESLASVEAYIDFSEDEIIEDNILNTVRSQVVQLHGSIEKHIELSNKCGVRIRSGIKSVICLASVEAYIDFSEDEIIEDNILNTVRSQVVQLHGSIEKHIELSNKCGVRIRSGIKSVIVGEPNVGKSSLMNFLCQKQISIVTSIPGTTRDVIEKHLDIGGYPVILLDTAGLRTTTSDIIETEGNLLEKNNQQR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query445 2.2.26 [Sep-21-2011]
A8GTM1 445 tRNA modification GTPase yes N/A 0.615 0.615 0.406 3e-62
B0BV57 445 tRNA modification GTPase yes N/A 0.615 0.615 0.406 3e-62
Q92GE8 445 tRNA modification GTPase yes N/A 0.615 0.615 0.403 7e-62
A8EZV9 445 tRNA modification GTPase yes N/A 0.615 0.615 0.400 4e-61
Q1RKJ6 445 tRNA modification GTPase yes N/A 0.615 0.615 0.391 4e-61
A8GUF3 445 tRNA modification GTPase yes N/A 0.615 0.615 0.391 5e-61
A8GPN6 445 tRNA modification GTPase yes N/A 0.615 0.615 0.394 1e-60
Q501Z5 500 tRNA modification GTPase yes N/A 0.474 0.422 0.527 7e-60
A8F2P7 445 tRNA modification GTPase yes N/A 0.615 0.615 0.397 2e-59
Q5GTQ0 442 tRNA modification GTPase yes N/A 0.633 0.638 0.399 7e-58
>sp|A8GTM1|MNME_RICRS tRNA modification GTPase MnmE OS=Rickettsia rickettsii (strain Sheila Smith) GN=mnmE PE=3 SV=1 Back     alignment and function desciption
 Score =  239 bits (610), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 137/337 (40%), Positives = 187/337 (55%), Gaps = 63/337 (18%)

Query: 99  GKCGVSVIRVSGPDTLNALKSMACYPDQKVSKPRYASLRNIVDPVSEVVLDEGLCLWFPK 158
           GK GV+V R+SGP +L  L+ +    D    K R    + I  P ++ ++D  + ++F  
Sbjct: 12  GKAGVAVFRISGPKSLEVLQLLTGRKD---FKSRLMYYQQITVPETKELIDNVMVVYFKS 68

Query: 159 PNSFTGEDCCEFQVHGSIAVINAILGALTKLPGLRPAEPGEFSKRAFFNNKLDLTQTEAL 218
           P SFTGED  E   HGS A+   +  AL  + G+R AE GEF+KRAF NNKLDLT  E +
Sbjct: 69  PGSFTGEDVVEIHTHGSKAISIMLTNALLNIAGIRLAEAGEFTKRAFLNNKLDLTAAEGI 128

Query: 219 GDLIQAETELQRQKALHQMKGNLKQLYSEWRQLILESLASVEAYIDFSEDEIIEDNILNT 278
            DLI AET +Q ++A+ Q  G L+ LY+ W                              
Sbjct: 129 ADLINAETIMQHKQAIRQASGKLEALYNNW------------------------------ 158

Query: 279 VRSQVVQLHGSIEKHIELSNKCGVRIRSGIKSVICLASVEAYIDFSEDEIIEDNILNTVR 338
            RSQ++++                           L+ +EAYIDF  DE I D +LN V 
Sbjct: 159 -RSQLLKI---------------------------LSLLEAYIDFP-DEDIPDTVLNEVT 189

Query: 339 SQVVQLHGSIEKHIELSNKCGVRIRSGIKSVIVGEPNVGKSSLMNFLCQKQISIVTSIPG 398
           +    L  +I +++   N+ G  +RSG+K  I+G PNVGKSSL+NFL Q+ I+IV++I G
Sbjct: 190 NTHTILVNTISEYLN-DNRKGELLRSGLKLAIIGPPNVGKSSLLNFLMQRDIAIVSNIAG 248

Query: 399 TTRDVIEKHLDIGGYPVILLDTAGLRTTTSDIIETEG 435
           TTRD+IE HLDIGGYP+IL DTAG+R  +SDIIE EG
Sbjct: 249 TTRDIIEGHLDIGGYPIILQDTAGIREESSDIIEQEG 285




Exhibits a very high intrinsic GTPase hydrolysis rate. Involved in the addition of a carboxymethylaminomethyl (cmnm) group at the wobble position (U34) of certain tRNAs, forming tRNA-cmnm(5)s(2)U34.
Rickettsia rickettsii (strain Sheila Smith) (taxid: 392021)
EC: 3EC: .EC: 6EC: .EC: -EC: .EC: -
>sp|B0BV57|MNME_RICRO tRNA modification GTPase MnmE OS=Rickettsia rickettsii (strain Iowa) GN=mnmE PE=3 SV=1 Back     alignment and function description
>sp|Q92GE8|MNME_RICCN tRNA modification GTPase MnmE OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=mnmE PE=3 SV=1 Back     alignment and function description
>sp|A8EZV9|MNME_RICCK tRNA modification GTPase MnmE OS=Rickettsia canadensis (strain McKiel) GN=mnmE PE=3 SV=1 Back     alignment and function description
>sp|Q1RKJ6|MNME_RICBR tRNA modification GTPase MnmE OS=Rickettsia bellii (strain RML369-C) GN=mnmE PE=3 SV=1 Back     alignment and function description
>sp|A8GUF3|MNME_RICB8 tRNA modification GTPase MnmE OS=Rickettsia bellii (strain OSU 85-389) GN=mnmE PE=3 SV=1 Back     alignment and function description
>sp|A8GPN6|MNME_RICAH tRNA modification GTPase MnmE OS=Rickettsia akari (strain Hartford) GN=mnmE PE=3 SV=1 Back     alignment and function description
>sp|Q501Z5|GTPB3_DANRE tRNA modification GTPase GTPBP3, mitochondrial OS=Danio rerio GN=gtpbp3 PE=2 SV=1 Back     alignment and function description
>sp|A8F2P7|MNME_RICM5 tRNA modification GTPase MnmE OS=Rickettsia massiliae (strain Mtu5) GN=mnmE PE=3 SV=1 Back     alignment and function description
>sp|Q5GTQ0|MNME_WOLTR tRNA modification GTPase MnmE OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=mnmE PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query445
348515307 580 PREDICTED: tRNA modification GTPase GTPB 0.640 0.491 0.468 2e-76
432855043516 PREDICTED: tRNA modification GTPase GTPB 0.615 0.531 0.464 2e-73
193624724485 PREDICTED: tRNA modification GTPase GTPB 0.620 0.569 0.451 4e-73
195151833493 GL21987 [Drosophila persimilis] gi|19411 0.624 0.563 0.449 2e-71
198453278493 GA27334 [Drosophila pseudoobscura pseudo 0.624 0.563 0.446 9e-71
91076116479 PREDICTED: similar to GTP binding protei 0.631 0.586 0.469 4e-70
158301166486 AGAP002133-PA [Anopheles gambiae str. PE 0.613 0.561 0.423 6e-70
195111166494 GI22686 [Drosophila mojavensis] gi|19391 0.624 0.562 0.440 8e-70
195389280494 GJ23413 [Drosophila virilis] gi|19415139 0.624 0.562 0.434 3e-69
195035994495 GH18796 [Drosophila grimshawi] gi|193893 0.624 0.561 0.437 6e-69
>gi|348515307|ref|XP_003445181.1| PREDICTED: tRNA modification GTPase GTPBP3, mitochondrial-like [Oreochromis niloticus] Back     alignment and taxonomy information
 Score =  293 bits (749), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 163/348 (46%), Positives = 208/348 (59%), Gaps = 63/348 (18%)

Query: 98  HGKCGVSVIRVSGPDTLNALKSMACYPDQKVSKPRYASLRNIVDPVSEVVLDEGLCLWFP 157
           HG+CGV+V+RVSGP +  AL+ MA +  Q++  PR A LR+I DP S  VLD GL LWFP
Sbjct: 124 HGRCGVAVVRVSGPASATALRCMAGF-TQRLPPPRTALLRSITDPRSTEVLDRGLVLWFP 182

Query: 158 KPNSFTGEDCCEFQVHGSIAVINAILGALTKLPGLRPAEPGEFSKRAFFNNKLDLTQTEA 217
            P SF+GED  EF +HG  AVI A+L AL  +PGLRPAE GEF++RAF   KL LT+ E 
Sbjct: 183 APRSFSGEDSVEFHIHGGPAVITAVLQALGSVPGLRPAEAGEFTRRAFQAGKLGLTEVEG 242

Query: 218 LGDLIQAETELQRQKALHQMKGNLKQLYSEWRQLILESLASVEAYIDFSEDEIIEDNILN 277
           LGDLI AETE QR++AL QM G L +L                 Y D+S+          
Sbjct: 243 LGDLIHAETEAQRRQALRQMSGELGRL-----------------YQDWSD---------- 275

Query: 278 TVRSQVVQLHGSIEKHIELSNKCGVRIRSGIKSVICLASVEAYIDFSEDEIIEDNILNTV 337
                                    R++       CLA VEA+IDFSEDE+IED +LN V
Sbjct: 276 -------------------------RLKR------CLAHVEAFIDFSEDELIEDGVLNRV 304

Query: 338 RSQVVQLHGSIEKHIELSNKCGVRIRSGIKSVIVGEPNVGKSSLMNFLCQKQISIVTSIP 397
              V  L   IE+H++   + G R+R G++ VI G  N GKSSL+N LCQ+  +IV+ I 
Sbjct: 305 DVSVRDLQAEIERHLK-DERRGERLRGGVQVVIAGATNAGKSSLLNKLCQRPAAIVSPIA 363

Query: 398 GTTRDVIEKHLDIGGYPVILLDTAGLRTTTSDIIETEG--NLLEKNNQ 443
           GTTRDV+E  LD+GG+PV+L DTAGLR  +SD++E EG    LE+  Q
Sbjct: 364 GTTRDVVETALDLGGFPVLLSDTAGLR-DSSDLVEREGVRRALERVEQ 410




Source: Oreochromis niloticus

Species: Oreochromis niloticus

Genus: Oreochromis

Family: Cichlidae

Order: Perciformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota

>gi|432855043|ref|XP_004068044.1| PREDICTED: tRNA modification GTPase GTPBP3, mitochondrial-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|193624724|ref|XP_001945984.1| PREDICTED: tRNA modification GTPase GTPBP3, mitochondrial-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|195151833|ref|XP_002016843.1| GL21987 [Drosophila persimilis] gi|194111900|gb|EDW33943.1| GL21987 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|198453278|ref|XP_002137635.1| GA27334 [Drosophila pseudoobscura pseudoobscura] gi|198132291|gb|EDY68193.1| GA27334 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|91076116|ref|XP_969524.1| PREDICTED: similar to GTP binding protein (mitochondrial), putative [Tribolium castaneum] gi|270014577|gb|EFA11025.1| hypothetical protein TcasGA2_TC004613 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|158301166|ref|XP_320903.3| AGAP002133-PA [Anopheles gambiae str. PEST] gi|157012341|gb|EAA00934.3| AGAP002133-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195111166|ref|XP_002000150.1| GI22686 [Drosophila mojavensis] gi|193916744|gb|EDW15611.1| GI22686 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195389280|ref|XP_002053305.1| GJ23413 [Drosophila virilis] gi|194151391|gb|EDW66825.1| GJ23413 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195035994|ref|XP_001989456.1| GH18796 [Drosophila grimshawi] gi|193893652|gb|EDV92518.1| GH18796 [Drosophila grimshawi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query445
ZFIN|ZDB-GENE-050522-335 500 gtpbp3 "GTP binding protein 3" 0.469 0.418 0.532 5.5e-54
FB|FBgn0039189 493 CG18528 [Drosophila melanogast 0.478 0.432 0.516 1e-52
UNIPROTKB|Q969Y2 492 GTPBP3 "tRNA modification GTPa 0.474 0.428 0.481 4.7e-48
UNIPROTKB|E1BH64 493 E1BH64 "Uncharacterized protei 0.474 0.427 0.485 6e-48
MGI|MGI:1917609 492 Gtpbp3 "GTP binding protein 3" 0.474 0.428 0.467 2.7e-45
RGD|1305367 492 Gtpbp3 "GTP binding protein 3" 0.474 0.428 0.462 5.6e-45
TIGR_CMR|GSU_3465456 GSU_3465 "tRNA modification GT 0.375 0.366 0.392 3.2e-44
DICTYBASE|DDB_G0270228 512 gtpbp3 "GTP-binding protein 3" 0.478 0.416 0.400 2.8e-41
TIGR_CMR|ECH_0060439 ECH_0060 "tRNA modification GT 0.451 0.457 0.442 6.8e-40
TIGR_CMR|APH_1288445 APH_1288 "tRNA modification GT 0.462 0.462 0.420 8.9e-38
ZFIN|ZDB-GENE-050522-335 gtpbp3 "GTP binding protein 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 558 (201.5 bits), Expect = 5.5e-54, P = 5.5e-54
 Identities = 114/214 (53%), Positives = 147/214 (68%)

Query:    99 GKCGVSVIRVSGPDTLNALKSMACYPDQKVSKPRYASLRNIVDPVSEVVLDEGLCLWFPK 158
             GKCGV+V+RVSGP +  A++ +     + +  PR ASLR+I  P S+ +LD GL LWFP 
Sbjct:    45 GKCGVAVVRVSGPASALAVRRLT----RSLPAPRTASLRSISHPQSKELLDRGLVLWFPG 100

Query:   159 PNSFTGEDCCEFQVHGSIAVINAILGALTKLPGLRPAEPGEFSKRAFFNNKLDLTQTEAL 218
             P SFTGED  EF +HG  AVI+ +L AL  LPGLRPAE GEF++RAF+  KLDLT+ E L
Sbjct:   101 PASFTGEDSAEFHIHGGPAVISGVLQALGSLPGLRPAEAGEFTRRAFYAGKLDLTEVEGL 160

Query:   219 GDLIQAETELQRQKALHQMKGNLKQLYSEWRQLILESLASVEAYIDFSEDEIIEDNILNT 278
              DLI AETE QR++AL QM G+L ++Y +W   +   LA VEA+IDFSEDE+IED +LN 
Sbjct:   161 SDLIHAETEAQRRQALRQMAGDLGRIYQDWTDQLKRCLAHVEAFIDFSEDELIEDGVLND 220

Query:   279 VRSQVVQLHGSIEKHIELSNKCGVRIRSGIKSVI 312
             V   V QL   +E H+    + G R+RSG+  VI
Sbjct:   221 VDRAVQQLQTDMENHLS-DERRGERLRSGVHVVI 253


GO:0005525 "GTP binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0006184 "GTP catabolic process" evidence=IEA
GO:0003924 "GTPase activity" evidence=IEA
GO:0006400 "tRNA modification" evidence=IEA
GO:0005739 "mitochondrion" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0008033 "tRNA processing" evidence=IEA
FB|FBgn0039189 CG18528 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q969Y2 GTPBP3 "tRNA modification GTPase GTPBP3, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BH64 E1BH64 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1917609 Gtpbp3 "GTP binding protein 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1305367 Gtpbp3 "GTP binding protein 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_3465 GSU_3465 "tRNA modification GTPase TrmE" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0270228 gtpbp3 "GTP-binding protein 3" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TIGR_CMR|ECH_0060 ECH_0060 "tRNA modification GTPase TrmE" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] Back     alignment and assigned GO terms
TIGR_CMR|APH_1288 APH_1288 "tRNA modification GTPase TrmE" [Anaplasma phagocytophilum HZ (taxid:212042)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5P9B1MNME_ANAMM3, ., 6, ., -, ., -0.37600.61790.6207yesN/A
Q2WBH0MNME_MAGSA3, ., 6, ., -, ., -0.39760.60890.6145yesN/A
Q5FF19MNME_EHRRG3, ., 6, ., -, ., -0.38570.60440.6127yesN/A
Q2RN77MNME_RHORT3, ., 6, ., -, ., -0.36120.62240.6087yesN/A
A7HSK9MNME_PARL13, ., 6, ., -, ., -0.38870.61340.6232yesN/A
Q501Z5GTPB3_DANRENo assigned EC number0.52770.47410.422yesN/A
A8EZV9MNME_RICCK3, ., 6, ., -, ., -0.40050.61570.6157yesN/A
B0BV57MNME_RICRO3, ., 6, ., -, ., -0.40650.61570.6157yesN/A
C0R405MNME_WOLWR3, ., 6, ., -, ., -0.41240.60890.6131yesN/A
B4RD04MNME_PHEZH3, ., 6, ., -, ., -0.37090.60670.6067yesN/A
Q68VZ0MNME_RICTY3, ., 6, ., -, ., -0.38870.61570.6157yesN/A
Q21CM0MNME_RHOPB3, ., 6, ., -, ., -0.36710.60670.6013yesN/A
Q2GI42MNME_EHRCR3, ., 6, ., -, ., -0.37380.60440.6127yesN/A
Q5GTQ0MNME_WOLTR3, ., 6, ., -, ., -0.39940.63370.6380yesN/A
Q3YT72MNME_EHRCJ3, ., 6, ., -, ., -0.38270.60440.6099yesN/A
A8F2P7MNME_RICM53, ., 6, ., -, ., -0.39760.61570.6157yesN/A
A8I264MNME_AZOC53, ., 6, ., -, ., -0.36010.60670.6206yesN/A
Q5HCD7MNME_EHRRW3, ., 6, ., -, ., -0.38570.60440.6127yesN/A
Q92GE8MNME_RICCN3, ., 6, ., -, ., -0.40350.61570.6157yesN/A
Q9ZCI1MNME_RICPR3, ., 6, ., -, ., -0.39160.61570.6157yesN/A
A8GUF3MNME_RICB83, ., 6, ., -, ., -0.39160.61570.6157yesN/A
B0UJI9MNME_METS43, ., 6, ., -, ., -0.37270.61790.6292yesN/A
Q2GC37MNME_NOVAD3, ., 6, ., -, ., -0.35130.61790.6292yesN/A
Q0AKE8MNME_MARMM3, ., 6, ., -, ., -0.36360.60220.6118yesN/A
B3CMJ7MNME_WOLPP3, ., 6, ., -, ., -0.41240.60890.6131yesN/A
A8GPN6MNME_RICAH3, ., 6, ., -, ., -0.39460.61570.6157yesN/A
A8GTM1MNME_RICRS3, ., 6, ., -, ., -0.40650.61570.6157yesN/A
Q1RKJ6MNME_RICBR3, ., 6, ., -, ., -0.39160.61570.6157yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query445
PRK05291 449 PRK05291, trmE, tRNA modification GTPase TrmE; Rev 1e-122
COG0486 454 COG0486, ThdF, Predicted GTPase [General function 1e-112
TIGR00450 442 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPas 8e-57
pfam10396114 pfam10396, TrmE_N, GTP-binding protein TrmE N-term 3e-47
cd04164159 cd04164, trmE, trmE is a tRNA modification GTPase 1e-35
pfam10396114 pfam10396, TrmE_N, GTP-binding protein TrmE N-term 1e-19
cd01895174 cd01895, EngA2, EngA2 GTPase contains the second d 2e-18
pfam01926117 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase 6e-18
TIGR03594 429 TIGR03594, GTPase_EngA, ribosome-associated GTPase 8e-18
PRK00093 435 PRK00093, PRK00093, GTP-binding protein Der; Revie 2e-17
COG1160 444 COG1160, COG1160, Predicted GTPases [General funct 3e-17
cd01894157 cd01894, EngA1, EngA1 GTPase contains the first do 4e-17
PRK05291449 PRK05291, trmE, tRNA modification GTPase TrmE; Rev 2e-16
COG1160 444 COG1160, COG1160, Predicted GTPases [General funct 2e-16
PRK00093 435 PRK00093, PRK00093, GTP-binding protein Der; Revie 1e-15
cd00880161 cd00880, Era_like, E 4e-15
COG0486454 COG0486, ThdF, Predicted GTPase [General function 2e-14
TIGR03918 391 TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster 2e-14
TIGR03594 429 TIGR03594, GTPase_EngA, ribosome-associated GTPase 4e-14
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 6e-12
cd04163168 cd04163, Era, E 2e-11
PRK03003 472 PRK03003, PRK03003, GTP-binding protein Der; Revie 7e-11
PRK00089 292 PRK00089, era, GTPase Era; Reviewed 1e-10
COG1159 298 COG1159, Era, GTPase [General function prediction 3e-10
COG1161 322 COG1161, COG1161, Predicted GTPases [General funct 3e-10
TIGR00231162 TIGR00231, small_GTP, small GTP-binding protein do 7e-10
PRK09518 712 PRK09518, PRK09518, bifunctional cytidylate kinase 8e-10
TIGR00436 270 TIGR00436, era, GTP-binding protein Era 2e-09
cd01856171 cd01856, YlqF, Circularly permuted YlqF GTPase 4e-08
PRK09563287 PRK09563, rbgA, GTPase YlqF; Reviewed 5e-07
TIGR03596276 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-bi 6e-07
TIGR03597 360 TIGR03597, GTPase_YqeH, ribosome biogenesis GTPase 1e-06
PRK09518 712 PRK09518, PRK09518, bifunctional cytidylate kinase 2e-06
cd04178171 cd04178, Nucleostemin_like, A circularly permuted 4e-06
cd01855191 cd01855, YqeH, Circularly permuted YqeH GTPase 4e-06
PRK03003 472 PRK03003, PRK03003, GTP-binding protein Der; Revie 1e-05
COG1084346 COG1084, COG1084, Predicted GTPase [General functi 3e-05
cd01857140 cd01857, HSR1_MMR1, A circularly permuted subfamil 4e-05
cd01849146 cd01849, YlqF_related_GTPase, Circularly permuted 5e-05
COG0370 653 COG0370, FeoB, Fe2+ transport system protein B [In 6e-05
cd01879159 cd01879, FeoB, Ferrous iron transport protein B (F 7e-05
cd01897167 cd01897, NOG, Nucleolar GTP-binding protein (NOG) 9e-05
PRK15494 339 PRK15494, era, GTPase Era; Provisional 1e-04
cd01881167 cd01881, Obg_like, Obg-like family of GTPases cons 1e-04
cd11383140 cd11383, YfjP, YfjP GTPase 1e-04
pfam02421 190 pfam02421, FeoB_N, Ferrous iron transport protein 2e-04
PRK13796 365 PRK13796, PRK13796, GTPase YqeH; Provisional 2e-04
cd01876170 cd01876, YihA_EngB, YihA (EngB) GTPase family 6e-04
cd01858157 cd01858, NGP_1, A novel nucleolar GTP-binding prot 0.001
COG1100 219 COG1100, COG1100, GTPase SAR1 and related small G 0.001
COG3596 296 COG3596, COG3596, Predicted GTPase [General functi 0.002
>gnl|CDD|235392 PRK05291, trmE, tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
 Score =  361 bits (930), Expect = e-122
 Identities = 138/338 (40%), Positives = 183/338 (54%), Gaps = 67/338 (19%)

Query: 98  HGKCGVSVIRVSGPDTLNALKSMACYPDQKVSKPRYASLRNIVDPVSEVVLDEGLCLWFP 157
            G+ G+ +IR+SGPD L   + +     +K+ KPR A   +I DP    V+DE L L+FP
Sbjct: 14  PGRGGIGIIRISGPDALEIAQKLF---GKKLPKPRTAHYGHIRDP--GEVIDEVLVLYFP 68

Query: 158 KPNSFTGEDCCEFQVHGSIAVINAILGALTKLPGLRPAEPGEFSKRAFFNNKLDLTQTEA 217
            PNSFTGED  E Q HG  AV+N IL  L  L G R AEPGEF+KRAF N KLDLTQ EA
Sbjct: 69  APNSFTGEDVVEIQCHGGPAVLNLILELLLAL-GARLAEPGEFTKRAFLNGKLDLTQAEA 127

Query: 218 LGDLIQAETELQRQKALHQMKGNLKQLYSEWRQLILESLASVEAYIDFSEDEIIEDNILN 277
           + DLI A+TE   + AL Q++G L +L +E R+ +LE LA VEA IDF E++        
Sbjct: 128 IADLIDAKTEAAARLALRQLQGALSKLINELREELLELLALVEAAIDFPEED-------- 179

Query: 278 TVRSQVVQLHGSIEKHIELSNKCGVRIRSGIKSVICLASVEAYIDFSEDEIIEDNILNTV 337
                                                      I+F  DE I + +    
Sbjct: 180 -------------------------------------------IEFLSDEKILEKLEE-- 194

Query: 338 RSQVVQLHGSIEKHIELSNKCGVRIRSGIKSVIVGEPNVGKSSLMNFLCQKQISIVTSIP 397
                 L   +E  +  + + G  +R G+K VI G PNVGKSSL+N L  ++ +IVT I 
Sbjct: 195 ------LIAELEALLASARQ-GEILREGLKVVIAGRPNVGKSSLLNALLGEERAIVTDIA 247

Query: 398 GTTRDVIEKHLDIGGYPVILLDTAGLRTTTSDIIETEG 435
           GTTRDVIE+H+++ G P+ L+DTAG+R T  D +E  G
Sbjct: 248 GTTRDVIEEHINLDGIPLRLIDTAGIRETD-DEVEKIG 284


Length = 449

>gnl|CDD|223561 COG0486, ThdF, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|232980 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPase TrmE Back     alignment and domain information
>gnl|CDD|204472 pfam10396, TrmE_N, GTP-binding protein TrmE N-terminus Back     alignment and domain information
>gnl|CDD|206727 cd04164, trmE, trmE is a tRNA modification GTPase Back     alignment and domain information
>gnl|CDD|204472 pfam10396, TrmE_N, GTP-binding protein TrmE N-terminus Back     alignment and domain information
>gnl|CDD|206682 cd01895, EngA2, EngA2 GTPase contains the second domain of EngA Back     alignment and domain information
>gnl|CDD|216791 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase Back     alignment and domain information
>gnl|CDD|234274 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA Back     alignment and domain information
>gnl|CDD|234628 PRK00093, PRK00093, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|224082 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|206681 cd01894, EngA1, EngA1 GTPase contains the first domain of EngA Back     alignment and domain information
>gnl|CDD|235392 PRK05291, trmE, tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>gnl|CDD|224082 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|234628 PRK00093, PRK00093, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|206646 cd00880, Era_like, E Back     alignment and domain information
>gnl|CDD|223561 COG0486, ThdF, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|234395 TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster maturation GTPase HydF Back     alignment and domain information
>gnl|CDD|234274 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206726 cd04163, Era, E Back     alignment and domain information
>gnl|CDD|179525 PRK03003, PRK03003, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|234624 PRK00089, era, GTPase Era; Reviewed Back     alignment and domain information
>gnl|CDD|224081 COG1159, Era, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224083 COG1161, COG1161, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|236546 PRK09518, PRK09518, bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>gnl|CDD|129528 TIGR00436, era, GTP-binding protein Era Back     alignment and domain information
>gnl|CDD|206749 cd01856, YlqF, Circularly permuted YlqF GTPase Back     alignment and domain information
>gnl|CDD|236570 PRK09563, rbgA, GTPase YlqF; Reviewed Back     alignment and domain information
>gnl|CDD|213833 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>gnl|CDD|213834 TIGR03597, GTPase_YqeH, ribosome biogenesis GTPase YqeH Back     alignment and domain information
>gnl|CDD|236546 PRK09518, PRK09518, bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>gnl|CDD|206753 cd04178, Nucleostemin_like, A circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|206748 cd01855, YqeH, Circularly permuted YqeH GTPase Back     alignment and domain information
>gnl|CDD|179525 PRK03003, PRK03003, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|224009 COG1084, COG1084, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|206750 cd01857, HSR1_MMR1, A circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|206746 cd01849, YlqF_related_GTPase, Circularly permuted YlqF-related GTPases Back     alignment and domain information
>gnl|CDD|223447 COG0370, FeoB, Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|206667 cd01879, FeoB, Ferrous iron transport protein B (FeoB) family Back     alignment and domain information
>gnl|CDD|206684 cd01897, NOG, Nucleolar GTP-binding protein (NOG) Back     alignment and domain information
>gnl|CDD|185391 PRK15494, era, GTPase Era; Provisional Back     alignment and domain information
>gnl|CDD|206668 cd01881, Obg_like, Obg-like family of GTPases consist of five subfamilies: Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>gnl|CDD|206743 cd11383, YfjP, YfjP GTPase Back     alignment and domain information
>gnl|CDD|217025 pfam02421, FeoB_N, Ferrous iron transport protein B Back     alignment and domain information
>gnl|CDD|237511 PRK13796, PRK13796, GTPase YqeH; Provisional Back     alignment and domain information
>gnl|CDD|206665 cd01876, YihA_EngB, YihA (EngB) GTPase family Back     alignment and domain information
>gnl|CDD|206751 cd01858, NGP_1, A novel nucleolar GTP-binding protein, circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|226124 COG3596, COG3596, Predicted GTPase [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 445
COG0486 454 ThdF Predicted GTPase [General function prediction 100.0
PRK05291 449 trmE tRNA modification GTPase TrmE; Reviewed 100.0
TIGR00450 442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 100.0
KOG1191|consensus 531 100.0
PF10396114 TrmE_N: GTP-binding protein TrmE N-terminus; Inter 100.0
COG1162301 Predicted GTPases [General function prediction onl 99.84
PRK12288347 GTPase RsgA; Reviewed 99.74
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 99.73
PRK12289352 GTPase RsgA; Reviewed 99.72
COG0486454 ThdF Predicted GTPase [General function prediction 99.7
PRK00098298 GTPase RsgA; Reviewed 99.61
COG0404379 GcvT Glycine cleavage system T protein (aminomethy 99.6
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 99.59
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.54
TIGR00450 442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.5
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.48
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 99.48
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 99.44
COG1160 444 Predicted GTPases [General function prediction onl 99.4
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 99.32
PRK12486368 dmdA putative dimethyl sulfoniopropionate demethyl 99.32
PRK01889356 GTPase RsgA; Reviewed 99.3
PRK09563287 rbgA GTPase YlqF; Reviewed 99.29
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 99.28
PLN02319404 aminomethyltransferase 99.27
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 99.26
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 99.25
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 99.23
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.23
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 99.23
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 99.22
TIGR03597 360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 99.22
PRK13796 365 GTPase YqeH; Provisional 99.22
COG1160 444 Predicted GTPases [General function prediction onl 99.21
KOG2770|consensus401 99.2
COG1159 298 Era GTPase [General function prediction only] 99.19
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.18
COG1084346 Predicted GTPase [General function prediction only 99.17
PRK13579370 gcvT glycine cleavage system aminomethyltransferas 99.15
PRK03003 472 GTP-binding protein Der; Reviewed 99.13
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.09
PF10396114 TrmE_N: GTP-binding protein TrmE N-terminus; Inter 99.08
COG1161 322 Predicted GTPases [General function prediction onl 99.07
TIGR00528361 gcvT glycine cleavage system T protein. Eukaryotic 99.07
PRK00093 435 GTP-binding protein Der; Reviewed 99.06
PF01571211 GCV_T: Aminomethyltransferase folate-binding domai 99.03
TIGR01372985 soxA sarcosine oxidase, alpha subunit family, hete 99.02
TIGR00436 270 era GTP-binding protein Era. Era is an essential G 99.02
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.01
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 98.99
PRK15494 339 era GTPase Era; Provisional 98.96
KOG1424|consensus 562 98.96
PRK00389359 gcvT glycine cleavage system aminomethyltransferas 98.91
cd01853 249 Toc34_like Toc34-like (Translocon at the Outer-env 98.91
PRK11058 426 GTPase HflX; Provisional 98.9
KOG2484|consensus 435 98.89
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 98.83
cd01852 196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 98.83
PRK00089 292 era GTPase Era; Reviewed 98.78
KOG0084|consensus 205 98.77
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 98.76
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 98.73
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 98.72
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 98.72
TIGR00991 313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 98.71
PRK00093 435 GTP-binding protein Der; Reviewed 98.71
PRK03003 472 GTP-binding protein Der; Reviewed 98.71
cd01878204 HflX HflX subfamily. A distinct conserved domain w 98.7
KOG1423|consensus 379 98.69
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 98.69
PTZ00258 390 GTP-binding protein; Provisional 98.67
KOG0080|consensus 209 98.65
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 98.65
KOG0394|consensus 210 98.65
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 98.65
TIGR00231161 small_GTP small GTP-binding protein domain. This m 98.65
PRK09601 364 GTP-binding protein YchF; Reviewed 98.64
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 98.64
KOG0094|consensus 221 98.63
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 98.63
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 98.63
cd01900 274 YchF YchF subfamily. YchF is a member of the Obg f 98.62
PRK12298 390 obgE GTPase CgtA; Reviewed 98.62
cd04171164 SelB SelB subfamily. SelB is an elongation factor 98.61
TIGR00993 763 3a0901s04IAP86 chloroplast protein import componen 98.6
cd01896 233 DRG The developmentally regulated GTP-binding prot 98.6
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 98.59
cd01881176 Obg_like The Obg-like subfamily consists of five w 98.59
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 98.58
PF04548 212 AIG1: AIG1 family; InterPro: IPR006703 This entry 98.58
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 98.58
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 98.58
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 98.57
PRK12299335 obgE GTPase CgtA; Reviewed 98.56
cd04142 198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 98.55
COG0218200 Predicted GTPase [General function prediction only 98.55
KOG0092|consensus 200 98.55
KOG2485|consensus 335 98.55
PRK00454196 engB GTP-binding protein YsxC; Reviewed 98.55
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 98.54
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 98.53
PRK12296 500 obgE GTPase CgtA; Reviewed 98.53
KOG0087|consensus 222 98.52
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 98.52
KOG1191|consensus 531 98.52
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 98.52
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 98.51
COG1163 365 DRG Predicted GTPase [General function prediction 98.49
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 98.49
PRK04213 201 GTP-binding protein; Provisional 98.48
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 98.48
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 98.47
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 98.47
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 98.46
cd04107 201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 98.46
COG3596 296 Predicted GTPase [General function prediction only 98.46
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 98.45
PRK12297 424 obgE GTPase CgtA; Reviewed 98.45
KOG0079|consensus 198 98.45
PTZ00369 189 Ras-like protein; Provisional 98.45
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 98.45
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 98.45
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 98.45
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 98.45
KOG0098|consensus 216 98.44
cd04112 191 Rab26 Rab26 subfamily. First identified in rat pan 98.44
cd04109 215 Rab28 Rab28 subfamily. First identified in maize, 98.44
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 98.44
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 98.43
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 98.43
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 98.43
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 98.43
KOG0095|consensus 213 98.43
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 98.43
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 98.43
KOG0078|consensus 207 98.42
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 98.42
cd04118 193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 98.42
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 98.42
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 98.42
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 98.42
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 98.41
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 98.41
cd01899 318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 98.41
cd04120 202 Rab12 Rab12 subfamily. Rab12 was first identified 98.4
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 98.4
cd04144 190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 98.39
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 98.39
COG2262 411 HflX GTPases [General function prediction only] 98.38
cd04128 182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 98.38
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 98.38
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 98.38
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 98.37
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 98.37
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 98.37
PLN03118 211 Rab family protein; Provisional 98.37
PRK09602 396 translation-associated GTPase; Reviewed 98.37
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 98.36
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 98.35
cd04110 199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 98.35
cd04125 188 RabA_like RabA-like subfamily. RabA was first iden 98.35
PLN03110 216 Rab GTPase; Provisional 98.35
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 98.34
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 98.34
cd04173 222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 98.33
cd01875 191 RhoG RhoG subfamily. RhoG is a GTPase with high se 98.33
cd01850 276 CDC_Septin CDC/Septin. Septins are a conserved fam 98.33
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 98.33
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 98.33
KOG2423|consensus 572 98.32
cd04143 247 Rhes_like Rhes_like subfamily. This subfamily incl 98.32
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 98.31
cd00154159 Rab Rab family. Rab GTPases form the largest famil 98.31
smart00178184 SAR Sar1p-like members of the Ras-family of small 98.31
cd04123162 Rab21 Rab21 subfamily. The localization and functi 98.3
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 98.3
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 98.3
cd04174 232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 98.3
KOG0086|consensus 214 98.3
cd04132 187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 98.3
cd04111 211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 98.3
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 98.29
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 98.29
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 98.29
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 98.29
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 98.29
cd04134 189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 98.28
cd04121 189 Rab40 Rab40 subfamily. This subfamily contains Rab 98.28
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 98.27
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 98.27
PLN03071 219 GTP-binding nuclear protein Ran; Provisional 98.26
PLN03108 210 Rab family protein; Provisional 98.25
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 98.25
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 98.24
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 98.24
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 98.24
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 98.23
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 98.23
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 98.22
cd04148 221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 98.22
PTZ00133182 ADP-ribosylation factor; Provisional 98.21
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 98.21
PRK09559327 putative global regulator; Reviewed 98.21
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 98.2
cd00876160 Ras Ras family. The Ras family of the Ras superfam 98.2
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 98.2
cd04147 198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 98.2
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 98.19
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 98.18
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 98.18
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 98.17
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 98.17
cd01851 224 GBP Guanylate-binding protein (GBP), N-terminal do 98.17
cd04102 202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 98.15
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 98.14
cd00881189 GTP_translation_factor GTP translation factor fami 98.13
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 98.12
PLN00223181 ADP-ribosylation factor; Provisional 98.12
COG1100 219 GTPase SAR1 and related small G proteins [General 98.1
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 98.1
cd04126 220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 98.09
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 98.07
PRK12317 425 elongation factor 1-alpha; Reviewed 98.05
KOG0091|consensus 213 98.05
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 98.04
PLN00023 334 GTP-binding protein; Provisional 98.04
KOG0097|consensus 215 98.03
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 98.03
cd04129 187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 98.03
COG0012 372 Predicted GTPase, probable translation factor [Tra 98.03
cd04104 197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 98.03
PTZ00132 215 GTP-binding nuclear protein Ran; Provisional 98.01
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 98.01
KOG0393|consensus 198 98.01
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 97.99
KOG1486|consensus 364 97.91
PF00735 281 Septin: Septin; InterPro: IPR000038 Septins consti 97.91
PRK05306 787 infB translation initiation factor IF-2; Validated 97.89
cd04168 237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 97.86
TIGR00092 368 GTP-binding protein YchF. This predicted GTP-bindi 97.83
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 97.83
KOG1491|consensus 391 97.83
KOG1490|consensus 620 97.82
cd01886 270 EF-G Elongation factor G (EF-G) subfamily. Translo 97.81
KOG0395|consensus 196 97.8
cd04105 203 SR_beta Signal recognition particle receptor, beta 97.78
smart00176 200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 97.75
PRK15467158 ethanolamine utilization protein EutP; Provisional 97.75
TIGR02836 492 spore_IV_A stage IV sporulation protein A. A compa 97.73
KOG2844|consensus856 97.73
KOG1547|consensus 336 97.72
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 97.72
cd04169 267 RF3 RF3 subfamily. Peptide chain release factor 3 97.71
KOG1489|consensus366 97.71
PF05049 376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 97.69
KOG0410|consensus 410 97.65
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 97.64
CHL00189 742 infB translation initiation factor 2; Provisional 97.64
COG0536 369 Obg Predicted GTPase [General function prediction 97.62
cd04170 268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 97.61
KOG0083|consensus 192 97.61
KOG0088|consensus 218 97.59
PF00025175 Arf: ADP-ribosylation factor family The prints ent 97.59
KOG0093|consensus193 97.59
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 97.57
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 97.57
cd04167 213 Snu114p Snu114p subfamily. Snu114p is one of sever 97.53
CHL00071 409 tufA elongation factor Tu 97.52
PRK12735 396 elongation factor Tu; Reviewed 97.49
COG5019 373 CDC3 Septin family protein [Cell division and chro 97.47
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 97.46
cd01883 219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 97.46
KOG0075|consensus186 97.45
KOG0073|consensus185 97.45
KOG2655|consensus 366 97.45
TIGR00483 426 EF-1_alpha translation elongation factor EF-1 alph 97.43
TIGR00485 394 EF-Tu translation elongation factor TU. This align 97.41
PLN03127 447 Elongation factor Tu; Provisional 97.41
KOG4252|consensus 246 97.39
KOG0081|consensus 219 97.35
PF04670 232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 97.33
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 97.31
PRK12736 394 elongation factor Tu; Reviewed 97.29
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 97.29
PRK10218 607 GTP-binding protein; Provisional 97.27
PRK12739 691 elongation factor G; Reviewed 97.26
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 97.23
PRK04004 586 translation initiation factor IF-2; Validated 97.21
PLN03126 478 Elongation factor Tu; Provisional 97.18
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 97.17
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 97.16
PRK05124 474 cysN sulfate adenylyltransferase subunit 1; Provis 97.13
PRK00007 693 elongation factor G; Reviewed 97.09
PRK00049 396 elongation factor Tu; Reviewed 97.09
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 97.09
TIGR02034 406 CysN sulfate adenylyltransferase, large subunit. H 97.04
TIGR01375152 soxG sarcosine oxidase, gamma subunit family, hete 97.04
PRK00741 526 prfC peptide chain release factor 3; Provisional 97.04
PRK13351 687 elongation factor G; Reviewed 96.94
cd01888 203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 96.93
cd01885 222 EF2 EF2 (for archaea and eukarya). Translocation r 96.92
TIGR00503 527 prfC peptide chain release factor 3. This translat 96.92
TIGR00490 720 aEF-2 translation elongation factor aEF-2. This mo 96.77
cd01882 225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 96.74
PF09439181 SRPRB: Signal recognition particle receptor beta s 96.69
PRK05433 600 GTP-binding protein LepA; Provisional 96.69
PRK14722 374 flhF flagellar biosynthesis regulator FlhF; Provis 96.64
PTZ00141 446 elongation factor 1- alpha; Provisional 96.6
cd04165 224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 96.6
COG2229187 Predicted GTPase [General function prediction only 96.59
KOG1487|consensus 358 96.52
PRK14721 420 flhF flagellar biosynthesis regulator FlhF; Provis 96.42
KOG0070|consensus181 96.39
PRK09866 741 hypothetical protein; Provisional 96.38
TIGR03680 406 eif2g_arch translation initiation factor 2 subunit 96.36
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 96.35
COG0194 191 Gmk Guanylate kinase [Nucleotide transport and met 96.25
PRK04000 411 translation initiation factor IF-2 subunit gamma; 96.13
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 96.11
KOG1673|consensus 205 96.09
KOG3883|consensus 198 95.95
KOG0074|consensus185 95.87
KOG0096|consensus 216 95.8
PRK12740 668 elongation factor G; Reviewed 95.77
PRK14737 186 gmk guanylate kinase; Provisional 95.69
KOG3859|consensus 406 95.65
PTZ00416 836 elongation factor 2; Provisional 95.5
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 95.48
COG1419 407 FlhF Flagellar GTP-binding protein [Cell motility 95.42
KOG2486|consensus 320 95.4
COG1116 248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 95.37
PRK12727 559 flagellar biosynthesis regulator FlhF; Provisional 95.29
PLN00116 843 translation elongation factor EF-2 subunit; Provis 95.25
PRK07560 731 elongation factor EF-2; Reviewed 95.23
KOG0071|consensus180 95.2
PF00005137 ABC_tran: ABC transporter This structure is on hol 95.13
KOG2929|consensus348 95.12
COG4917148 EutP Ethanolamine utilization protein [Amino acid 95.1
PLN00043 447 elongation factor 1-alpha; Provisional 95.07
PRK00300 205 gmk guanylate kinase; Provisional 95.05
PRK14738 206 gmk guanylate kinase; Provisional 94.94
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 94.89
COG5256 428 TEF1 Translation elongation factor EF-1alpha (GTPa 94.78
PRK12726 407 flagellar biosynthesis regulator FlhF; Provisional 94.71
COG1136 226 SalX ABC-type antimicrobial peptide transport syst 94.67
COG3840 231 ThiQ ABC-type thiamine transport system, ATPase co 94.65
KOG0090|consensus 238 94.47
KOG1707|consensus 625 94.43
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 94.42
cd03264 211 ABC_drug_resistance_like ABC-type multidrug transp 94.4
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 94.34
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 94.32
cd03225 211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 94.32
cd03255 218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 94.31
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 94.29
cd03261 235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 94.28
TIGR00960 216 3a0501s02 Type II (General) Secretory Pathway (IIS 94.26
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 94.25
PF1355562 AAA_29: P-loop containing region of AAA domain 94.24
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 94.22
smart00053 240 DYNc Dynamin, GTPase. Large GTPases that mediate v 94.21
COG1120 258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 94.2
COG1126 240 GlnQ ABC-type polar amino acid transport system, A 94.14
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 94.14
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 94.14
TIGR02673 214 FtsE cell division ATP-binding protein FtsE. This 94.12
cd03265 220 ABC_DrrA DrrA is the ATP-binding protein component 94.06
cd03224 222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 94.05
cd03269 210 ABC_putative_ATPase This subfamily is involved in 94.03
PRK10078 186 ribose 1,5-bisphosphokinase; Provisional 94.03
cd03262 213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 94.01
cd03259 213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 94.01
TIGR03608 206 L_ocin_972_ABC putative bacteriocin export ABC tra 94.0
cd03293 220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 94.0
cd03216163 ABC_Carb_Monos_I This family represents the domain 93.98
TIGR02315 243 ABC_phnC phosphonate ABC transporter, ATP-binding 93.96
cd03260 227 ABC_PstB_phosphate_transporter Phosphate uptake is 93.96
cd03257 228 ABC_NikE_OppD_transporters The ABC transporter sub 93.92
cd03235 213 ABC_Metallic_Cations ABC component of the metal-ty 93.9
cd03263 220 ABC_subfamily_A The ABCA subfamily mediates the tr 93.87
cd03292 214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 93.86
TIGR02211 221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 93.84
KOG0077|consensus193 93.83
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 93.79
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 93.79
cd03258 233 ABC_MetN_methionine_transporter MetN (also known a 93.79
PRK15177 213 Vi polysaccharide export ATP-binding protein VexC; 93.77
COG4525 259 TauB ABC-type taurine transport system, ATPase com 93.76
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 93.73
TIGR01978 243 sufC FeS assembly ATPase SufC. SufC is part of the 93.72
cd03256 241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 93.72
PRK05703 424 flhF flagellar biosynthesis regulator FlhF; Valida 93.7
PRK11248 255 tauB taurine transporter ATP-binding subunit; Prov 93.69
cd03218 232 ABC_YhbG The ABC transporters belonging to the Yhb 93.68
cd03301 213 ABC_MalK_N The N-terminal ATPase domain of the mal 93.67
cd03219 236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 93.66
PRK09435 332 membrane ATPase/protein kinase; Provisional 93.66
PRK11629 233 lolD lipoprotein transporter ATP-binding subunit; 93.63
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 93.62
KOG3886|consensus 295 93.61
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 93.61
PRK14242 253 phosphate transporter ATP-binding protein; Provisi 93.58
cd03268 208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 93.58
cd03215182 ABC_Carb_Monos_II This family represents domain II 93.57
COG4108 528 PrfC Peptide chain release factor RF-3 [Translatio 93.57
cd03266 218 ABC_NatA_sodium_exporter NatA is the ATPase compon 93.56
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 93.55
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 93.54
TIGR02770 230 nickel_nikD nickel import ATP-binding protein NikD 93.54
PRK10908 222 cell division protein FtsE; Provisional 93.53
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 93.52
cd03254 229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 93.52
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 93.48
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 93.48
TIGR03410 230 urea_trans_UrtE urea ABC transporter, ATP-binding 93.47
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 93.47
cd03296 239 ABC_CysA_sulfate_importer Part of the ABC transpor 93.47
PRK11124 242 artP arginine transporter ATP-binding subunit; Pro 93.46
PRK06995 484 flhF flagellar biosynthesis regulator FlhF; Valida 93.45
PRK10584 228 putative ABC transporter ATP-binding protein YbbA; 93.44
PRK14247 250 phosphate ABC transporter ATP-binding protein; Pro 93.44
TIGR03864 236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 93.43
PRK10895 241 lipopolysaccharide ABC transporter ATP-binding pro 93.42
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 93.42
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 93.38
PRK11264 250 putative amino-acid ABC transporter ATP-binding pr 93.37
COG4559 259 ABC-type hemin transport system, ATPase component 93.31
cd03237 246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 93.29
smart00382148 AAA ATPases associated with a variety of cellular 93.29
cd03295 242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 93.28
cd03298 211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 93.28
COG0410 237 LivF ABC-type branched-chain amino acid transport 93.27
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 93.27
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 93.24
TIGR00235 207 udk uridine kinase. Model contains a number of lon 93.24
PRK13638 271 cbiO cobalt transporter ATP-binding subunit; Provi 93.2
PRK10744 260 pstB phosphate transporter ATP-binding protein; Pr 93.2
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 93.19
TIGR02323 253 CP_lyasePhnK phosphonate C-P lyase system protein 93.19
PRK14239 252 phosphate transporter ATP-binding protein; Provisi 93.18
cd03294 269 ABC_Pro_Gly_Bertaine This family comprises the gly 93.17
PRK10575 265 iron-hydroxamate transporter ATP-binding subunit; 93.17
KOG0076|consensus197 93.16
PRK11300 255 livG leucine/isoleucine/valine transporter ATP-bin 93.14
cd03234 226 ABCG_White The White subfamily represents ABC tran 93.14
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 93.14
PRK15056 272 manganese/iron transporter ATP-binding protein; Pr 93.13
PRK13645 289 cbiO cobalt transporter ATP-binding subunit; Provi 93.13
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 93.13
PRK11247 257 ssuB aliphatic sulfonates transport ATP-binding su 93.13
PRK10247 225 putative ABC transporter ATP-binding protein YbbL; 93.12
PRK14267 253 phosphate ABC transporter ATP-binding protein; Pro 93.12
PRK14262 250 phosphate ABC transporter ATP-binding protein; Pro 93.11
PRK11701 258 phnK phosphonate C-P lyase system protein PhnK; Pr 93.11
PRK14250 241 phosphate ABC transporter ATP-binding protein; Pro 93.11
PRK14273 254 phosphate ABC transporter ATP-binding protein; Pro 93.1
TIGR03740 223 galliderm_ABC gallidermin-class lantibiotic protec 93.08
cd03236 255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 93.08
TIGR03005 252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 93.07
TIGR01184 230 ntrCD nitrate transport ATP-binding subunits C and 93.05
TIGR03411 242 urea_trans_UrtD urea ABC transporter, ATP-binding 93.05
TIGR00972 247 3a0107s01c2 phosphate ABC transporter, ATP-binding 93.03
COG1117 253 PstB ABC-type phosphate transport system, ATPase c 93.02
cd03245 220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 93.02
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 93.01
COG4988 559 CydD ABC-type transport system involved in cytochr 93.0
PRK13649 280 cbiO cobalt transporter ATP-binding subunit; Provi 93.0
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 92.99
PRK09544 251 znuC high-affinity zinc transporter ATPase; Review 92.99
TIGR02324 224 CP_lyasePhnL phosphonate C-P lyase system protein 92.99
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 92.97
PRK14241 258 phosphate transporter ATP-binding protein; Provisi 92.97
COG0411 250 LivG ABC-type branched-chain amino acid transport 92.97
PRK14235 267 phosphate transporter ATP-binding protein; Provisi 92.97
PRK15112 267 antimicrobial peptide ABC system ATP-binding prote 92.96
TIGR01188 302 drrA daunorubicin resistance ABC transporter ATP-b 92.95
COG3638 258 ABC-type phosphate/phosphonate transport system, A 92.93
PRK14259 269 phosphate ABC transporter ATP-binding protein; Pro 92.92
cd03249 238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 92.91
PRK14269 246 phosphate ABC transporter ATP-binding protein; Pro 92.91
PRK13641 287 cbiO cobalt transporter ATP-binding subunit; Provi 92.9
PRK14274 259 phosphate ABC transporter ATP-binding protein; Pro 92.9
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 92.89
PRK13547 272 hmuV hemin importer ATP-binding subunit; Provision 92.88
PRK13646 286 cbiO cobalt transporter ATP-binding subunit; Provi 92.88
PRK09580 248 sufC cysteine desulfurase ATPase component; Review 92.87
cd03253 236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 92.86
PRK14240 250 phosphate transporter ATP-binding protein; Provisi 92.86
CHL00131 252 ycf16 sulfate ABC transporter protein; Validated 92.85
PRK13648 269 cbiO cobalt transporter ATP-binding subunit; Provi 92.84
PRK13632 271 cbiO cobalt transporter ATP-binding subunit; Provi 92.84
TIGR03771 223 anch_rpt_ABC anchored repeat-type ABC transporter, 92.84
cd03267 236 ABC_NatA_like Similar in sequence to NatA, this is 92.83
TIGR01288 303 nodI ATP-binding ABC transporter family nodulation 92.82
TIGR01277 213 thiQ thiamine ABC transporter, ATP-binding protein 92.82
PRK11231 255 fecE iron-dicitrate transporter ATP-binding subuni 92.81
PRK09493 240 glnQ glutamine ABC transporter ATP-binding protein 92.8
PRK14248 268 phosphate ABC transporter ATP-binding protein; Pro 92.8
PLN02772 398 guanylate kinase 92.79
cd03246173 ABCC_Protease_Secretion This family represents the 92.79
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=2.6e-75  Score=588.55  Aligned_cols=296  Identities=47%  Similarity=0.722  Sum_probs=272.0

Q ss_pred             CCCCCcEEEEccCCCCceEEEEEEecccHHHHHHHhcCCCCCCCCCCceeEEeeeecCCCCceecceEEEeecccccCcc
Q psy1007          24 LAIKNTIFALSSGHGKCGVSVIRVSGPDTLNALKSMACYPDQKVPKPRYASLRNIVDPVSKVVLDEGLCLWFPRHGKCGV  103 (445)
Q Consensus        24 ~~~~dtI~A~at~~g~~ai~viRiSG~~a~~i~~~l~~~~~~~~~~~~~~~~~~~~d~~~g~~iD~~i~~~~~~~~~~gi  103 (445)
                      +...|||+|+|||+|+|||||||+|||+|+.+++++|++  .+.++||+++|+++.|+                      
T Consensus         1 ~~~~dTI~AiaTa~g~~aI~IvRiSGp~a~~ia~~i~~~--~~~~~~r~a~y~~i~d~----------------------   56 (454)
T COG0486           1 MMMFDTIAAIATAPGEGAIGIVRISGPDALEIAQKLFGG--LKLPKPRTAHYGHIKDE----------------------   56 (454)
T ss_pred             CCCCCcEEEEccCCCCceEEEEEecCHhHHHHHHHHhCC--CCCCCCcEEEEEEEEcC----------------------
Confidence            356789999999999999999999999999999999984  35667777777776662                      


Q ss_pred             eEeeccCCChHHHhhhhccCCCCCCCCCeEEEeeeeecCCCCeeecCceeeecCCCCCcCCCceeEEEecCcHHHHHHHH
Q psy1007         104 SVIRVSGPDTLNALKSMACYPDQKVSKPRYASLRNIVDPVSEVVLDEGLCLWFPKPNSFTGEDCCEFQVHGSIAVINAIL  183 (445)
Q Consensus       104 avIrisGp~a~~il~~l~~~~~~~~~~~rra~~~~~~d~~~~~~~d~~~~~~f~~p~syTGEd~~Ei~~hg~~~v~~~i~  183 (445)
                                                              +++.+|+++++||++|+||||||++|||||||++|+++++
T Consensus        57 ----------------------------------------~~~~iDe~lvl~f~aP~SFTGEDvvEi~~HGg~~v~~~iL   96 (454)
T COG0486          57 ----------------------------------------NGEIIDEVLVLYFKAPNSFTGEDVVEIQCHGGPVVVNLIL   96 (454)
T ss_pred             ----------------------------------------CCcEeeeeeEEEEeCCCCcccccEEEEEcCCCHHHHHHHH
Confidence                                                    3678899999999999999999999999999999999999


Q ss_pred             HHHhcCCCcccccCCcccchhhhccccchhhhhhHHHHHHcccHHHHHHHHHhccchHHHHHHHHHHHHHHHHhcccccc
Q psy1007         184 GALTKLPGLRPAEPGEFSKRAFFNNKLDLTQTEALGDLIQAETELQRQKALHQMKGNLKQLYSEWRQLILESLASVEAYI  263 (445)
Q Consensus       184 ~~l~~~~g~r~a~~Gef~~ra~~n~k~dl~~ae~~~~li~A~~~~~~~~al~~~~g~l~~~l~~~~~~l~~~~a~iE~~I  263 (445)
                      +.|++. |+|+|+|||||+|||+||||||+|||++.||+.|+|+.+++.|+.++.|.+++.+..|++.+...++++|+.|
T Consensus        97 ~~~l~~-GaR~AepGEFs~RAFLNgK~DLtqAEai~dLI~A~te~a~r~A~~~l~G~ls~~i~~lr~~li~~~a~vEa~I  175 (454)
T COG0486          97 ELLLKL-GARLAEPGEFSKRAFLNGKLDLTQAEAIADLIDAKTEQAARIALRQLQGALSQLINELREALLELLAQVEANI  175 (454)
T ss_pred             HHHHHc-CCeecCCCcchHHHHhcCCccHHHHHHHHHHHhCCCHHHHHHHHHHcCCcHHHHHHHHHHHHHHHHHHheEeC
Confidence            999999 9999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCcccchhhHHHHHHHHHHHHHHHHHHHHhhhccccccccCCeEEEeeeccccccCCChhHHHHHHHHHHHHHHHHh
Q psy1007         264 DFSEDEIIEDNILNTVRSQVVQLHGSIEKHIELSNKCGVRIRSGIKSVICLASVEAYIDFSEDEIIEDNILNTVRSQVVQ  343 (445)
Q Consensus       264 dfse~e~~~~~~~~~~~~~l~~l~~~L~~~~~~~~~~g~~~~~gi~~vIvl~k~e~~~Dl~~~~~~~~~~l~~~~~~~~~  343 (445)
                      ||++++ ++........+.+..+..+|.+++.                                                
T Consensus       176 Dfpeed-i~~~~~~~i~~~l~~~~~~l~~ll~------------------------------------------------  206 (454)
T COG0486         176 DFPEED-IEELVLEKIREKLEELIAELDELLA------------------------------------------------  206 (454)
T ss_pred             CCCccc-ccchhHHHHHHHHHHHHHHHHHHHH------------------------------------------------
Confidence            999984 6666777777777777777776666                                                


Q ss_pred             hccCcceeeecccccccccccCcEEEEEcCCCCChhHHhhhhccccceeeecCCCccceEEEEEEEECCeeEEEEECCCC
Q psy1007         344 LHGSIEKHIELSNKCGVRIRSGIKSVIVGEPNVGKSSLMNFLCQKQISIVTSIPGTTRDVIEKHLDIGGYPVILLDTAGL  423 (445)
Q Consensus       344 ~~~~~~~~~~~s~~~~~~~~~~~~v~lvG~~~vGKSsLln~l~~~~~~~vs~~~~tt~~~~~~~~~~~g~~v~l~DTpG~  423 (445)
                                 ++.+++.+++|++++++|.||||||||+|+|++++.++|++++|||||+....+.++|.++.++||||+
T Consensus       207 -----------~~~~g~ilr~G~kvvIiG~PNvGKSSLLNaL~~~d~AIVTdI~GTTRDviee~i~i~G~pv~l~DTAGi  275 (454)
T COG0486         207 -----------TAKQGKILREGLKVVIIGRPNVGKSSLLNALLGRDRAIVTDIAGTTRDVIEEDINLNGIPVRLVDTAGI  275 (454)
T ss_pred             -----------hhhhhhhhhcCceEEEECCCCCcHHHHHHHHhcCCceEecCCCCCccceEEEEEEECCEEEEEEecCCc
Confidence                       556778889999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcCCCCcccHHHHHHHHHhhhC
Q psy1007         424 RTTTSDIIETEGNLLEKNNQQR  445 (445)
Q Consensus       424 ~~~~~~~~e~~~i~~~~~~~~~  445 (445)
                      + .+.|.+|++|++++++.+++
T Consensus       276 R-et~d~VE~iGIeRs~~~i~~  296 (454)
T COG0486         276 R-ETDDVVERIGIERAKKAIEE  296 (454)
T ss_pred             c-cCccHHHHHHHHHHHHHHHh
Confidence            9 77899999999999998763



>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>KOG1191|consensus Back     alignment and domain information
>PF10396 TrmE_N: GTP-binding protein TrmE N-terminus; InterPro: IPR018948 This family represents the shorter, B, chain of the homo-dimeric structure which is a guanine nucleotide-binding protein that binds and hydrolyses GTP Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>COG0404 GcvT Glycine cleavage system T protein (aminomethyltransferase) [Amino acid transport and metabolism] Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>PRK12486 dmdA putative dimethyl sulfoniopropionate demethylase; Reviewed Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>PLN02319 aminomethyltransferase Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG2770|consensus Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK13579 gcvT glycine cleavage system aminomethyltransferase T; Provisional Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PF10396 TrmE_N: GTP-binding protein TrmE N-terminus; InterPro: IPR018948 This family represents the shorter, B, chain of the homo-dimeric structure which is a guanine nucleotide-binding protein that binds and hydrolyses GTP Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>TIGR00528 gcvT glycine cleavage system T protein Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PF01571 GCV_T: Aminomethyltransferase folate-binding domain; InterPro: IPR006222 This is a family of glycine cleavage T-proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>KOG1424|consensus Back     alignment and domain information
>PRK00389 gcvT glycine cleavage system aminomethyltransferase T; Reviewed Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>KOG2484|consensus Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>KOG0084|consensus Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>KOG1423|consensus Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>KOG0080|consensus Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>KOG0394|consensus Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>KOG0094|consensus Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0092|consensus Back     alignment and domain information
>KOG2485|consensus Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>KOG0087|consensus Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>KOG1191|consensus Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>KOG0079|consensus Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>KOG0098|consensus Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>KOG0095|consensus Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>KOG0078|consensus Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>KOG2423|consensus Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>KOG0086|consensus Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>PRK09559 putative global regulator; Reviewed Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>KOG0091|consensus Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>KOG0097|consensus Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>KOG0393|consensus Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>KOG1486|consensus Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>TIGR00092 GTP-binding protein YchF Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>KOG1491|consensus Back     alignment and domain information
>KOG1490|consensus Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>KOG0395|consensus Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>KOG2844|consensus Back     alignment and domain information
>KOG1547|consensus Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>KOG1489|consensus Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>KOG0410|consensus Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>KOG0083|consensus Back     alignment and domain information
>KOG0088|consensus Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>KOG0093|consensus Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>KOG0075|consensus Back     alignment and domain information
>KOG0073|consensus Back     alignment and domain information
>KOG2655|consensus Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>KOG4252|consensus Back     alignment and domain information
>KOG0081|consensus Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>TIGR01375 soxG sarcosine oxidase, gamma subunit family, heterotetrameric form Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG1487|consensus Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0070|consensus Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>KOG1673|consensus Back     alignment and domain information
>KOG3883|consensus Back     alignment and domain information
>KOG0074|consensus Back     alignment and domain information
>KOG0096|consensus Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>KOG3859|consensus Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>KOG2486|consensus Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>KOG0071|consensus Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>KOG2929|consensus Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>KOG0090|consensus Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>KOG0077|consensus Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>KOG3886|consensus Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0076|consensus Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query445
1xzp_A 482 Structure Of The Gtp-Binding Protein Trme From Ther 4e-33
3gee_A 476 Crystal Structure Of Mnme From Chlorobium Tepidum I 8e-27
3geh_A462 Crystal Structure Of Mnme From Nostoc In Complex Wi 5e-25
3geh_A 462 Crystal Structure Of Mnme From Nostoc In Complex Wi 2e-20
1rfl_A172 Nmr Data Driven Structural Model Of G-Domain Of Mnm 4e-15
2gj9_A172 Structure Of The Mnme G-Domain In Complex With GdpA 3e-14
2gj8_A172 Structure Of The Mnme G-domain In Complex With Gdp* 8e-14
1mky_A 439 Structural Analysis Of The Domain Interactions In D 1e-11
1xzp_B150 Structure Of The Gtp-Binding Protein Trme From Ther 1e-08
1xzq_B149 Structure Of The Gtp-binding Protein Trme From Ther 3e-08
2dyk_A161 Crystal Structure Of N-Terminal Gtp-Binding Domain 4e-08
4dcs_A 456 Crystal Structure Of B. Subtilis Enga In Complex Wi 5e-07
2hjg_A 436 The Crystal Structure Of The B. Subtilis Yphc Gtpas 1e-06
3qq5_A 423 Crystal Structure Of The [fefe]-Hydrogenase Maturat 2e-05
1x18_X 292 Contact Sites Of Era Gtpase On The Thermus Thermoph 5e-05
1ega_A 301 Crystal Structure Of A Widely Conserved Gtpase Era 5e-05
1wf3_A 301 Crystal Structure Of Gtp-Binding Protein Tt1341 Fro 2e-04
3r9w_A 307 Crystal Structure Of Era In Complex With Mggdpnp An 4e-04
3iev_A 308 Crystal Structure Of Era In Complex With Mggnp And 4e-04
>pdb|1XZP|A Chain A, Structure Of The Gtp-Binding Protein Trme From Thermotoga Maritima Length = 482 Back     alignment and structure

Iteration: 1

Score = 139 bits (350), Expect = 4e-33, Method: Compositional matrix adjust. Identities = 108/341 (31%), Positives = 161/341 (47%), Gaps = 75/341 (21%) Query: 99 GKCGVSVIRVSGPDTLNALKSMACYPDQKVSKPRYASLRNIVDPVSE--VVLDEGLCLWF 156 GK ++++R+SGPD+ ++ + V PR A I + E +DE + +++ Sbjct: 44 GKGAIAILRLSGPDSWKIVQKHLRTRSKIV--PRKA----IHGWIHENGEDVDEVVVVFY 97 Query: 157 PKPNSFTGEDCCEFQVHGSIAVINAILGALTKLPGLRPAEPGEFSKRAFFNNKLDLTQTE 216 P S+TGED E HG V+ +L K G R AEPGEF+KRAF N K+DLT E Sbjct: 98 KSPKSYTGEDMVEVMCHGGPLVVKKLLDLFLK-SGARMAEPGEFTKRAFLNGKMDLTSAE 156 Query: 217 ALGDLIQAETELQRQKALHQMKGNLKQLYSEWRQLILESLASVEAYIDFSEDEIIEDNIL 276 A+ DLI+A++E + +L +KG L+ ++D E+IE Sbjct: 157 AVRDLIEAKSETSLKLSLRNLKGGLRD------------------FVDSLRRELIE---- 194 Query: 277 NTVRSQVVQLHGSIEKHIELSNKCGVRIRSGIKSVICLASVEAYIDFSEDEIIEDNILNT 336 LA + +D+ D I Sbjct: 195 ------------------------------------VLAEIRVELDYP------DEIETN 212 Query: 337 VRSQVVQLHGSIEKHIELSNKC--GVRIRSGIKSVIVGEPNVGKSSLMNFLCQKQISIVT 394 V +L EK E K G+ + G++ VIVG+PNVGKS+L+N L + +IVT Sbjct: 213 TGEVVTRLERIKEKLTEELKKADAGILLNRGLRMVIVGKPNVGKSTLLNRLLNEDRAIVT 272 Query: 395 SIPGTTRDVIEKHLDIGGYPVILLDTAGLRTTTSDIIETEG 435 IPGTTRDVI + + I G ++DTAG+R+ T+D++E G Sbjct: 273 DIPGTTRDVISEEIVIRGILFRIVDTAGVRSETNDLVERLG 313
>pdb|3GEE|A Chain A, Crystal Structure Of Mnme From Chlorobium Tepidum In Complex With Gdp And Folinic Acid Length = 476 Back     alignment and structure
>pdb|3GEH|A Chain A, Crystal Structure Of Mnme From Nostoc In Complex With Gdp, Folinic Acid And Zn Length = 462 Back     alignment and structure
>pdb|3GEH|A Chain A, Crystal Structure Of Mnme From Nostoc In Complex With Gdp, Folinic Acid And Zn Length = 462 Back     alignment and structure
>pdb|1RFL|A Chain A, Nmr Data Driven Structural Model Of G-Domain Of Mnme Protein Length = 172 Back     alignment and structure
>pdb|2GJ9|A Chain A, Structure Of The Mnme G-Domain In Complex With GdpAlf4-, Mg2+ And Rb+ Length = 172 Back     alignment and structure
>pdb|2GJ8|A Chain A, Structure Of The Mnme G-domain In Complex With Gdp*alf4-, Mg2+ And K+ Length = 172 Back     alignment and structure
>pdb|1MKY|A Chain A, Structural Analysis Of The Domain Interactions In Der, A Switch Protein Containing Two Gtpase Domains Length = 439 Back     alignment and structure
>pdb|1XZP|B Chain B, Structure Of The Gtp-Binding Protein Trme From Thermotoga Maritima Length = 150 Back     alignment and structure
>pdb|1XZQ|B Chain B, Structure Of The Gtp-binding Protein Trme From Thermotoga Maritima Complexed With 5-formyl-thf Length = 149 Back     alignment and structure
>pdb|2DYK|A Chain A, Crystal Structure Of N-Terminal Gtp-Binding Domain Of Enga From Thermus Thermophilus Hb8 Length = 161 Back     alignment and structure
>pdb|4DCS|A Chain A, Crystal Structure Of B. Subtilis Enga In Complex With Sulfate Ion And Gdp Length = 456 Back     alignment and structure
>pdb|2HJG|A Chain A, The Crystal Structure Of The B. Subtilis Yphc Gtpase In Complex With Gdp Length = 436 Back     alignment and structure
>pdb|3QQ5|A Chain A, Crystal Structure Of The [fefe]-Hydrogenase Maturation Protein Hydf Length = 423 Back     alignment and structure
>pdb|1X18|X Chain X, Contact Sites Of Era Gtpase On The Thermus Thermophilus 30s Subunit Length = 292 Back     alignment and structure
>pdb|1EGA|A Chain A, Crystal Structure Of A Widely Conserved Gtpase Era Length = 301 Back     alignment and structure
>pdb|1WF3|A Chain A, Crystal Structure Of Gtp-Binding Protein Tt1341 From Thermus Thermophilus Hb8 Length = 301 Back     alignment and structure
>pdb|3R9W|A Chain A, Crystal Structure Of Era In Complex With Mggdpnp And Nucleotides 1506- 1542 Of 16s Ribosomal Rna Length = 307 Back     alignment and structure
>pdb|3IEV|A Chain A, Crystal Structure Of Era In Complex With Mggnp And The 3' End Of 16s Rrna Length = 308 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query445
3geh_A 462 MNME, tRNA modification GTPase MNME; G protein, U3 1e-100
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 2e-10
3gee_A 476 MNME, tRNA modification GTPase MNME; G protein, cy 6e-99
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 9e-09
1xzp_A 482 Probable tRNA modification GTPase TRME; GTP-bindin 3e-96
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 1e-08
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 8e-33
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 4e-17
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 3e-13
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 4e-17
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 5e-17
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 2e-14
3def_A 262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 6e-16
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 7e-16
1h65_A 270 Chloroplast outer envelope protein OEP34; GTPase, 9e-15
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 2e-10
1wf3_A 301 GTP-binding protein; GTPase, riken structural geno 5e-10
2cxx_A 190 Probable GTP-binding protein ENGB; structural geno 9e-10
3iev_A 308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 1e-09
3h2y_A 368 GTPase family protein; GTP-binding protein YQEH, p 2e-08
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 3e-08
3cnl_A262 YLQF, putative uncharacterized protein; circular p 5e-08
3ec1_A 369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 1e-07
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 5e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
3lxw_A 247 GTPase IMAP family member 1; immunity, structural 9e-06
3lxx_A 239 GTPase IMAP family member 4; structural genomics c 2e-05
2xtp_A 260 GTPase IMAP family member 2; immune system, G prot 9e-05
2qtf_A 364 Protein HFLX, GTP-binding protein; beta-alpha-barr 2e-04
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 6e-04
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Length = 462 Back     alignment and structure
 Score =  305 bits (784), Expect = e-100
 Identities = 109/337 (32%), Positives = 160/337 (47%), Gaps = 63/337 (18%)

Query: 99  GKCGVSVIRVSGPDTLNALKSMACYPDQKVSKPRYASLRNIVDPVSEVVLDEGLCLWFPK 158
            +  V ++RVSG   +   +++   P ++V +        I  P +  ++DE L L    
Sbjct: 20  QQGSVGIVRVSGSQAIAIAQTLFDAPGKQVWESHRILYGYIRHPQTRQIVDEALLLLMKA 79

Query: 159 PNSFTGEDCCEFQVHGSIAVINAILGALTKLPGLRPAEPGEFSKRAFFNNKLDLTQTEAL 218
           P S+T ED  EF  HG I  +  +L    +  G R A+PGEF+ RAF N +LDLTQ E++
Sbjct: 80  PRSYTREDVVEFHCHGGIIAVQQVLQLCLES-GARLAQPGEFTLRAFLNGRLDLTQAESI 138

Query: 219 GDLIQAETELQRQKALHQMKGNLKQLYSEWRQLILESLASVEAYIDFSEDEIIEDNILNT 278
            DL+ A +    Q AL  ++G L     + R   L+ LA +EA IDF ED          
Sbjct: 139 ADLVGARSPQAAQTALAGLQGKLAHPIRQLRANCLDILAEIEARIDFEED---------- 188

Query: 279 VRSQVVQLHGSIEKHIELSNKCGVRIRSGIKSVICLASVEAYIDFSEDEIIEDNILNTVR 338
                                                     +   +DE I  + +  + 
Sbjct: 189 ------------------------------------------LPPLDDEAIISD-IENIA 205

Query: 339 SQVVQLHGSIEKHIELSNKCGVRIRSGIKSVIVGEPNVGKSSLMNFLCQKQISIVTSIPG 398
           +++ QL  + +K        G  +R+G+K  IVG PNVGKSSL+N   Q   +IVT +PG
Sbjct: 206 AEISQLLATKDK--------GELLRTGLKVAIVGRPNVGKSSLLNAWSQSDRAIVTDLPG 257

Query: 399 TTRDVIEKHLDIGGYPVILLDTAGLRTTTSDIIETEG 435
           TTRDV+E  L +GG PV +LDTAG+R T+ D +E  G
Sbjct: 258 TTRDVVESQLVVGGIPVQVLDTAGIRETS-DQVEKIG 293


>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Length = 462 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Length = 476 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Length = 476 Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Length = 482 Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Length = 482 Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Length = 172 Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Length = 436 Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Length = 436 Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Length = 423 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Length = 439 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Length = 439 Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Length = 262 Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Length = 161 Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Length = 270 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Length = 301 Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Length = 301 Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Length = 190 Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Length = 308 Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Length = 368 Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Length = 282 Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Length = 262 Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Length = 369 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Length = 413 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Length = 239 Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Length = 260 Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Length = 364 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} Length = 169 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query445
3gee_A 476 MNME, tRNA modification GTPase MNME; G protein, cy 100.0
3geh_A 462 MNME, tRNA modification GTPase MNME; G protein, U3 100.0
1xzp_A 482 Probable tRNA modification GTPase TRME; GTP-bindin 100.0
3gee_A 476 MNME, tRNA modification GTPase MNME; G protein, cy 99.54
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 99.52
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 99.48
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 99.39
3gir_A393 Aminomethyltransferase; glycine cleavage system, a 99.38
1vlo_A381 Aminomethyltransferase; NP417381, tetrahydrofolat 99.32
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 99.31
3h2y_A 368 GTPase family protein; GTP-binding protein YQEH, p 99.29
3tfi_A369 GCVT-like aminomethyltransferase protein; demethyl 99.28
1wos_A364 Aminomethyltransferase; T-protein; 1.84A {Thermoto 99.27
3ec1_A 369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 99.26
1wsr_A375 Aminomethyltransferase; glycine-cleavage sytem; 2. 99.22
3cnl_A262 YLQF, putative uncharacterized protein; circular p 99.22
3ttg_A355 Putative aminomethyltransferase; structural genomi 99.21
1yx2_A365 Aminomethyltransferase; glycine cleavage system T 99.21
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 99.2
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.18
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.16
2qtf_A 364 Protein HFLX, GTP-binding protein; beta-alpha-barr 99.16
2gag_A965 Heterotetrameric sarcosine oxidase alpha-subunit; 99.08
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.06
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.05
1v5v_A401 Aminomethyltransferase; glycine-cleavage sytem, st 99.04
1pj5_A830 N,N-dimethylglycine oxidase; channelling, FAD bind 99.01
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 98.99
1wf3_A 301 GTP-binding protein; GTPase, riken structural geno 98.98
2wji_A165 Ferrous iron transport protein B homolog; membrane 98.93
1xzp_A 482 Probable tRNA modification GTPase TRME; GTP-bindin 98.92
2wjg_A 188 FEOB, ferrous iron transport protein B homolog; me 98.88
1vly_A338 SPOT PR51, unknown protein from 2D-PAGE; structura 98.87
3i8s_A 274 Ferrous iron transport protein B; GTPase, GPCR, ir 98.87
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 98.87
3iby_A 256 Ferrous iron transport protein B; G protein, G dom 98.86
3a1s_A 258 Iron(II) transport protein B; FEOB, iron transport 98.85
3lxw_A 247 GTPase IMAP family member 1; immunity, structural 98.85
3k53_A 271 Ferrous iron transport protein B; GTPase fold, hel 98.85
3def_A 262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 98.84
4a9a_A 376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 98.83
3iev_A 308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 98.83
3lxx_A 239 GTPase IMAP family member 4; structural genomics c 98.8
1h65_A 270 Chloroplast outer envelope protein OEP34; GTPase, 98.79
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 98.79
2xtp_A 260 GTPase IMAP family member 2; immune system, G prot 98.75
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 98.75
4dhe_A 223 Probable GTP-binding protein ENGB; melioidosis, RA 98.75
3b1v_A 272 Ferrous iron uptake transporter protein B; G prote 98.74
2qu8_A 228 Putative nucleolar GTP-binding protein 1; GTPase, 98.74
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 98.74
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 98.73
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 98.69
3cph_A 213 RAS-related protein SEC4; RAB GTPase, prenylation, 98.67
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 98.67
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 98.66
4dkx_A 216 RAS-related protein RAB-6A; GTP binding fold, memb 98.66
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 98.65
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 98.63
3t5d_A 274 Septin-7; GTP-binding protein, cytoskeleton, signa 98.62
4dsu_A 189 GTPase KRAS, isoform 2B; small G-protein, signalin 98.62
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 98.61
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 98.61
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 98.6
2bov_A 206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 98.6
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 98.6
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 98.6
3clv_A 208 RAB5 protein, putative; malaria, GTPase, structura 98.59
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 98.59
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 98.59
1jal_A 363 YCHF protein; nucleotide-binding fold, structural 98.59
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 98.58
2q3h_A 201 RAS homolog gene family, member U; GTPase, structu 98.58
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 98.58
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 98.58
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 98.57
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 98.57
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 98.57
3r7w_A 307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 98.57
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 98.57
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 98.57
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 98.56
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 98.56
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 98.56
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 98.55
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 98.55
2bcg_Y 206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 98.54
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 98.54
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 98.54
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 98.54
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 98.54
2e87_A 357 Hypothetical protein PH1320; GTP-binding, GTPase, 98.54
2gag_C210 Heterotetrameric sarcosine oxidase gamma-subunit; 98.54
2cjw_A 192 GTP-binding protein GEM; nucleotide-binding, small 98.54
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 98.53
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 98.53
1mh1_A 186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 98.53
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 98.52
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 98.52
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 98.51
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 98.51
1vg8_A 207 RAS-related protein RAB-7; GTP-binding protein, pr 98.51
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 98.51
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 98.51
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 98.5
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 98.5
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 98.5
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 98.5
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 98.5
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 98.5
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 98.5
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 98.5
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 98.5
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 98.5
3cpj_B 223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 98.49
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 98.49
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 98.49
1wxq_A 397 GTP-binding protein; structural genomics, riken st 98.49
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 98.49
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 98.48
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 98.48
4bas_A 199 ADP-ribosylation factor, putative (small GTPase, p 98.48
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 98.48
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 98.48
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 98.47
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 98.47
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 98.47
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 98.47
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 98.47
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 98.47
2aka_B 299 Dynamin-1; fusion protein, GTPase domain, myosin, 98.47
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 98.47
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 98.47
2f9l_A 199 RAB11B, member RAS oncogene family; RAB11B GTPase, 98.46
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 98.46
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 98.46
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 98.46
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 98.46
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 98.45
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 98.45
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 98.45
1zbd_A 203 Rabphilin-3A; G protein, effector, RABCDR, synapti 98.45
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 98.44
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 98.44
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 98.44
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 98.44
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 98.43
2fv8_A 207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 98.43
2j0v_A 212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 98.42
2fh5_B 214 SR-beta, signal recognition particle receptor beta 98.41
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 98.41
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 98.41
2cxx_A 190 Probable GTP-binding protein ENGB; structural geno 98.41
1pui_A 210 ENGB, probable GTP-binding protein ENGB; structura 98.38
2gf0_A 199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 98.37
3q3j_B 214 RHO-related GTP-binding protein RHO6; RAS-binding 98.37
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 98.36
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 98.34
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 98.34
1x31_C206 Sarcosine oxidase gamma subunit; heterotetrameric 98.33
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 98.33
2yc2_C 208 IFT27, small RAB-related GTPase; transport protein 98.32
4djt_A 218 GTP-binding nuclear protein GSP1; structural genom 98.31
2ged_A193 SR-beta, signal recognition particle receptor beta 98.31
3gj0_A 221 GTP-binding nuclear protein RAN; G protein, GDP, a 98.31
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 97.61
1lnz_A 342 SPO0B-associated GTP-binding protein; GTPase, OBG, 98.28
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 98.27
3o47_A329 ADP-ribosylation factor GTPase-activating protein 98.27
2f7s_A 217 C25KG, RAS-related protein RAB-27B; G-protein, str 98.27
3llu_A196 RAS-related GTP-binding protein C; structural geno 98.21
1jwy_B 315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 98.2
2dby_A 368 GTP-binding protein; GDP, structural genomics, NPP 98.2
1f5n_A 592 Interferon-induced guanylate-binding protein 1; GB 98.19
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 98.19
2x2e_A 353 Dynamin-1; nitration, hydrolase, membrane fission, 98.18
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 98.16
3j2k_7 439 ERF3, eukaryotic polypeptide chain release factor 98.13
1nrj_B 218 SR-beta, signal recognition particle receptor beta 98.11
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 98.06
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 98.03
3t1o_A 198 Gliding protein MGLA; G domain containing protein, 98.01
1udx_A 416 The GTP-binding protein OBG; TGS domain, riken str 97.98
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 97.96
3mca_A 592 HBS1, elongation factor 1 alpha-like protein; prot 97.95
2qag_A 361 Septin-2, protein NEDD5; cell cycle, cell division 97.93
3r7w_B 331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 97.93
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 97.9
3t34_A 360 Dynamin-related protein 1A, linker, dynamin-relat 97.89
2elf_A 370 Protein translation elongation factor 1A; tRNA, py 97.88
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 97.83
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 97.82
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 97.81
1zun_B 434 Sulfate adenylate transferase, subunit 1/adenylyls 97.8
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 97.79
2c78_A 405 Elongation factor TU-A; hydrolase, GTPase, transla 97.79
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 97.77
1jny_A 435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 97.71
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 97.71
1wb1_A 482 Translation elongation factor SELB; selenocysteine 97.69
1d2e_A 397 Elongation factor TU (EF-TU); G-protein, beta-barr 97.65
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 97.57
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 97.54
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 97.54
2qnr_A 301 Septin-2, protein NEDD5; structural genomics conso 97.54
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 97.51
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 97.43
3q5d_A 447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 97.37
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 97.36
1kk1_A 410 EIF2gamma; initiation of translation; HET: GNP; 1. 97.33
3sjy_A 403 Translation initiation factor 2 subunit gamma; zin 97.32
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 97.28
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 97.26
1s0u_A 408 EIF-2-gamma, translation initiation factor 2 gamma 97.2
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 97.2
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 97.16
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 97.16
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 97.13
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 97.11
3c5h_A 255 Glucocorticoid receptor DNA-binding factor 1; RAS, 97.09
3p32_A 355 Probable GTPase RV1496/MT1543; structural genomics 97.08
3sop_A 270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 97.05
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 97.03
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 97.02
2wsm_A 221 Hydrogenase expression/formation protein (HYPB); m 96.87
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 96.69
3e70_C 328 DPA, signal recognition particle receptor; FTSY, S 96.68
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 96.61
2hf9_A 226 Probable hydrogenase nickel incorporation protein 96.47
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 96.32
1yrb_A 262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 96.21
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 95.96
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 95.75
1lvg_A 198 Guanylate kinase, GMP kinase; transferase; HET: AD 95.59
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 95.55
1znw_A 207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 95.31
1z6g_A 218 Guanylate kinase; structural genomics, SGC, struct 95.19
1zp6_A 191 Hypothetical protein ATU3015; alpha-beta protein., 95.09
3tr0_A 205 Guanylate kinase, GMP kinase; purines, pyrimidines 95.0
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 94.95
1s96_A 219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 94.93
3tif_A 235 Uncharacterized ABC transporter ATP-binding prote; 94.91
3tau_A 208 Guanylate kinase, GMP kinase; structural genomics, 94.89
2pcj_A 224 ABC transporter, lipoprotein-releasing system ATP- 94.84
1ex7_A 186 Guanylate kinase; substrate-induced FIT, domain mo 94.8
3c8u_A 208 Fructokinase; YP_612366.1, putative fructose trans 94.73
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 94.7
2cbz_A 237 Multidrug resistance-associated protein 1; ABC pro 94.69
3a00_A 186 Guanylate kinase, GMP kinase; domain movement, dim 94.62
1b0u_A 262 Histidine permease; ABC transporter, transport pro 94.6
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 94.6
1g6h_A 257 High-affinity branched-chain amino acid transport 94.58
2ff7_A 247 Alpha-hemolysin translocation ATP-binding protein 94.57
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 94.55
2pze_A 229 Cystic fibrosis transmembrane conductance regulat; 94.54
1mv5_A 243 LMRA, multidrug resistance ABC transporter ATP-bin 94.53
1sgw_A214 Putative ABC transporter; structural genomics, P p 94.52
4g1u_C 266 Hemin import ATP-binding protein HMUV; membrane tr 94.48
2j41_A 207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 94.45
1ji0_A 240 ABC transporter; ATP binding protein, structural g 94.44
2olj_A 263 Amino acid ABC transporter; ABC domain, ATPase, hy 94.42
2ghi_A 260 Transport protein; multidrug resistance protein, M 94.4
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 94.39
2qi9_C 249 Vitamin B12 import ATP-binding protein BTUD; inner 94.36
3b9q_A 302 Chloroplast SRP receptor homolog, alpha subunit CP 94.34
1vpl_A 256 ABC transporter, ATP-binding protein; TM0544, stru 94.34
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 94.33
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 94.3
2d2e_A 250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 94.27
2zu0_C 267 Probable ATP-dependent transporter SUFC; iron-sulf 94.22
3lnc_A 231 Guanylate kinase, GMP kinase; ALS collaborative cr 94.18
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 94.15
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 94.13
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 94.12
2nq2_C 253 Hypothetical ABC transporter ATP-binding protein H 94.11
2yhs_A 503 FTSY, cell division protein FTSY; cell cycle, prot 94.05
3asz_A 211 Uridine kinase; cytidine phosphorylation, transfer 94.03
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 93.89
2qor_A 204 Guanylate kinase; phosphotransferase, purine metab 93.86
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 93.86
4ido_A 457 Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HE 93.84
3b85_A 208 Phosphate starvation-inducible protein; PHOH2, ATP 93.8
2eyu_A 261 Twitching motility protein PILT; pilus retraction 93.75
2og2_A 359 Putative signal recognition particle receptor; nuc 93.73
2bbs_A 290 Cystic fibrosis transmembrane conductance regulato 93.73
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 93.59
4a74_A 231 DNA repair and recombination protein RADA; hydrola 93.58
2onk_A 240 Molybdate/tungstate ABC transporter, ATP-binding p 93.54
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 93.45
2ehv_A 251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 93.41
1kag_A173 SKI, shikimate kinase I; transferase, structural g 93.38
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 93.3
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 93.29
3aez_A 312 Pantothenate kinase; transferase, homodimer, COA b 93.25
2bdt_A 189 BH3686; alpha-beta protein, structural genomics, P 93.22
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 93.2
2i3b_A 189 HCR-ntpase, human cancer-related ntpase; AAA, ross 93.19
2jeo_A 245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 93.13
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 93.12
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 93.09
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 93.08
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 93.06
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 93.01
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 92.99
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 92.9
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 92.78
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 92.78
2bbw_A 246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 92.78
2gza_A 361 Type IV secretion system protein VIRB11; ATPase, h 92.71
3vaa_A199 Shikimate kinase, SK; structural genomics, center 92.48
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 92.44
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 92.43
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 92.37
2qt1_A 207 Nicotinamide riboside kinase 1; non-protein kinase 92.29
2vp4_A 230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 92.26
1ko7_A314 HPR kinase/phosphatase; protein kinase, phosphotra 92.26
1rj9_A 304 FTSY, signal recognition protein; SRP-GTPase domai 92.14
2kjq_A149 DNAA-related protein; solution structure, NESG, st 92.13
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 92.04
1kht_A 192 Adenylate kinase; phosphotransferase, signaling pr 92.02
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 91.96
1cke_A 227 CK, MSSA, protein (cytidine monophosphate kinase); 91.93
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 91.88
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 91.75
2w0m_A 235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 91.66
3cm0_A 186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 91.65
1lw7_A 365 Transcriptional regulator NADR; NMN, NMN adenylyl 91.64
1sq5_A 308 Pantothenate kinase; P-loop, transferase; HET: PAU 91.6
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 91.57
2rhm_A 193 Putative kinase; P-loop containing nucleoside trip 91.57
2ewv_A 372 Twitching motility protein PILT; pilus retraction 91.5
4e22_A 252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 91.46
2v54_A 204 DTMP kinase, thymidylate kinase; nucleotide biosyn 91.28
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 91.27
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 91.18
2yl4_A 595 ATP-binding cassette SUB-family B member 10, mitoc 91.16
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 91.16
3b60_A 582 Lipid A export ATP-binding/permease protein MSBA; 91.16
3t61_A 202 Gluconokinase; PSI-biology, structural genomics, p 91.13
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 91.13
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 91.12
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 91.09
4a82_A 578 Cystic fibrosis transmembrane conductance regulat; 91.05
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 91.02
2if2_A 204 Dephospho-COA kinase; alpha-beta protein, structur 91.0
2plr_A 213 DTMP kinase, probable thymidylate kinase; TMP-bind 90.96
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 90.9
1jjv_A 206 Dephospho-COA kinase; P-loop nucleotide-binding fo 90.89
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 90.88
3qf4_B 598 Uncharacterized ABC transporter ATP-binding prote 90.78
3b5x_A 582 Lipid A export ATP-binding/permease protein MSBA; 90.76
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 90.75
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 90.68
2cvh_A 220 DNA repair and recombination protein RADB; filamen 90.62
1aky_A 220 Adenylate kinase; ATP:AMP phosphotransferase, myok 90.55
3qf4_A 587 ABC transporter, ATP-binding protein; multidrug tr 90.55
2wwf_A 212 Thymidilate kinase, putative; transferase, malaria 90.51
2jaq_A 205 Deoxyguanosine kinase; transferase, deoxyribonucle 90.47
1nn5_A 215 Similar to deoxythymidylate kinase (thymidylate K; 90.45
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 90.44
3kta_A182 Chromosome segregation protein SMC; structural mai 90.4
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 90.37
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 90.34
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 90.33
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 90.32
1n0w_A 243 DNA repair protein RAD51 homolog 1; DNA repair, ho 90.29
1nks_A 194 Adenylate kinase; thermophilic, transferase; HET: 90.24
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 90.18
2p5t_B 253 PEZT; postsegregational killing system, phosphoryl 90.17
2c95_A 196 Adenylate kinase 1; transferase, AP4A, nucleotide 90.04
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 90.03
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 89.91
1tev_A 196 UMP-CMP kinase; ploop, NMP binding region, LID reg 89.86
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 89.86
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 89.86
3fb4_A 216 Adenylate kinase; psychrophIle, phosphotransferase 89.76
3tqc_A 321 Pantothenate kinase; biosynthesis of cofactors, pr 89.65
2cdn_A 201 Adenylate kinase; phosphoryl transfer, associative 89.58
1zd8_A 227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 89.52
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 89.5
1p9r_A 418 General secretion pathway protein E; bacterial typ 89.47
3dl0_A 216 Adenylate kinase; phosphotransferase, zinc coordin 89.46
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 89.43
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 89.16
1zak_A 222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 89.11
4eaq_A 229 DTMP kinase, thymidylate kinase; structural genomi 89.06
2vli_A183 Antibiotic resistance protein; transferase, tunica 88.96
3nwj_A 250 ATSK2; P loop, shikimate, nucleoside monophosphate 88.89
1m7g_A 211 Adenylylsulfate kinase; APS kinase, transferase, s 88.86
3tlx_A 243 Adenylate kinase 2; structural genomics, structura 88.84
1nij_A 318 Hypothetical protein YJIA; structural genomics, P- 88.74
3qf7_A 365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 88.69
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 88.66
2bwj_A 199 Adenylate kinase 5; phosphoryl transfer reaction, 88.6
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 88.54
3be4_A 217 Adenylate kinase; malaria, cryptosporidium parvum 88.52
1p5z_B 263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 88.51
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 88.5
1vht_A 218 Dephospho-COA kinase; structural genomics, transfe 88.25
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 88.17
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 88.1
1via_A175 Shikimate kinase; structural genomics, transferase 88.07
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 87.88
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 87.84
1e4v_A 214 Adenylate kinase; transferase(phosphotransferase); 87.81
1svm_A 377 Large T antigen; AAA+ fold, viral protein; HET: AT 87.77
2z0h_A 197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 87.71
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 87.64
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 87.61
1gtv_A 214 TMK, thymidylate kinase; transferase, transferase 87.55
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 87.52
1ukz_A 203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 87.5
2px0_A 296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 87.36
1uf9_A 203 TT1252 protein; P-loop, nucleotide binding domain, 87.33
3a4m_A 260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 87.31
2pbr_A 195 DTMP kinase, thymidylate kinase; transferase, nucl 87.3
3bos_A 242 Putative DNA replication factor; P-loop containing 87.25
3cr8_A 552 Sulfate adenylyltranferase, adenylylsulfate kinase 87.09
1q3t_A 236 Cytidylate kinase; nucleotide monophosphate kinase 87.01
1qf9_A 194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 86.99
2ze6_A 253 Isopentenyl transferase; crown GALL tumor, cytokin 86.95
3umf_A 217 Adenylate kinase; rossmann fold, transferase; 2.05 86.94
1ak2_A 233 Adenylate kinase isoenzyme-2; nucleoside monophosp 86.9
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 86.77
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 86.7
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 86.67
2xb4_A 223 Adenylate kinase; ATP-binding, nucleotide-binding, 86.54
2dr3_A 247 UPF0273 protein PH0284; RECA superfamily ATPase, h 86.51
1xjc_A169 MOBB protein homolog; structural genomics, midwest 86.4
2iyv_A 184 Shikimate kinase, SK; transferase, aromatic amino 86.34
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 86.28
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 86.22
1uj2_A 252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 86.18
4aby_A 415 DNA repair protein RECN; hydrolase, double strand 86.15
3r20_A 233 Cytidylate kinase; structural genomics, seattle st 86.1
3sr0_A 206 Adenylate kinase; phosphoryl transfer analogue, AL 86.04
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 85.92
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 85.72
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 85.72
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 85.58
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 85.48
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 85.08
1vma_A 306 Cell division protein FTSY; TM0570, structural gen 84.83
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 84.69
1pzn_A 349 RAD51, DNA repair and recombination protein RAD51, 84.65
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 84.51
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 84.47
2chg_A 226 Replication factor C small subunit; DNA-binding pr 84.32
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 84.29
1njg_A 250 DNA polymerase III subunit gamma; rossman-like fol 84.22
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 84.09
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 83.86
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 83.73
3co5_A143 Putative two-component system transcriptional RES 83.6
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 83.6
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 83.23
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 83.07
2f6r_A 281 COA synthase, bifunctional coenzyme A synthase; 18 82.84
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 82.72
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 82.6
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 82.56
3v9p_A 227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 82.54
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 82.43
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 82.34
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 82.25
3lda_A 400 DNA repair protein RAD51; DNA binding protein, ATP 82.22
1e69_A 322 Chromosome segregation SMC protein; structural mai 82.18
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 82.12
2ocp_A 241 DGK, deoxyguanosine kinase; protein-nucleotide com 81.98
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 81.93
1zcb_A 362 G alpha I/13; GTP-binding, lipoprotein, membrane, 81.72
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 81.59
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 81.52
4edh_A 213 DTMP kinase, thymidylate kinase; structural genomi 81.42
3exa_A 322 TRNA delta(2)-isopentenylpyrophosphate transferase 81.27
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 81.19
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 81.05
3ake_A 208 Cytidylate kinase; CMP kinase, CMP complex, open c 80.9
1a7j_A 290 Phosphoribulokinase; transferase, calvin cycle; 2. 80.82
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 80.53
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 80.26
2qgz_A308 Helicase loader, putative primosome component; str 80.21
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 80.06
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 80.04
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
Probab=100.00  E-value=1.2e-66  Score=545.46  Aligned_cols=301  Identities=34%  Similarity=0.507  Sum_probs=219.4

Q ss_pred             ecCCCCCCC-CCcEEEEccCCCCceEEEEEEecccHHHHHHHhcCCC--CC--CCCCCceeEEeeeecCCCCceecceEE
Q psy1007          18 SRRCSHLAI-KNTIFALSSGHGKCGVSVIRVSGPDTLNALKSMACYP--DQ--KVPKPRYASLRNIVDPVSKVVLDEGLC   92 (445)
Q Consensus        18 ~~~~~~~~~-~dtI~A~at~~g~~ai~viRiSG~~a~~i~~~l~~~~--~~--~~~~~~~~~~~~~~d~~~g~~iD~~i~   92 (445)
                      |+.++|+.. +|||+|+|||+|+|||||||||||+|.++++++|+..  ..  ..+                        
T Consensus         5 ~~~~~~~~~~~dtI~Aiat~~g~~~i~iiRiSG~~a~~i~~~~~~~~~~~~~~~~~------------------------   60 (476)
T 3gee_A            5 SPSDLHLPVPGHPIAAIATPVGVGALAIVRISGAGVLDLADRVFRKVHGSGKLAEA------------------------   60 (476)
T ss_dssp             -------CCCCCCEEEECSCSSCCSEEEEEEESTTHHHHHHHHEEESSSCCCGGGC------------------------
T ss_pred             CcccccCCCCCCCEEEeCCCCcCcEEEEEEeechhHHHHHHHHhCcccccccccCC------------------------
Confidence            445555553 6999999999999999999999999999999999721  00  112                        


Q ss_pred             EeecccccCcceEeeccCCChHHHhhhhccCCCCCCCCCeEEEeeeeecCCCCeeecCceeeecCCCCCcCCCceeEEEe
Q psy1007          93 LWFPRHGKCGVSVIRVSGPDTLNALKSMACYPDQKVSKPRYASLRNIVDPVSEVVLDEGLCLWFPKPNSFTGEDCCEFQV  172 (445)
Q Consensus        93 ~~~~~~~~~giavIrisGp~a~~il~~l~~~~~~~~~~~rra~~~~~~d~~~~~~~d~~~~~~f~~p~syTGEd~~Ei~~  172 (445)
                                                           .||+++++.++|.  +++||+++++||++|+||||||++||||
T Consensus        61 -------------------------------------~~~~~~~~~~~~~--~~~iD~~l~~~f~~P~s~TgEd~~E~~~  101 (476)
T 3gee_A           61 -------------------------------------AGYTAHFGRLYDG--EEMVDEVIALVFRAPRSFTAEQMVEFTC  101 (476)
T ss_dssp             -------------------------------------CTTEEEEEEEESS--SCEEEEEEEEEEBTTBSSSSSCEEEEEE
T ss_pred             -------------------------------------CCCEEEEEEEecC--CcccceEEEEEecCCCCCCCCCeEEEEC
Confidence                                                 4556666666663  6789999999999999999999999999


Q ss_pred             cCcHHHHHHHHHHHhcCCCcccccCCcccchhhhccccchhhhhhHHHHHHcccHHHHHHHHHhccchHHHHHHHHHHHH
Q psy1007         173 HGSIAVINAILGALTKLPGLRPAEPGEFSKRAFFNNKLDLTQTEALGDLIQAETELQRQKALHQMKGNLKQLYSEWRQLI  252 (445)
Q Consensus       173 hg~~~v~~~i~~~l~~~~g~r~a~~Gef~~ra~~n~k~dl~~ae~~~~li~A~~~~~~~~al~~~~g~l~~~l~~~~~~l  252 (445)
                      |||++|+++++++|++. |+|+|+|||||+|||+||||||+|||++.||+.|+++.+++.|+.++.|.+++.+..|++.|
T Consensus       102 HGg~~v~~~~l~~~~~~-g~r~A~pGEFt~RAflngk~dL~qaEav~dli~a~t~~~~~~a~~~l~G~ls~~i~~lr~~L  180 (476)
T 3gee_A          102 HGGPVVVGRVLRLMLDN-GCRLAEPGEFTRRAFLNGRIDLLQAEAIGEMIHARTESAYRTAVSQMKGDLSVRLGGLREQL  180 (476)
T ss_dssp             ECCHHHHHHHHHHHHHT-TCEECCTTHHHHHHHHTTSSCHHHHHHHHHHHHCCSHHHHHHHHHHHHTHHHHHHHHHHTHH
T ss_pred             CCCHHHHHHHHHHHHHC-CCeecCCcchhhhhhccCcCcHHHHHHHHHHHhCCCHHHHHHHHHhhCCcHHHHHHHHHHHH
Confidence            99999999999999998 99999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhccccccccCCCcccchhhHHHHHHHHHHHHHHHHHHHHhhhccccccccCCeEEEeeeccccccCCChhHHHHHH
Q psy1007         253 LESLASVEAYIDFSEDEIIEDNILNTVRSQVVQLHGSIEKHIELSNKCGVRIRSGIKSVICLASVEAYIDFSEDEIIEDN  332 (445)
Q Consensus       253 ~~~~a~iE~~Idfse~e~~~~~~~~~~~~~l~~l~~~L~~~~~~~~~~g~~~~~gi~~vIvl~k~e~~~Dl~~~~~~~~~  332 (445)
                      ..+++++|+.|||++++ ++........+++..+..++.....                                     
T Consensus       181 ~~~~a~iea~iDf~eed-i~~~~~~~l~~~i~~l~~~l~~~~~-------------------------------------  222 (476)
T 3gee_A          181 IRSCALIELELDFSEED-VEFQSRDELTMQIETLRSEVNRLID-------------------------------------  222 (476)
T ss_dssp             HHHHHTTTTCSSCCSSC-CSSSCHHHHHHHHHHHHHHHHHHHH-------------------------------------
T ss_pred             HHHHHHhheecCCCccc-ccchhHHHHHHHHHHHHHHHHHHHH-------------------------------------
Confidence            99999999999999965 5554555555556655555554443                                     


Q ss_pred             HHHHHHHHHHhhccCcceeeecccccccccccCcEEEEEcCCCCChhHHhhhhccccceeeecCCCccceEEEEEEEECC
Q psy1007         333 ILNTVRSQVVQLHGSIEKHIELSNKCGVRIRSGIKSVIVGEPNVGKSSLMNFLCQKQISIVTSIPGTTRDVIEKHLDIGG  412 (445)
Q Consensus       333 ~l~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~v~lvG~~~vGKSsLln~l~~~~~~~vs~~~~tt~~~~~~~~~~~g  412 (445)
                                            +...++.++++++|+++|+||||||||+|+|++.+...+++.++||++.....+.++|
T Consensus       223 ----------------------~~~~~~~~r~~~kV~ivG~~nvGKSSLln~L~~~~~a~vs~~~gtT~d~~~~~i~~~g  280 (476)
T 3gee_A          223 ----------------------SYQHGRIVSEGVSTVIAGKPNAGKSTLLNTLLGQERAIVSHMPGTTRDYIEECFIHDK  280 (476)
T ss_dssp             ----------------------HHHHHHHHHHCEEEEEECCTTSSHHHHHHHCC------------------CEEEEETT
T ss_pred             ----------------------HHHhhHhhcCCCEEEEECCCCCCHHHHHHHHhCCCCcccCCCCCceEEEEEEEEEECC
Confidence                                  1122344567899999999999999999999998877788999999999999999999


Q ss_pred             eeEEEEECCCCCcCCCCcccHHHHHHHHHhh
Q psy1007         413 YPVILLDTAGLRTTTSDIIETEGNLLEKNNQ  443 (445)
Q Consensus       413 ~~v~l~DTpG~~~~~~~~~e~~~i~~~~~~~  443 (445)
                      .++.+|||||+++ ..+.++..++.+++..+
T Consensus       281 ~~l~liDT~G~~~-~~~~ve~~gi~~~~~~~  310 (476)
T 3gee_A          281 TMFRLTDTAGLRE-AGEEIEHEGIRRSRMKM  310 (476)
T ss_dssp             EEEEEEC---------------------CCC
T ss_pred             eEEEEEECCCCCc-chhHHHHHHHHHHHhhc
Confidence            9999999999985 45667777777766543



>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>3gir_A Aminomethyltransferase; glycine cleavage system, aminotransferase, structural genomics; 1.60A {Bartonella henselae} Back     alignment and structure
>1vlo_A Aminomethyltransferase; NP417381, tetrahydrofolat dependent) of glycine cleavage system, structural genomics, protein structure initiative; HET: MSE; 1.70A {Escherichia coli K12} SCOP: b.44.2.1 d.250.1.1 PDB: 3a8j_A* 3a8i_A* 3a8k_A* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>3tfi_A GCVT-like aminomethyltransferase protein; demethylase, THF; 1.60A {Candidatus pelagibacter ubique} PDB: 3tfh_A 3tfj_A* Back     alignment and structure
>1wos_A Aminomethyltransferase; T-protein; 1.84A {Thermotoga maritima} SCOP: b.44.2.1 d.250.1.1 PDB: 1woo_A* 1wop_A* 1wor_A Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>1wsr_A Aminomethyltransferase; glycine-cleavage sytem; 2.00A {Homo sapiens} PDB: 1wsv_A* Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>3ttg_A Putative aminomethyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.00A {Leptospirillum rubarum} Back     alignment and structure
>1yx2_A Aminomethyltransferase; glycine cleavage system T protein, alpha-beta, beta-barrel, structural genomics, PSI, protein structure initiative; 2.08A {Bacillus subtilis} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1v5v_A Aminomethyltransferase; glycine-cleavage sytem, structural riken structural genomics/proteomics initiative, RSGI; 1.50A {Pyrococcus horikoshii} SCOP: b.44.2.1 d.250.1.1 Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1vly_A SPOT PR51, unknown protein from 2D-PAGE; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.30A {Escherichia coli} SCOP: b.44.2.1 d.250.1.1 PDB: 1nrk_A Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2gag_C Heterotetrameric sarcosine oxidase gamma-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_C* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>1x31_C Sarcosine oxidase gamma subunit; heterotetrameric sarcosine oxidase, flavoenzyme, oxidoreduct; HET: FAD NAD FMN; 2.15A {Corynebacterium SP} PDB: 1vrq_C* 3ad7_C* 3ad8_C* 3ad9_C* 3ada_C* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>4ido_A Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HET: GDP; 2.09A {Homo sapiens} PDB: 4idn_A* 3q5d_A* 3q5e_A* 4idq_A* 4idp_A* 3qnu_A* 3qof_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 445
d1xzpa3117 d.250.1.2 (A:1-117) TrmE formyl-THF-binding domain 4e-24
d1xzpa3117 d.250.1.2 (A:1-117) TrmE formyl-THF-binding domain 3e-09
d1xzpa1173 a.24.25.1 (A:118-211,A:372-450) TrmE connector dom 7e-18
d1xzpa2160 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotog 3e-13
d1udxa2180 c.37.1.8 (A:157-336) Obg GTP-binding protein middl 2e-11
d1lnza2 185 c.37.1.8 (A:158-342) Obg GTP-binding protein middl 4e-11
d1h65a_ 257 c.37.1.8 (A:) Chloroplast protein translocon GTPas 7e-11
d1mkya2186 c.37.1.8 (A:173-358) Probable GTPase Der, N-termin 2e-10
d1egaa1179 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain { 2e-10
d2gj8a1161 c.37.1.8 (A:216-376) Probable tRNA modification GT 4e-10
d1tq4a_ 400 c.37.1.8 (A:) Interferon-inducible GTPase {Mouse ( 2e-08
d1wf3a1178 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain { 2e-08
d1mkya1171 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal 1e-07
d2cxxa1 184 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyroc 2e-07
d1u0la2225 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C 3e-07
d1g16a_166 c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye 6e-07
d1puia_188 c.37.1.8 (A:) Probable GTPase EngB {Escherichia co 9e-07
d2ew1a1171 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [Ta 2e-06
d2fu5c1173 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta 2e-06
d3raba_169 c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI 4e-06
d2g6ba1170 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [T 5e-06
d1puja_273 c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subti 7e-06
d1x3sa1177 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [Ta 9e-06
d1svia_195 c.37.1.8 (A:) Probable GTPase EngB {Bacillus subti 1e-05
d1nrjb_ 209 c.37.1.8 (B:) Signal recognition particle receptor 4e-05
d1t9ha2231 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C 4e-05
d1upta_169 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 5e-05
d1ni3a1 296 c.37.1.8 (A:11-306) YchF GTP-binding protein N-ter 5e-05
d2qtvb1166 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharom 1e-04
d2bcgy1 194 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac 2e-04
d1ksha_165 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 3e-04
d2g3ya1172 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human 6e-04
d1r8sa_160 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 6e-04
d2bmea1174 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta 7e-04
d2atxa1185 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [Tax 0.001
d1f6ba_186 c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus gr 0.001
d2gjsa1168 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [Tax 0.001
d1zj6a1177 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human 0.001
d1moza_182 c.37.1.8 (A:) ADP-ribosylation factor {Baker's yea 0.002
d1ky3a_175 c.37.1.8 (A:) Rab-related protein ypt7p {Baker's y 0.002
d1z2aa1164 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [Ta 0.002
d1zd9a1164 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human 0.002
d2fh5b1 207 c.37.1.8 (B:63-269) Signal recognition particle re 0.002
d1fzqa_176 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 0.003
d1vg8a_ 184 c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId 0.003
>d1xzpa3 d.250.1.2 (A:1-117) TrmE formyl-THF-binding domain {Thermotoga maritima [TaxId: 2336]} Length = 117 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Folate-binding domain
superfamily: Folate-binding domain
family: TrmE formyl-THF-binding domain
domain: TrmE formyl-THF-binding domain
species: Thermotoga maritima [TaxId: 2336]
 Score = 94.7 bits (235), Expect = 4e-24
 Identities = 39/111 (35%), Positives = 58/111 (52%), Gaps = 5/111 (4%)

Query: 99  GKCGVSVIRVSGPDTLNALKSMACYPDQKVSKPRYASLRNIVDPVSEVVLDEGLCLWFPK 158
           GK  ++++R+SGPD+   ++       +    PR A    I +      +DE + +++  
Sbjct: 12  GKGAIAILRLSGPDSWKIVQKH--LRTRSKIVPRKAIHGWIHEN--GEDVDEVVVVFYKS 67

Query: 159 PNSFTGEDCCEFQVHGSIAVINAILGALTKLPGLRPAEPGEFSKRAFFNNK 209
           P S+TGED  E   HG   V+  +L    K  G R AEPGEF+KRAF N K
Sbjct: 68  PKSYTGEDMVEVMCHGGPLVVKKLLDLFLK-SGARMAEPGEFTKRAFLNGK 117


>d1xzpa3 d.250.1.2 (A:1-117) TrmE formyl-THF-binding domain {Thermotoga maritima [TaxId: 2336]} Length = 117 Back     information, alignment and structure
>d1xzpa1 a.24.25.1 (A:118-211,A:372-450) TrmE connector domain {Thermotoga maritima [TaxId: 2336]} Length = 173 Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Length = 160 Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Length = 180 Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Length = 185 Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 257 Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 186 Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Length = 161 Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Length = 400 Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 178 Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 171 Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Length = 184 Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 225 Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Length = 188 Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Length = 273 Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Length = 195 Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Length = 231 Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 296 Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Length = 185 Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 186 Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Length = 182 Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175 Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Length = 164 Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 207 Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Length = 176 Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 184 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query445
d1xzpa3117 TrmE formyl-THF-binding domain {Thermotoga maritim 100.0
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 99.83
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 99.79
d1pj5a4315 N,N-dimethylglycine oxidase domain 3 {Arthrobacter 99.48
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 99.43
d1vloa2274 Glycine cleavage system T protein, GcvT {Escherich 99.43
d1v5va2310 Glycine cleavage system T protein, GcvT {Pyrococcu 99.43
d1xzpa1173 TrmE connector domain {Thermotoga maritima [TaxId: 99.38
d1wosa2278 Glycine cleavage system T protein, GcvT {Thermotog 99.37
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.13
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.1
d1h65a_ 257 Chloroplast protein translocon GTPase Toc34 {Garde 99.07
d1xzpa3117 TrmE formyl-THF-binding domain {Thermotoga maritim 99.05
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.0
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 98.83
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 98.79
d1lnza2 185 Obg GTP-binding protein middle domain {Bacillus su 98.77
d2cxxa1 184 GTP-binding protein engB {Pyrococcus horikoshii [T 98.75
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 98.73
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 98.72
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 98.72
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 98.7
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 98.64
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 98.64
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 98.6
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 98.6
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 98.57
d2bcgy1 194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 98.57
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 98.56
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 98.56
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 98.56
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 98.56
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 98.55
d1nrjb_ 209 Signal recognition particle receptor beta-subunit 98.52
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 98.52
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 98.52
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 98.52
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 98.51
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 98.5
d1ni3a1 296 YchF GTP-binding protein N-terminal domain {Fissio 98.5
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 98.49
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 98.48
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 98.48
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 98.48
d1wxqa1 319 GTP-binding protein PH0525 {Pyrococcus horikoshii 98.47
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 98.46
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.45
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 98.45
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 98.45
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 98.43
d2ngra_ 191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 98.41
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 98.4
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 98.4
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 98.39
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 98.39
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 98.38
d1vlya2241 Hypothetical protein YgfZ, N-terminal domain {Esch 98.37
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 98.37
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 98.37
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 98.37
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 98.36
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 98.36
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 98.35
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 98.34
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 98.34
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 98.33
d1jala1 278 YchF GTP-binding protein N-terminal domain {Haemop 98.32
d1vg8a_ 184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 98.29
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 98.29
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 98.24
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 98.23
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 98.23
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 98.2
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 98.17
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.16
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 98.12
d1svsa1 195 Transducin (alpha subunit) {Rat (Rattus norvegicus 98.1
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.07
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 98.06
d1zcba2 200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 98.05
d2c78a3 204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 98.05
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 98.04
d2fh5b1 207 Signal recognition particle receptor beta-subunit 98.02
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 98.01
d2bcjq2 200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 98.0
d1g7sa4 227 Initiation factor IF2/eIF5b, N-terminal (G) domain 97.92
d1azta2 221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 97.78
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 97.7
d2bv3a2 276 Elongation factor G (EF-G), N-terminal (G) domain 97.25
d2dy1a2 267 Elongation factor G (EF-G), N-terminal (G) domain 97.19
d1kk1a3 195 Initiation factor eIF2 gamma subunit, N-terminal ( 97.15
d1zunb3 222 Sulfate adenylate transferase subunit cysN/C, EF-T 96.95
d1jwyb_ 306 Dynamin G domain {Dictyostelium discoideum [TaxId: 96.95
d1f60a3 239 Elongation factor eEF-1alpha, N-terminal (G) domai 96.81
d2qn6a3 205 Initiation factor eIF2 gamma subunit, N-terminal ( 96.78
d1jnya3 224 Elongation factor eEF-1alpha, N-terminal (G) domai 96.51
d1r5ba3 245 Eukaryotic peptide chain release factor ERF2, G do 96.48
d1f5na2 277 Interferon-induced guanylate-binding protein 1 (GB 96.32
d2akab1 299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 96.0
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 95.98
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 95.77
d1s96a_ 205 Guanylate kinase {Escherichia coli [TaxId: 562]} 95.69
d1j8yf2 211 GTPase domain of the signal sequence recognition p 95.44
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 95.38
d1l2ta_ 230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 95.23
d1lw7a2 192 Transcriptional regulator NadR, ribosylnicotinamid 95.21
d3dhwc1 240 Methionine import ATP-binding protein MetN {Escher 95.05
d1n0ua2 341 Elongation factor 2 (eEF-2), N-terminal (G) domain 95.03
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 95.03
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 94.99
d1v43a3 239 Hypothetical protein PH0022, N-terminal domain {Py 94.97
d1ji0a_ 240 Branched chain aminoacid ABC transporter {Thermoto 94.96
d2pmka1 241 Haemolysin B ATP-binding protein {Escherichia coli 94.95
d1mv5a_ 242 Multidrug resistance ABC transporter LmrA, C-termi 94.87
d1jj7a_ 251 Peptide transporter Tap1, C-terminal ABC domain {H 94.83
d1g2912 240 Maltose transport protein MalK, N-terminal domain 94.79
d3b60a1 253 Multidrug resistance ABC transporter MsbA, C-termi 94.76
d2awna2 232 Maltose transport protein MalK, N-terminal domain 94.59
d1g6ha_ 254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 94.55
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 94.53
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 94.5
d1r0wa_ 281 Cystic fibrosis transmembrane conductance regulato 94.49
d2hyda1 255 Putative multidrug export ATP-binding/permease pro 94.48
d1ak2a1 190 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.36
d1oxxk2 242 Glucose transport protein GlcV, N-terminal domain 94.33
d1yrba1 244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 94.25
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 94.23
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 94.18
d1vpla_ 238 Putative ABC transporter TM0544 {Thermotoga mariti 94.13
d1l7vc_ 231 ABC transporter involved in vitamin B12 uptake, Bt 94.01
d3d31a2 229 Sulfate/molybdate ABC transporter, ATP-binding pro 93.89
d1gkya_ 186 Guanylate kinase {Baker's yeast (Saccharomyces cer 93.77
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 93.74
d1bifa1 213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 93.6
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 93.56
d1b0ua_ 258 ATP-binding subunit of the histidine permease {Sal 93.54
d2onka1 240 Molybdate/tungstate import ATP-binding protein Wtp 93.46
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 93.37
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 93.32
d1zina1 182 Adenylate kinase {Bacillus stearothermophilus [Tax 93.11
d2i3ba1 189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 93.1
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 93.08
d1zaka1 189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 93.07
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 93.01
d1qf9a_ 194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 92.98
d1khta_ 190 Adenylate kinase {Archaeon Methanococcus voltae [T 92.89
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 92.67
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 92.66
d1lvga_ 190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 92.62
d2ak3a1 189 Adenylate kinase {Cow (Bos taurus), mitochondrial 92.59
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 92.49
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 92.45
d1s3ga1 182 Adenylate kinase {Bacillus globisporus [TaxId: 145 92.45
d2cdna1 181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 92.32
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 92.25
d3adka_ 194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 92.19
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 91.87
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 91.72
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 91.71
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 91.51
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 91.35
d1teva_ 194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 91.3
d1nksa_ 194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 90.97
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 90.83
d1ixsb2 239 Holliday junction helicase RuvB {Thermus thermophi 90.74
d2vp4a1 197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 90.59
d1uj2a_ 213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 90.59
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 90.36
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 89.65
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 89.47
d1ukza_ 196 Uridylate kinase {Baker's yeast (Saccharomyces cer 89.43
d1okkd2 207 GTPase domain of the signal recognition particle r 89.35
d1in4a2 238 Holliday junction helicase RuvB {Thermotoga mariti 89.29
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 88.96
d1vmaa2 213 GTPase domain of the signal recognition particle r 88.91
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 88.64
d1m7ga_ 208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 88.6
d1d2na_ 246 Hexamerization domain of N-ethylmalemide-sensitive 88.48
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 88.39
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 88.03
d2qy9a2 211 GTPase domain of the signal recognition particle r 87.8
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 87.74
d1sxja2 253 Replication factor C1 {Baker's yeast (Saccharomyce 87.65
d1uf9a_ 191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 86.89
d1n0wa_ 242 DNA repair protein Rad51, catalytic domain {Human 86.83
d1xzpa1173 TrmE connector domain {Thermotoga maritima [TaxId: 86.57
d1q3ta_ 223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 86.36
d1iqpa2 231 Replication factor C {Archaeon Pyrococcus furiosus 86.3
d1ls1a2 207 GTPase domain of the signal sequence recognition p 86.12
d1sq5a_ 308 Pantothenate kinase PanK {Escherichia coli [TaxId: 85.79
d1nn5a_ 209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 85.63
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 85.31
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 85.26
d1ckea_ 225 CMP kinase {Escherichia coli [TaxId: 562]} 84.97
d1p5zb_ 241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 84.96
d4tmka_ 210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 84.76
d1ixza_ 247 AAA domain of cell division protein FtsH {Thermus 84.63
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 84.6
d1sxjd2 237 Replication factor C2 {Baker's yeast (Saccharomyce 84.42
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 84.39
d1szpa2 251 DNA repair protein Rad51, catalytic domain {Baker' 83.92
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 83.87
d1qhla_ 222 Cell division protein MukB {Escherichia coli [TaxI 83.72
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 83.72
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 83.68
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 83.39
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 83.32
d1sxjb2 224 Replication factor C4 {Baker's yeast (Saccharomyce 83.28
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 82.99
d1e69a_ 308 Smc head domain {Thermotoga maritima [TaxId: 2336] 82.88
d1gsia_ 208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 82.61
d1sxjc2 227 Replication factor C3 {Baker's yeast (Saccharomyce 81.77
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 81.51
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 81.48
d1pzna2 254 DNA repair protein Rad51, catalytic domain {Archae 80.19
>d1xzpa3 d.250.1.2 (A:1-117) TrmE formyl-THF-binding domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Folate-binding domain
superfamily: Folate-binding domain
family: TrmE formyl-THF-binding domain
domain: TrmE formyl-THF-binding domain
species: Thermotoga maritima [TaxId: 2336]
Probab=100.00  E-value=1.6e-41  Score=285.76  Aligned_cols=117  Identities=36%  Similarity=0.560  Sum_probs=101.2

Q ss_pred             CCcEEEEccCCCCceEEEEEEecccHHHHHHHhcCCCCCCCCCCceeEEeeeecCCCCceecceEEEeecccccCcceEe
Q psy1007          27 KNTIFALSSGHGKCGVSVIRVSGPDTLNALKSMACYPDQKVPKPRYASLRNIVDPVSKVVLDEGLCLWFPRHGKCGVSVI  106 (445)
Q Consensus        27 ~dtI~A~at~~g~~ai~viRiSG~~a~~i~~~l~~~~~~~~~~~~~~~~~~~~d~~~g~~iD~~i~~~~~~~~~~giavI  106 (445)
                      +|||||+|||+|+|||+|||||||+|.+++++++...  ..++||+++|+.                             
T Consensus         1 mDTI~AlaTp~G~saIaVIRiSG~~a~~i~~~~~~~~--~~~~~r~~~~~~-----------------------------   49 (117)
T d1xzpa3           1 MDTIVAVATPPGKGAIAILRLSGPDSWKIVQKHLRTR--SKIVPRKAIHGW-----------------------------   49 (117)
T ss_dssp             SCCEEEECSCSSSCSCEEEEEESSSHHHHHHTTEEES--SCCCBTBCEEEE-----------------------------
T ss_pred             CCCEEEecCCCCcceEEEEEEECccHHHHHHHHhCcc--cccccceEEeec-----------------------------
Confidence            5999999999999999999999999999999988621  233334333333                             


Q ss_pred             eccCCChHHHhhhhccCCCCCCCCCeEEEeeeeecCCCCeeecCceeeecCCCCCcCCCceeEEEecCcHHHHHHHHHHH
Q psy1007         107 RVSGPDTLNALKSMACYPDQKVSKPRYASLRNIVDPVSEVVLDEGLCLWFPKPNSFTGEDCCEFQVHGSIAVINAILGAL  186 (445)
Q Consensus       107 risGp~a~~il~~l~~~~~~~~~~~rra~~~~~~d~~~~~~~d~~~~~~f~~p~syTGEd~~Ei~~hg~~~v~~~i~~~l  186 (445)
                                                      +.+  +++.+|+++++||++|+||||||++|||||||++|++++++.|
T Consensus        50 --------------------------------i~~--~~~~iD~~lv~~f~~P~S~TGEd~vEi~~HG~~~i~~~il~~l   95 (117)
T d1xzpa3          50 --------------------------------IHE--NGEDVDEVVVVFYKSPKSYTGEDMVEVMCHGGPLVVKKLLDLF   95 (117)
T ss_dssp             --------------------------------ECC--SSCCCCEEEEEEECTTSSSSSSCEEEEEECSCHHHHHHHHHHH
T ss_pred             --------------------------------ccc--cccccCcceEEEecCccCccccceEEEEeccchhHHHHHHHHh
Confidence                                            332  3677899999999999999999999999999999999999999


Q ss_pred             hcCCCcccccCCcccchhhhccc
Q psy1007         187 TKLPGLRPAEPGEFSKRAFFNNK  209 (445)
Q Consensus       187 ~~~~g~r~a~~Gef~~ra~~n~k  209 (445)
                      ... |+|+|+|||||+|||+|||
T Consensus        96 ~~~-g~R~A~pGEFT~RAflNgK  117 (117)
T d1xzpa3          96 LKS-GARMAEPGEFTKRAFLNGK  117 (117)
T ss_dssp             HTT-TCEECCTTHHHHHHHHTTS
T ss_pred             hhc-CccccCCchhhHHHHhcCC
Confidence            986 9999999999999999997



>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pj5a4 d.250.1.1 (A:428-742) N,N-dimethylglycine oxidase domain 3 {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vloa2 d.250.1.1 (A:4-277) Glycine cleavage system T protein, GcvT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5va2 d.250.1.1 (A:3-312) Glycine cleavage system T protein, GcvT {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xzpa1 a.24.25.1 (A:118-211,A:372-450) TrmE connector domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wosa2 d.250.1.1 (A:1-278) Glycine cleavage system T protein, GcvT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1xzpa3 d.250.1.2 (A:1-117) TrmE formyl-THF-binding domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1vlya2 d.250.1.1 (A:3-243) Hypothetical protein YgfZ, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xzpa1 a.24.25.1 (A:118-211,A:372-450) TrmE connector domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure