Psyllid ID: psy13761

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400--
MLRKYQTNPPTKQLKKKSLPKEPFNPHNDSLGEFELAESQLISEEKRLSERLKEEKELAEDTKEVVNLSGHSDRDLLENEIPVNLMEDENLNKSEAGPNTAELSKEDFQTGDECKAPISESELRKQSLYVQFDPFLKSPVRQKPSIKSPPTQSIMEEESLNDSAKLLGTSELNESVNSLSIKENESLNGNCATSTPSGTAHTANLISPERNSTSDEKDKLIEKLKKENASYQKMLNDYENTITQCVNQRENDKKQFEKYKKELEKEKEEVQLHLRNSEIAFNDVHLKYERSKVIIEGMKANEDHLRARHSELEEELKKQVNKYDALKTHAISQLEKANQDLDLRNKTYEMETTKLKAMLKKSEMQITSLQESLARKTEENAELTSICDDLISKLSSCVKLKF
ccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccHHHHHHHHHHccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHccccc
ccHHHccccccHHccccccccccccccccccccHHHHHHHHHHHcccHHccccccccHHcccHHHHHHccccccccccccccccccccccccHHHcccccHcccHHHccccccccccccHHHHHHHcEEEEccHccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
mlrkyqtnpptkqlkkkslpkepfnphndslgeFELAESQLISEEKRLSERLKEEKELAEDTKEVVnlsghsdrdlleneipvnlmedenlnkseagpntaelskedfqtgdeckapiseselrkqslyvqfdpflkspvrqkpsikspptqsimeeeSLNDSAKLLGTSELNESVNSLSikeneslngncatstpsgtahtanlispernstsdEKDKLIEKLKKENASYQKMLNDYENTITQCVNQRENDKKQFEKYKKELEKEKEEVQLHLRNSEIAFNDVHLKYERSKVIIEGMKANEDHLRARHSELEEELKKQVNKYDALKTHAISQLEKANQDLDLRNKTYEMETTKLKAMLKKSEMQITSLQESLARKTEENAELTSICDDLISKLSSCVKLKF
mlrkyqtnpptkqlkkkslpkepfNPHNDSLGEFELAESQLISEEKRLSERLKEEkelaedtkevvnlsghsdrdllENEIPVNLMEDENLNKSEAGPNTAELSKEDFQTGDECKAPISESELRKQSLYVQFDpflkspvrqkpsikspptqsimeeESLNDSAKLLGTSELNESVNSLSIKENESLNGNCATstpsgtahtanlispernstsdekDKLIEKLKKENASYQKMLNDYENTITQCVNQRENDKKQFEKYKKELEKEKEEVQlhlrnseiafndvhlkYERSKVIIEGMKANEDHLRARHSELEEELKKQVNKYDALKTHAISqlekanqdldlrnKTYEMETTKLKAMLKKSEMQITSLQESLARKTEENAELTSIcddlisklsscvklkf
MLRKYQTNPPTKQLKKKSLPKEPFNPHNDSLGEFELAESQLIseekrlserlkeekelAEDTKEVVNLSGHSDRDLLENEIPVNLMEDENLNKSEAGPNTAELSKEDFQTGDECKAPISESELRKQSLYVQFDPFLKSPVRQKPSIKSPPTQSIMEEESLNDSAKLLGTSELNESVNSLSIKENESLNGNCATSTPSGTAHTANLISPERNSTSdekdklieklkkeNASYQKMLNDYENTITQCVNQRendkkqfekykkelekekeeVQLHLRNSEIAFNDVHLKYERSKVIIEGMKANEDHLRARHSELEEELKKQVNKYDALKTHAISQLEKANQDLDLRNKTYEMETTKLKAMLKKSEMQITSLQESLARKTEENAELTSICDDLISKLSSCVKLKF
********************************************************************************************************************************YVQF*************************************************************************************************************IT*****************************HLRNSEIAFNDVHLKYERSKVIIEG***************************************************************************************SICDDLISKL********
***********************************************************************************************************************************FD*******************************************************************************************************DYENTIT******************************************************************************************************************************************ELTSICDDLISKLSSCV**KF
********************KEPFNPHNDSLGEFELAESQLISEEKRLSERLKEEKELAEDTKEVVNLSGHSDRDLLENEIPVNLMEDENLNKSEAGPNTAELSKEDFQTGDECKAPISESELRKQSLYVQFDPFLKSPVR*******************NDSAKLLGTSELNESVNSLSIKENESLNGNCATSTPSGTAHTANLISP*********DKLIEKLKKENASYQKMLNDYENTITQCVNQRENDKKQFEKYKKELEKEKEEVQLHLRNSEIAFNDVHLKYERSKVIIEGMKANEDHLRARHSELEEELKKQVNKYDALKTHAISQLEKANQDLDLRNKTYEMETTKLKAMLKKSEMQITSLQESLARKTEENAELTSICDDLISKLSSCVKLKF
******************************************************************************************************************KAPISESELRKQSLYVQFDPFLKS************************************SVNSLSIKENESLNGNCATSTPSGTAHTANLISPERNSTSDEKDKLIEKLKKENASYQKMLNDYENTITQCVNQRENDKKQFEKYKKELEKEKEEVQLHLRNSEIAFNDVHLKYERSKVIIEGMKANEDHLRARHSELEEELKKQVNKYDALKTHAISQLEKANQDLDLRNKTYEMETTKLKAMLKKSEMQITSLQESLARKTEENAELTSICDDLISKLSSCVK***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRKYQTNPPTKQLKKKSLPKEPFNPHNDSLGEFELAESQLxxxxxxxxxxxxxxxxxxxxxxxxVNLSGHSDRDLLENEIPVNLMEDENLNKSEAGPNTAELSKEDFQTGDECKAPISESELRKQSLYVQFDPFLKSPVRQKPSIKSPPTQSIMEEESLNDSAKLLGTSELNESVNSLSIKENESLNGNCATSTPSGTAHTANLISPERNSTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFNDVHLKYERSKVIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAxxxxxxxxxxxxxxxxxxxxxTTKLKAMxxxxxxxxxxxxxxxxxxxxxxxxxxxxCDDLISKLSSCVKLKF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query402 2.2.26 [Sep-21-2011]
Q9PTG8931 Transforming acidic coile N/A N/A 0.659 0.284 0.3 2e-22
Q9JJ11631 Transforming acidic coile yes N/A 0.738 0.470 0.308 3e-21
O75410805 Transforming acidic coile yes N/A 0.452 0.226 0.324 3e-19
Q6Y685774 Transforming acidic coile no N/A 0.452 0.235 0.318 4e-19
Q9Y6A5838 Transforming acidic coile no N/A 0.425 0.204 0.338 8e-17
O953592948 Transforming acidic coile no N/A 0.472 0.064 0.314 1e-16
Q9JJG01149 Transforming acidic coile no N/A 0.470 0.164 0.314 3e-15
>sp|Q9PTG8|TACC3_XENLA Transforming acidic coiled-coil-containing protein 3 OS=Xenopus laevis GN=tacc3 PE=1 SV=2 Back     alignment and function desciption
 Score =  107 bits (266), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 96/320 (30%), Positives = 157/320 (49%), Gaps = 55/320 (17%)

Query: 120 ESELRKQSLYVQFDPFLK-SPVRQKPSIKSPPTQSI--------------------MEEE 158
           ES LRKQSLY++FDP L+ SP +    I   P+  +                    +E E
Sbjct: 619 ESVLRKQSLYLKFDPLLRESPKKSAAGINLLPSVPLKCSSDLFGAIPEANFPLIPSIENE 678

Query: 159 SLNDSAKLLGTSELNESVNSLSIKENESLNGNCATSTPSGTAHTANLISPERNSTSDEKD 218
                  LLGT  + ++  +L I     ++   + + P+    T++ I      +  + D
Sbjct: 679 EKPKGLDLLGTFTVADT--ALLI-----VDAPSSVAVPNPFLSTSDAIVEMLKYSQKDMD 731

Query: 219 KLI---------------------EKLKKENASYQKMLNDYENTITQCVNQRENDKKQFE 257
             I                     EKL  E     K++ ++E TITQ +   E+ ++Q E
Sbjct: 732 AAIEAVRLEVQEKDLEVLEWKTKHEKLYLEYVEMGKIIAEFEGTITQIL---EDSQRQKE 788

Query: 258 KYKKELEK---EKEEVQLHLRNSEIAFNDVHLKYERSKVIIEGMKANEDHLRARHSELEE 314
             K EL K   EK++VQ+ L + E +F+++  + E+ K  +EG + NE+ L+    +   
Sbjct: 789 TAKLELNKVLQEKQQVQVDLNSMETSFSELFKRLEKQKEALEGYRKNEEALKKCVEDYLV 848

Query: 315 ELKKQVNKYDALKTHAISQLEKANQDLDLRNKTYEMETTKLKAMLKKSEMQITSLQESLA 374
            +KK+  +Y ALK HA  +L +AN+++       + E T L+A L+K +M+I SL+ SL 
Sbjct: 849 RIKKEEQRYQALKAHAEEKLNRANEEIAHVRSKAKSEATALQATLRKEQMKIQSLERSLE 908

Query: 375 RKTEENAELTSICDDLISKL 394
           +K++EN ELT ICDD I K+
Sbjct: 909 QKSKENDELTKICDDFILKM 928
Maternal RNA in oocytes remains in a dormant state as masking outcompetes eif4g to bind eif4e, thereby preventing translation. During oocyte maturation this complex dissolves and eif4g binds eif4e to allow translation of maternal RNAs.
Xenopus laevis (taxid: 8355)
>sp|Q9JJ11|TACC3_MOUSE Transforming acidic coiled-coil-containing protein 3 OS=Mus musculus GN=Tacc3 PE=1 SV=1 Back     alignment and function description
>sp|O75410|TACC1_HUMAN Transforming acidic coiled-coil-containing protein 1 OS=Homo sapiens GN=TACC1 PE=1 SV=2 Back     alignment and function description
>sp|Q6Y685|TACC1_MOUSE Transforming acidic coiled-coil-containing protein 1 OS=Mus musculus GN=Tacc1 PE=1 SV=1 Back     alignment and function description
>sp|Q9Y6A5|TACC3_HUMAN Transforming acidic coiled-coil-containing protein 3 OS=Homo sapiens GN=TACC3 PE=1 SV=1 Back     alignment and function description
>sp|O95359|TACC2_HUMAN Transforming acidic coiled-coil-containing protein 2 OS=Homo sapiens GN=TACC2 PE=1 SV=3 Back     alignment and function description
>sp|Q9JJG0|TACC2_MOUSE Transforming acidic coiled-coil-containing protein 2 OS=Mus musculus GN=Tacc2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query402
328710712 556 PREDICTED: hypothetical protein LOC10016 0.718 0.519 0.332 1e-31
328710714 565 PREDICTED: hypothetical protein LOC10016 0.718 0.511 0.332 2e-31
357628423165 hypothetical protein KGM_09135 [Danaus p 0.402 0.981 0.456 2e-30
357613333 2346 hypothetical protein KGM_22044 [Danaus p 0.430 0.073 0.448 2e-30
383848835 958 PREDICTED: uncharacterized protein LOC10 0.467 0.196 0.413 5e-29
328781199 945 PREDICTED: hypothetical protein LOC41132 0.437 0.186 0.395 9e-27
380012446 944 PREDICTED: uncharacterized protein LOC10 0.437 0.186 0.395 1e-26
156541204 1090 PREDICTED: hypothetical protein LOC10011 0.400 0.147 0.416 2e-26
322795502 895 hypothetical protein SINV_14763 [Solenop 0.402 0.181 0.432 1e-25
311261768 740 PREDICTED: transforming acidic coiled-co 0.659 0.358 0.318 2e-25
>gi|328710712|ref|XP_001944892.2| PREDICTED: hypothetical protein LOC100165118 isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  143 bits (361), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 120/361 (33%), Positives = 185/361 (51%), Gaps = 72/361 (19%)

Query: 84  NLMEDENLNKSEAGPNTAE-LSKEDFQTGDECKA-----PISESELRK-----QSLYVQF 132
           N+ E E  N SEAGP  AE  +       D  +A      ++E ++R+     +SLYV F
Sbjct: 215 NIFESEIKNSSEAGPVIAEGFNSSAGYNFDNLEALESVRSLNEEDIRRLTISRKSLYVAF 274

Query: 133 DPFLKSP---------------VRQKPSIKSPPTQSIMEEESLNDSAKLLGTSELNESV- 176
           DP +K                 V  K  + S P QS    +SLN     +  +++N+S+ 
Sbjct: 275 DPIVKKSNEESNARKEAFENILVTDKTVLTSSP-QSSGSNKSLN-----ISDTKMNQSIT 328

Query: 177 ------NSLSIKENE-----------------SLNGNCATSTPSGTAHTANLISPERNST 213
                 NS + K N+                 +L   C          T +LIS  ++  
Sbjct: 329 KDEKISNSSNSKTNDREKCYQDKIEKLECEIKNLKNECIADKEKIKNLTNSLISVTKS-- 386

Query: 214 SDEKDKLIEKLKKENASYQKMLNDYENTITQCVNQRENDKKQFEKYKKELEKEKEEVQLH 273
              KD+L             ++ +YE TI+  V+++E+  K++E     +E+E+ +++ H
Sbjct: 387 ---KDQL-----------STVIGEYEKTISDMVSKKEDVHKEYEARIAYIEEERAKMERH 432

Query: 274 LRNSEIAFNDVHLKYERSKVIIEGMKANEDHLRARHSELEEELKKQVNKYDALKTHAISQ 333
           L+NSE+AFNDVH KY  SK +IE MK NE   +    E EE LKK  +KY  LK HA  Q
Sbjct: 433 LQNSELAFNDVHEKYNSSKQVIEAMKENETKYKNCIKEFEESLKKYEDKYMRLKIHATEQ 492

Query: 334 LEKANQDLDLRNKTYEMETTKLKAMLKKSEMQITSLQESLARKTEENAELTSICDDLISK 393
           + KA ++++ + +++E ET+K++ M K+ E+++ SLQESL RK  ENAELT++CD+LI K
Sbjct: 493 MNKATEEINDKERSFEAETSKMRIMNKRLEVKVRSLQESLDRKDVENAELTNLCDELIGK 552

Query: 394 L 394
           L
Sbjct: 553 L 553

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328710714|ref|XP_003244340.1| PREDICTED: hypothetical protein LOC100165118 isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|357628423|gb|EHJ77766.1| hypothetical protein KGM_09135 [Danaus plexippus] Back     alignment and taxonomy information
>gi|357613333|gb|EHJ68444.1| hypothetical protein KGM_22044 [Danaus plexippus] Back     alignment and taxonomy information
>gi|383848835|ref|XP_003700053.1| PREDICTED: uncharacterized protein LOC100880218 [Megachile rotundata] Back     alignment and taxonomy information
>gi|328781199|ref|XP_394801.4| PREDICTED: hypothetical protein LOC411326 [Apis mellifera] Back     alignment and taxonomy information
>gi|380012446|ref|XP_003690294.1| PREDICTED: uncharacterized protein LOC100871327 [Apis florea] Back     alignment and taxonomy information
>gi|156541204|ref|XP_001599707.1| PREDICTED: hypothetical protein LOC100114802 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|322795502|gb|EFZ18217.1| hypothetical protein SINV_14763 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|311261768|ref|XP_003128852.1| PREDICTED: transforming acidic coiled-coil-containing protein 3 [Sus scrofa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query402
FB|FBgn00266201308 tacc "transforming acidic coil 0.407 0.125 0.347 1.9e-27
UNIPROTKB|F1NCL7890 TACC3 "Uncharacterized protein 0.400 0.180 0.355 3.4e-27
UNIPROTKB|F1S8S7740 TACC3 "Uncharacterized protein 0.400 0.217 0.331 4.6e-24
UNIPROTKB|Q9PTG8931 tacc3 "Transforming acidic coi 0.400 0.172 0.337 3.5e-23
UNIPROTKB|A6QL93810 TACC3 "TACC3 protein" [Bos tau 0.400 0.198 0.306 4.4e-23
RGD|1302948587 Tacc3 "transforming, acidic co 0.298 0.204 0.377 4.5e-22
MGI|MGI:1341163631 Tacc3 "transforming, acidic co 0.300 0.191 0.388 6.8e-22
UNIPROTKB|E2RGF0788 TACC3 "Uncharacterized protein 0.412 0.210 0.297 3.8e-21
UNIPROTKB|Q9Y6A5838 TACC3 "Transforming acidic coi 0.412 0.198 0.303 7.8e-21
UNIPROTKB|G8JLK4792 TACC1 "Transforming acidic coi 0.402 0.204 0.317 7.4e-19
FB|FBgn0026620 tacc "transforming acidic coiled-coil protein" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 280 (103.6 bits), Expect = 1.9e-27, Sum P(2) = 1.9e-27
 Identities = 57/164 (34%), Positives = 92/164 (56%)

Query:   228 NASYQKMLNDYENTITQCVNQRXXXXXXXXXXXXXXXXXXXXVQLHLRNSEIAFNDVHLK 287
             NA    ++  YE  I + ++++                       HL + E  F+D+H+K
Sbjct:  1136 NAKLNGVIEAYEKAIAELISEKEQQAQLHERQLQEVQADRDANYHHLTSLETTFSDLHVK 1195

Query:   288 YERSKVIIEGMKANEDHLRARHSELEEELKKQVNKYDALKTHAISQLEKANQDLDLRNKT 347
             YE+SK +   +K+NE+ L A   ++ + L+ Q  +YD +K HA+ QLE AN+ LD  ++ 
Sbjct:  1196 YEKSKEMTSQLKSNEESLLAERKQMMDNLRLQEQRYDKMKNHAMQQLEIANKKLDTYSRE 1255

Query:   348 YEMETTKLKAMLKKSEMQITSLQESLARKTEENAELTSICDDLI 391
             +  ET KLKA+LKK E+   S+ E L +K+ ENA+L  IC++LI
Sbjct:  1256 HADETKKLKALLKKEEISRVSMTEQLQQKSRENADLLKICEELI 1299
GO:0007026 "negative regulation of microtubule depolymerization" evidence=NAS;TAS
GO:0007067 "mitosis" evidence=NAS;IMP
GO:0035046 "pronuclear migration" evidence=IMP
GO:0000226 "microtubule cytoskeleton organization" evidence=IMP
GO:0005813 "centrosome" evidence=IDA;TAS
GO:0007097 "nuclear migration" evidence=IMP
GO:0000242 "pericentriolar material" evidence=NAS
GO:0007344 "pronuclear fusion" evidence=TAS
GO:0005515 "protein binding" evidence=IPI
GO:0008104 "protein localization" evidence=IMP;TAS
GO:0007143 "female meiosis" evidence=TAS
GO:0000235 "astral microtubule" evidence=TAS
GO:0007052 "mitotic spindle organization" evidence=TAS
GO:0008017 "microtubule binding" evidence=TAS
GO:0005876 "spindle microtubule" evidence=TAS
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0000922 "spindle pole" evidence=IDA
GO:0007279 "pole cell formation" evidence=IMP
UNIPROTKB|F1NCL7 TACC3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1S8S7 TACC3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9PTG8 tacc3 "Transforming acidic coiled-coil-containing protein 3" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|A6QL93 TACC3 "TACC3 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1302948 Tacc3 "transforming, acidic coiled-coil containing protein 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1341163 Tacc3 "transforming, acidic coiled-coil containing protein 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RGF0 TACC3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y6A5 TACC3 "Transforming acidic coiled-coil-containing protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G8JLK4 TACC1 "Transforming acidic coiled-coil-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query402
pfam05010207 pfam05010, TACC, Transforming acidic coiled-coil-c 2e-27
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.003
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.004
>gnl|CDD|218380 pfam05010, TACC, Transforming acidic coiled-coil-containing protein (TACC) Back     alignment and domain information 
 Score =  107 bits (270), Expect = 2e-27
 Identities = 69/186 (37%), Positives = 114/186 (61%)

Query: 209 ERNSTSDEKDKLIEKLKKENASYQKMLNDYENTITQCVNQRENDKKQFEKYKKELEKEKE 268
                S+E  K  EKL+ EN    K+++++E TI Q + + +  K+  ++  +E+  EK+
Sbjct: 20  SSELESEELKKKYEKLRSENLEMGKIVDEFEKTIAQMIEESQKQKELSKRELQEVLAEKD 79

Query: 269 EVQLHLRNSEIAFNDVHLKYERSKVIIEGMKANEDHLRARHSELEEELKKQVNKYDALKT 328
           +    L + E +F+D+  +YE+ K +IEG K NE+ L+    E  + LKK+  +Y ALK 
Sbjct: 80  QAYADLNSLETSFSDLFKRYEKYKEVIEGYKKNEETLKKCAQEYLDRLKKEEQRYQALKA 139

Query: 329 HAISQLEKANQDLDLRNKTYEMETTKLKAMLKKSEMQITSLQESLARKTEENAELTSICD 388
           HA  +LE AN+++       + ET  L+A L+K +M++ SL+E+L +K +EN ELT ICD
Sbjct: 140 HAEEKLEIANEEIAQVRSKAKAETAALQASLRKEQMKVQSLEETLEQKNKENEELTKICD 199

Query: 389 DLISKL 394
           +LISK+
Sbjct: 200 ELISKM 205

This family contains the proteins TACC 1, 2 and 3 the genes for which are found concentrated in the centrosomes of eukaryotic and may play a conserved role in organising centrosomal microtubules. The human TACC proteins have been linked to cancer and TACC2 has been identified as a possible tumour suppressor (AZU-1). The functional homologue (Alp7) in Schizosaccharomyces pombe has been shown to be required for organisation of bipolar spindles. Length = 207
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 402
PF05010207 TACC: Transforming acidic coiled-coil-containing p 100.0
KOG0980|consensus 980 97.89
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 97.4
PF05010207 TACC: Transforming acidic coiled-coil-containing p 97.35
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 97.25
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 97.11
PRK04778569 septation ring formation regulator EzrA; Provision 97.09
PRK02224 880 chromosome segregation protein; Provisional 97.05
PF00038 312 Filament: Intermediate filament protein; InterPro: 97.05
PRK09039 343 hypothetical protein; Validated 97.03
PHA02562 562 46 endonuclease subunit; Provisional 96.89
PRK02224 880 chromosome segregation protein; Provisional 96.83
PRK03918 880 chromosome segregation protein; Provisional 96.81
PRK03918 880 chromosome segregation protein; Provisional 96.8
PRK11637 428 AmiB activator; Provisional 96.79
PHA02562 562 46 endonuclease subunit; Provisional 96.72
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 96.57
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 96.47
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 96.27
KOG0161|consensus 1930 96.23
PRK04863 1486 mukB cell division protein MukB; Provisional 96.21
KOG0996|consensus 1293 96.2
KOG0250|consensus 1074 96.17
PF13851201 GAS: Growth-arrest specific micro-tubule binding 96.06
KOG0161|consensus 1930 95.99
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 95.82
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 95.8
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 95.79
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 95.73
PF05667 594 DUF812: Protein of unknown function (DUF812); Inte 95.69
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 95.61
PF00038312 Filament: Intermediate filament protein; InterPro: 95.56
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 95.51
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 95.39
KOG0995|consensus581 95.38
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 95.28
TIGR01843 423 type_I_hlyD type I secretion membrane fusion prote 95.27
PF15397258 DUF4618: Domain of unknown function (DUF4618) 95.23
PF13851201 GAS: Growth-arrest specific micro-tubule binding 95.21
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 95.15
KOG1029|consensus 1118 95.05
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 94.99
KOG0996|consensus 1293 94.96
KOG1029|consensus 1118 94.71
PRK01156 895 chromosome segregation protein; Provisional 94.67
KOG0250|consensus 1074 94.59
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 94.47
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 94.4
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 94.39
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 94.37
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 94.22
KOG4643|consensus 1195 94.2
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 94.14
KOG0018|consensus 1141 94.07
KOG4674|consensus 1822 93.89
KOG4674|consensus 1822 93.87
KOG0964|consensus 1200 93.48
PRK11637 428 AmiB activator; Provisional 93.41
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 93.15
PRK01156 895 chromosome segregation protein; Provisional 93.09
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 93.06
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 93.01
KOG0994|consensus1758 92.9
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 92.67
PF09731 582 Mitofilin: Mitochondrial inner membrane protein; I 92.59
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 92.49
TIGR01843 423 type_I_hlyD type I secretion membrane fusion prote 92.47
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 92.24
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 92.21
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 92.12
KOG0933|consensus 1174 92.06
PF15254 861 CCDC14: Coiled-coil domain-containing protein 14 91.56
PF10211189 Ax_dynein_light: Axonemal dynein light chain; Inte 91.56
PF15066527 CAGE1: Cancer-associated gene protein 1 family 91.19
PF01576 859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 90.94
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 90.57
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 90.43
KOG0804|consensus493 90.41
KOG4673|consensus 961 90.27
KOG0612|consensus 1317 90.13
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 90.12
PRK04778 569 septation ring formation regulator EzrA; Provision 90.01
PF09728309 Taxilin: Myosin-like coiled-coil protein; InterPro 89.99
cd07657237 F-BAR_Fes_Fer The F-BAR (FES-CIP4 Homology and Bin 89.91
KOG4673|consensus 961 89.76
PRK09039343 hypothetical protein; Validated 89.64
PF15272196 BBP1_C: Spindle pole body component BBP1, C-termin 89.4
KOG0977|consensus 546 89.21
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 89.17
KOG0243|consensus 1041 88.85
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 88.83
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 88.74
COG0419 908 SbcC ATPase involved in DNA repair [DNA replicatio 88.68
PF10186302 Atg14: UV radiation resistance protein and autopha 88.54
PF03962188 Mnd1: Mnd1 family; InterPro: IPR005647 This family 88.42
TIGR03017444 EpsF chain length determinant protein EpsF. Sequen 88.37
KOG0243|consensus 1041 88.33
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 87.98
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 87.9
PF06548 488 Kinesin-related: Kinesin-related; InterPro: IPR010 87.9
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 87.7
PF05911769 DUF869: Plant protein of unknown function (DUF869) 87.5
KOG0804|consensus493 87.47
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 87.33
KOG0612|consensus 1317 87.14
cd07654264 F-BAR_FCHSD The F-BAR (FES-CIP4 Homology and Bin/A 86.93
smart00502127 BBC B-Box C-terminal domain. Coiled coil region C- 86.73
cd07627216 BAR_Vps5p The Bin/Amphiphysin/Rvs (BAR) domain of 86.53
PF14662193 CCDC155: Coiled-coil region of CCDC155 86.43
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 86.3
KOG0994|consensus1758 86.27
PRK04863 1486 mukB cell division protein MukB; Provisional 86.13
PRK10884206 SH3 domain-containing protein; Provisional 85.83
PF05701 522 WEMBL: Weak chloroplast movement under blue light; 85.6
COG4026290 Uncharacterized protein containing TOPRIM domain, 85.5
PF05483 786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 85.46
KOG3850|consensus455 85.35
COG1842225 PspA Phage shock protein A (IM30), suppresses sigm 85.31
PF09403126 FadA: Adhesion protein FadA; InterPro: IPR018543 F 85.3
PRK05759156 F0F1 ATP synthase subunit B; Validated 85.2
TIGR02977219 phageshock_pspA phage shock protein A. Members of 85.18
PF10267395 Tmemb_cc2: Predicted transmembrane and coiled-coil 84.93
PF07445173 priB_priC: Primosomal replication protein priB and 84.58
PF09787511 Golgin_A5: Golgin subfamily A member 5; InterPro: 84.57
PRK13454181 F0F1 ATP synthase subunit B'; Provisional 84.52
TIGR03185 650 DNA_S_dndD DNA sulfur modification protein DndD. T 84.3
PF05700221 BCAS2: Breast carcinoma amplified sequence 2 (BCAS 83.98
PF05529192 Bap31: B-cell receptor-associated protein 31-like 83.98
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 83.98
TIGR03185 650 DNA_S_dndD DNA sulfur modification protein DndD. T 83.98
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 83.86
PF01576 859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 83.86
KOG2077|consensus 832 83.65
PF05483 786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 83.64
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 83.56
PF10481 307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 83.28
PF10498359 IFT57: Intra-flagellar transport protein 57 ; Inte 83.24
PRK06231205 F0F1 ATP synthase subunit B; Validated 83.03
KOG0946|consensus 970 82.83
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 82.55
TIGR01069 771 mutS2 MutS2 family protein. Function of MutS2 is u 82.47
PRK10698222 phage shock protein PspA; Provisional 82.32
PRK00409 782 recombination and DNA strand exchange inhibitor pr 82.26
KOG4438|consensus 446 82.03
PF1022480 DUF2205: Predicted coiled-coil protein (DUF2205); 81.86
KOG0980|consensus 980 81.8
PRK07352174 F0F1 ATP synthase subunit B; Validated 81.73
PRK10884206 SH3 domain-containing protein; Provisional 81.54
TIGR02977219 phageshock_pspA phage shock protein A. Members of 81.52
KOG0244|consensus 913 81.36
PF05557 722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 81.28
KOG0964|consensus 1200 81.28
KOG0933|consensus 1174 81.15
TIGR02971327 heterocyst_DevB ABC exporter membrane fusion prote 80.9
PF05701 522 WEMBL: Weak chloroplast movement under blue light; 80.78
PF11932 251 DUF3450: Protein of unknown function (DUF3450); In 80.62
KOG3156|consensus220 80.58
KOG4807|consensus593 80.43
KOG0971|consensus 1243 80.14
>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules Back     alignment and domain information 
Probab=100.00  E-value=8.3e-59  Score=430.37  Aligned_cols=182  Identities=42%  Similarity=0.626  Sum_probs=179.3

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhhHHHHHHHHHHHhHHHHHHHHHHhHHHhhHHHHHHHHhhHHH
Q psy13761        215 DEKDKLIEKLKKENASYQKMLNDYENTITQCVNQRENDKKQFEKYKKELEKEKEEVQLHLRNSEIAFNDVHLKYERSKVI  294 (402)
Q Consensus       215 ~~~~~~~e~l~~~n~eM~~Im~EYEktI~qlIeE~eq~k~~~~~eiqkllkERDQa~aDLnS~EkSFSDLhrRYEK~Kev  294 (402)
                      .+|.++|++++.+|.+|++||++||+||++||++.+++++.+..+++++++||||+++||+|||+||+|||+||+|+|+|
T Consensus        26 ~~l~~k~~e~~~~~~~m~~i~~e~Ek~i~~~i~e~~~~~~~~~~~i~~~~~erdq~~~dL~s~E~sfsdl~~ryek~K~v  105 (207)
T PF05010_consen   26 QELKKKYEELHKENQEMRKIMEEYEKTIAQMIEEKQKQKELSEAEIQKLLKERDQAYADLNSLEKSFSDLHKRYEKQKEV  105 (207)
T ss_pred             HHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHhhHHhHHHHHHHHHhhHHHHHHHHHHHHhhHHHHHHHHHHHHHH
Confidence            46888999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHhhHHHHHHhhHHHHHH
Q psy13761        295 IEGMKANEDHLRARHSELEEELKKQVNKYDALKTHAISQLEKANQDLDLRNKTYEMETTKLKAMLKKSEMQITSLQESLA  374 (402)
Q Consensus       295 IegyKkNEE~LKk~ieey~~rvkkeeQRYqALKaHAEEKLe~ANEEIaqvrsk~eaE~~aLqA~LKKeEmkv~SLEesLE  374 (402)
                      |+||++||++||+|+++|.++|.+++|||++||+||+++|+.||++|++|+++|++|+++|+|+|||+||+++||+++|+
T Consensus       106 i~~~k~NEE~Lkk~~~ey~~~l~~~eqry~aLK~hAeekL~~ANeei~~v~~~~~~e~~aLqa~lkk~e~~~~SLe~~Le  185 (207)
T PF05010_consen  106 IEGYKKNEETLKKCIEEYEERLKKEEQRYQALKAHAEEKLEKANEEIAQVRSKHQAELLALQASLKKEEMKVQSLEESLE  185 (207)
T ss_pred             HHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHcccc
Q psy13761        375 RKTEENAELTSICDDLISKLSS  396 (402)
Q Consensus       375 QKtKENeELTkICDELIsK~~~  396 (402)
                      ||++||+|||+||||||++||+
T Consensus       186 QK~kEn~ELtkICDeLI~k~~k  207 (207)
T PF05010_consen  186 QKTKENEELTKICDELISKMGK  207 (207)
T ss_pred             HHHHHHHHHHHHHHHHHHHhcC
Confidence            9999999999999999999985

The human TACC proteins have been linked to cancer and TACC2 has been identified as a possible tumour suppressor (AZU-1) [].
>KOG0980|consensus Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0161|consensus Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>KOG0996|consensus Back     alignment and domain information
>KOG0250|consensus Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>KOG0161|consensus Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>KOG0995|consensus Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PF15397 DUF4618: Domain of unknown function (DUF4618) Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>KOG0996|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG0250|consensus Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>KOG4643|consensus Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>KOG0018|consensus Back     alignment and domain information
>KOG4674|consensus Back     alignment and domain information
>KOG4674|consensus Back     alignment and domain information
>KOG0964|consensus Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PF09731 Mitofilin: Mitochondrial inner membrane protein; InterPro: IPR019133 Mitofilin controls mitochondrial cristae morphology Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>KOG0933|consensus Back     alignment and domain information
>PF15254 CCDC14: Coiled-coil domain-containing protein 14 Back     alignment and domain information
>PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility Back     alignment and domain information
>PF15066 CAGE1: Cancer-associated gene protein 1 family Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>KOG4673|consensus Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed Back     alignment and domain information
>cd07657 F-BAR_Fes_Fer The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Fes (feline sarcoma) and Fer (Fes related) tyrosine kinases Back     alignment and domain information
>KOG4673|consensus Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF15272 BBP1_C: Spindle pole body component BBP1, C-terminal Back     alignment and domain information
>KOG0977|consensus Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>KOG0243|consensus Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>TIGR03017 EpsF chain length determinant protein EpsF Back     alignment and domain information
>KOG0243|consensus Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>PF06548 Kinesin-related: Kinesin-related; InterPro: IPR010544 This entry represents a domain within kinesin-related proteins from higher plants Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>cd07654 F-BAR_FCHSD The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of FCH and double SH3 domains proteins (FCHSD) Back     alignment and domain information
>smart00502 BBC B-Box C-terminal domain Back     alignment and domain information
>cd07627 BAR_Vps5p The Bin/Amphiphysin/Rvs (BAR) domain of yeast Sorting Nexin Vps5p Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>KOG3850|consensus Back     alignment and domain information
>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF09403 FadA: Adhesion protein FadA; InterPro: IPR018543 FadA (Fusobacterium adhesin A) is an adhesin which forms two alpha helices Back     alignment and domain information
>PRK05759 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>TIGR02977 phageshock_pspA phage shock protein A Back     alignment and domain information
>PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans Back     alignment and domain information
>PF07445 priB_priC: Primosomal replication protein priB and priC; InterPro: IPR010890 This family contains the bacterial primosomal replication proteins priB and priC (approximately 180 residues long) Back     alignment and domain information
>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure Back     alignment and domain information
>PRK13454 F0F1 ATP synthase subunit B'; Provisional Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function Back     alignment and domain information
>PF05529 Bap31: B-cell receptor-associated protein 31-like ; InterPro: IPR008417 Bap31 is a polytopic integral protein of the endoplasmic reticulum membrane and a substrate of caspase-8 Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>KOG2077|consensus Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms Back     alignment and domain information
>PRK06231 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>KOG0946|consensus Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>PRK10698 phage shock protein PspA; Provisional Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>KOG4438|consensus Back     alignment and domain information
>PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure Back     alignment and domain information
>KOG0980|consensus Back     alignment and domain information
>PRK07352 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>TIGR02977 phageshock_pspA phage shock protein A Back     alignment and domain information
>KOG0244|consensus Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>KOG0964|consensus Back     alignment and domain information
>KOG0933|consensus Back     alignment and domain information
>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG3156|consensus Back     alignment and domain information
>KOG4807|consensus Back     alignment and domain information
>KOG0971|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query402
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 7e-09
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-08
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 2e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 8e-07
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-05
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 59.9 bits (144), Expect = 9e-10
 Identities = 65/409 (15%), Positives = 112/409 (27%), Gaps = 148/409 (36%)

Query: 48  LSERLKEE-KELAEDTKEVVNLSGHSDRDLLENEIPV-----------------NLMEDE 89
           L   +K E ++ +  T+  +       RD L N+  V                  L+E  
Sbjct: 94  LMSPIKTEQRQPSMMTRMYI-----EQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLELR 148

Query: 90  NLN-----------KS----EAGPNTAELSKEDFQ----TGDECKAPISESELRK-QSLY 129
                         K+    +   +     K DF+        C +P  E+ L   Q L 
Sbjct: 149 PAKNVLIDGVLGSGKTWVALDVCLSYKVQCKMDFKIFWLNLKNCNSP--ETVLEMLQKLL 206

Query: 130 VQFDPFLKSPVRQKPSIKSPPTQSIMEE--------------------------ESLNDS 163
            Q DP   S      +IK     SI  E                           + N S
Sbjct: 207 YQIDPNWTSRSDHSSNIKL-RIHSIQAELRRLLKSKPYENCLLVLLNVQNAKAWNAFNLS 265

Query: 164 AKLLGTS-----------------ELNESVNSLSIKENESLNGNCATSTPSGTAHTANLI 206
            K+L T+                  L+    +L+  E +SL        P          
Sbjct: 266 CKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVLTT 325

Query: 207 SPERNSTSDEKDKLIEKLKKENAS----YQKMLND-YENTITQCVNQREND--KKQFEK- 258
           +P R S       +I +  ++  +    ++ +  D     I   +N  E    +K F++ 
Sbjct: 326 NPRRLS-------IIAESIRDGLATWDNWKHVNCDKLTTIIESSLNVLEPAEYRKMFDRL 378

Query: 259 -------------------YKKELEKEKEEVQLHLR--------NSEIAFNDVHLKYERS 291
                                 + +      +LH           S I+   ++L+    
Sbjct: 379 SVFPPSAHIPTILLSLIWFDVIKSDVMVVVNKLHKYSLVEKQPKESTISIPSIYLEL--- 435

Query: 292 KVIIEGMKANEDHLRARHSELEEELKKQVNKYDALKTHAISQLEKANQD 340
                  K   ++  A H       +  V+ Y+  KT     L     D
Sbjct: 436 -------KVKLENEYALH-------RSIVDHYNIPKTFDSDDLIPPYLD 470
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query402
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 97.45
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 97.26
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 96.98
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 96.96
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 96.13
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 95.07
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 94.78
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 94.27
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 94.26
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 93.88
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 93.8
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 92.52
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 92.35
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 92.23
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 92.22
1deq_A 390 Fibrinogen (alpha chain); coiled-coil, blood clott 90.39
2b5u_A551 Colicin E3; high resolution colicin E3, ribosome i 89.68
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 88.64
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 87.96
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 87.47
2efl_A305 Formin-binding protein 1; EFC domain, structural g 86.4
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 86.21
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 85.9
2no2_A107 HIP-I, huntingtin-interacting protein 1; clathrin 85.88
1m1j_A 491 Fibrinogen alpha subunit; coiled coils, disulfide 85.63
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 84.95
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 84.81
1m1j_B 464 Fibrinogen beta chain; coiled coils, disulfide rin 83.21
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 82.93
2efk_A301 CDC42-interacting protein 4; EFC domain, structura 82.88
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 82.19
3etw_A119 Adhesin A; antiparallel helix-loop-helix, leucine 81.82
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 81.2
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 80.97
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>2b5u_A Colicin E3; high resolution colicin E3, ribosome inactivation, ribosome inhibitor, hydrolase; HET: CIT; 2.30A {Escherichia coli} SCOP: b.101.1.1 b.110.1.1 h.4.9.1 PDB: 1jch_A* 1ujw_B* 2ysu_B 1e44_B 2xfz_Y* 2xg1_Y* Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>2efl_A Formin-binding protein 1; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.61A {Homo sapiens} SCOP: a.238.1.4 Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2no2_A HIP-I, huntingtin-interacting protein 1; clathrin light chain binding, HIP1 coiled-coil domain, endocytosis, clathrin SELF-assembly, cell adhesion; 2.80A {Homo sapiens} Back     alignment and structure
>1m1j_A Fibrinogen alpha subunit; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: h.1.8.1 PDB: 1ei3_A Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>2efk_A CDC42-interacting protein 4; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.30A {Homo sapiens} SCOP: a.238.1.4 Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3etw_A Adhesin A; antiparallel helix-loop-helix, leucine chain, cell adhesin, cell adhesion; 2.00A {Fusobacterium nucleatum} PDB: 3ety_A 3etx_A 3etz_A 2gl2_A Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query402
d2efka1279 CDC42-interacting protein 4, CIP4 {Human (Homo sap 93.85
d2efla1288 Formin-binding protein 1, FNBP1 {Human (Homo sapie 92.71
d2efla1288 Formin-binding protein 1, FNBP1 {Human (Homo sapie 90.93
>d2efka1 a.238.1.4 (A:10-288) CDC42-interacting protein 4, CIP4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: BAR/IMD domain-like
superfamily: BAR/IMD domain-like
family: FCH domain
domain: CDC42-interacting protein 4, CIP4
species: Human (Homo sapiens) [TaxId: 9606]

Probab=93.85  E-value=1.5  Score=36.47  Aligned_cols=107  Identities=14%  Similarity=0.128  Sum_probs=59.6

Q ss_pred             HHHHHHHHhhhhhhhhHHHHHHHHHHHhHHHHHHHHHHhHHHhhHHHHHHHHhhHHHHHhhHhhHHHHHHHHHHHHHHHH
Q psy13761        238 YENTITQCVNQRENDKKQFEKYKKELEKEKEEVQLHLRNSEIAFNDVHLKYERSKVIIEGMKANEDHLRARHSELEEELK  317 (402)
Q Consensus       238 YEktI~qlIeE~eq~k~~~~~eiqkllkERDQa~aDLnS~EkSFSDLhrRYEK~KevIegyKkNEE~LKk~ieey~~rvk  317 (402)
                      ...-+..++.+..+..+.+.....++.++.......+...-+.|....+.+++.+..++....+-..-+..+......+.
T Consensus        89 i~~~l~~~~~~~~~~~k~~~~~~~~~~k~l~~~~~~~~k~k~~y~~~~~e~e~~~~~~~~~~~~~~~~~~~~~K~~~~~~  168 (279)
T d2efka1          89 VCLELTKYSQEMKQERKMHFQEGRRAQQQLENGFKQLENSKRKFERDCREAEKAAQTAERLDQDINATKADVEKAKQQAH  168 (279)
T ss_dssp             THHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCTTSCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccHHHHHHHHHHHH
Confidence            34445566677777777777777777777777777777777777777777777776655433221111222333333333


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy13761        318 KQVNKYDALKTHAISQLEKANQDLDLR  344 (402)
Q Consensus       318 keeQRYqALKaHAEEKLe~ANEEIaqv  344 (402)
                      +..+..+..+..-...+..||......
T Consensus       169 ~~~~~~~~~~~~y~~~l~~~n~~~~~~  195 (279)
T d2efka1         169 LRSHMAEESKNEYAAQLQRFNRDQAHF  195 (279)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            333333333333344455555554443
>d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure