Psyllid ID: psy15036


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MFADLAIMFADSRPESTFWIFGKPTYRCTKVTKMTAAKEFSFNFGTQLGRRGIPLLKHLKYLGTGTHGKTVGIVFPAISVTYSIGPRYFRFPLVSRFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKWLLQIKVMDGALFTHFELQIVFMRGCLELLQRCREVVTPDQIMFGSTQSSL
ccccEEEEcccccccEEEEEEccccccccEEEEccccccccEEEEcccccccccEEEEcccccccccccEEEEEEcEEEEEEEEccEEcccccccHHHHHHHHccccccEEEEEEEcccccHHHHHHHHHHHHHHHccccccccccEEEEEEcccccccccccccHHHHHHHHHHHccc
ccHHHHHHHHccccccEEEEEccccEEccEHEHHHHHHHcccccccHcccccccHHHEEEEEcccccccEEEEEEcEEEEEEEEcccEEcHHHHHHHHHHHHcccccccEEEEEEEcccHHHHHcHHHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHcccccHHHHHHHHccccc
MFADLAIMFadsrpestfwifgkptyrctkvtkmtaakefsfnfgtqlgrrgipllkhlkylgtgthgktvgIVFPAIsvtysigpryfrfplvsrflslttglyrgTMGFLLIFDVTNENSFKDVEKWLLQIKVMDGALFTHFELQIVFMRGCLELLQRCrevvtpdqimfgstqssl
MFADLAImfadsrpestfwifgkptYRCTKVTKMTAAKEFSFNFGTQLGRRGIPLLKHLKYLGTGTHGKTVGIVFPAISVTYSIGPRYFRFPLVSRFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKWLLQIKVMDGALFTHFELQIVFMRGCLELLQRCREvvtpdqimfgstqssl
MFADLAIMFADSRPESTFWIFGKPTYRCTKVTKMTAAKEFSFNFGTQLGRRGIPLLKHLKYLGTGTHGKTVGIVFPAISVTYSIGPRYFRFPLVSRFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKWLLQIKVMDGALFTHFELQIVFMRGCLELLQRCREVVTPDQIMFGSTQSSL
****LAIMFADSRPESTFWIFGKPTYRCTKVTKMTAAKEFSFNFGTQLGRRGIPLLKHLKYLGTGTHGKTVGIVFPAISVTYSIGPRYFRFPLVSRFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKWLLQIKVMDGALFTHFELQIVFMRGCLELLQRCREVVTPDQIMF*******
**AD***MFADSRPESTFWIFGKPTY********TAAKEFSFNFGTQLGRRGIPLLKHLKYLGTGTHGKTVGIVFPAISVTYSIGPRYFRFPLVSRFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKWLLQIKVMDGALFTHFELQIVFMRGCLELLQRCREVVTPDQIMFGSTQS**
MFADLAIMFADSRPESTFWIFGKPTYRCTKVTKMTAAKEFSFNFGTQLGRRGIPLLKHLKYLGTGTHGKTVGIVFPAISVTYSIGPRYFRFPLVSRFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKWLLQIKVMDGALFTHFELQIVFMRGCLELLQRCREVVTPDQIM********
MFADLAIMFADSRPESTFWIFGKPTYRCTKVTKMTAAKEFSFNFGTQLGRRGIPLLKHLKYLGTGTHGKTVGIVFPAISVTYSIGPRYFRFPLVSRFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKWLLQIKVMDGALFTHFELQIVFMRGCLELLQRCREVVTPDQIMFGST****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFADLAIMFADSRPESTFWIFGKPTYRCTKVTKMTAAKEFSFNFGTQLGRRGIPLLKHLKYLGTGTHGKTVGIVFPAISVTYSIGPRYFRFPLVSRFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKWLLQIKVMDGALFTHFELQIVFMRGCLELLQRCREVVTPDQIMFGSTQSSL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query179 2.2.26 [Sep-21-2011]
E2RQ15213 Ras-related protein Rab-2 yes N/A 0.558 0.469 0.315 7e-08
Q9WTL2213 Ras-related protein Rab-2 yes N/A 0.558 0.469 0.306 9e-08
P25228220 Ras-related protein Rab-3 yes N/A 0.223 0.181 0.55 1e-07
Q58DW6213 Ras-related protein Rab-2 yes N/A 0.558 0.469 0.315 1e-07
P57735213 Ras-related protein Rab-2 yes N/A 0.558 0.469 0.306 2e-07
P46629213 Ras-related protein Rab-2 yes N/A 0.558 0.469 0.306 2e-07
Q94986219 Ras-related protein Rab-3 no N/A 0.223 0.182 0.525 3e-07
O13876234 GTP-binding protein ypt4 yes N/A 0.564 0.431 0.298 4e-07
Q63941219 Ras-related protein Rab-3 no N/A 0.217 0.178 0.538 6e-07
Q9CZT8219 Ras-related protein Rab-3 no N/A 0.217 0.178 0.538 6e-07
>sp|E2RQ15|RAB25_CANFA Ras-related protein Rab-25 OS=Canis familiaris GN=RAB25 PE=3 SV=1 Back     alignment and function desciption
 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 56/111 (50%), Gaps = 11/111 (9%)

Query: 70  TVGIVFPAISV---TYSIGPRYFRFPLVSRFLSLTTGLYRGTMGFLLIFDVTNENSFKDV 126
           T+G+ F   +V   T +I  + +    + R+ ++T+  YRG +G LL+FD+T   ++  V
Sbjct: 44  TIGVEFSTRTVMLGTAAIKAQIWDTAGLERYRAITSAYYRGAVGALLVFDLTKHQTYAVV 103

Query: 127 EKWLLQIKVMDGALFTHFELQIVFM-RGCLELLQRCREVVTPDQIMFGSTQ 176
           E+WL +       L+ H E  IV M  G    L + REV T +  MF    
Sbjct: 104 ERWLKE-------LYDHAEATIVVMLVGNKSDLHQAREVPTEEARMFAENN 147




Involved in the regulation of cell survival. Promotes invasive migration of cells in which it functions to localize and maintain integrin alpha-V/beta-1 at the tips of extending pseudopodia. May selectively regulate the apical recycling pathway (By similarity). Together with MYO5B regulates transcytosis.
Canis familiaris (taxid: 9615)
>sp|Q9WTL2|RAB25_MOUSE Ras-related protein Rab-25 OS=Mus musculus GN=Rab25 PE=1 SV=2 Back     alignment and function description
>sp|P25228|RAB3_DROME Ras-related protein Rab-3 OS=Drosophila melanogaster GN=Rab3 PE=1 SV=1 Back     alignment and function description
>sp|Q58DW6|RAB25_BOVIN Ras-related protein Rab-25 OS=Bos taurus GN=RAB25 PE=2 SV=1 Back     alignment and function description
>sp|P57735|RAB25_HUMAN Ras-related protein Rab-25 OS=Homo sapiens GN=RAB25 PE=1 SV=2 Back     alignment and function description
>sp|P46629|RAB25_RABIT Ras-related protein Rab-25 OS=Oryctolagus cuniculus GN=RAB25 PE=2 SV=1 Back     alignment and function description
>sp|Q94986|RAB3_CAEEL Ras-related protein Rab-3 OS=Caenorhabditis elegans GN=rab-3 PE=2 SV=1 Back     alignment and function description
>sp|O13876|YPT4_SCHPO GTP-binding protein ypt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt4 PE=3 SV=1 Back     alignment and function description
>sp|Q63941|RAB3B_RAT Ras-related protein Rab-3B OS=Rattus norvegicus GN=Rab3b PE=1 SV=2 Back     alignment and function description
>sp|Q9CZT8|RAB3B_MOUSE Ras-related protein Rab-3B OS=Mus musculus GN=Rab3b PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query179
357624129209 putative Ras-related protein Rab-27A [Da 0.363 0.311 0.472 5e-08
242003701213 GTP-binding nuclear protein RAN1, putati 0.363 0.305 0.444 6e-07
395845171213 PREDICTED: ras-related protein Rab-25 [O 0.558 0.469 0.324 1e-06
301783133213 PREDICTED: ras-related protein Rab-25-li 0.558 0.469 0.315 1e-06
281342890199 hypothetical protein PANDA_016684 [Ailur 0.558 0.502 0.315 1e-06
195456678230 GK16937 [Drosophila willistoni] gi|19417 0.368 0.286 0.438 2e-06
332027480208 Ras-related protein Rab-27A [Acromyrmex 0.363 0.312 0.479 2e-06
213510702218 Ras-related protein Rab-27B [Salmo salar 0.396 0.325 0.379 2e-06
355714881199 RAB25, member RAS oncoprotein family [Mu 0.558 0.502 0.315 2e-06
195399430226 GJ16030 [Drosophila virilis] gi|19415074 0.368 0.292 0.452 3e-06
>gi|357624129|gb|EHJ75014.1| putative Ras-related protein Rab-27A [Danaus plexippus] Back     alignment and taxonomy information
 Score = 63.2 bits (152), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 40/72 (55%), Gaps = 7/72 (9%)

Query: 70  TVGIVFPAISVTYSIGPRYFRFPLV-------SRFLSLTTGLYRGTMGFLLIFDVTNENS 122
           TVGI F   +V Y    R  R  L         RF SLTT  YR  MGFLL+FD+TNE S
Sbjct: 38  TVGIDFREKTVIYQQNSRQHRIHLQLWDTAGQERFRSLTTAFYRDAMGFLLLFDLTNEAS 97

Query: 123 FKDVEKWLLQIK 134
           F +V  W+ Q+K
Sbjct: 98  FLEVRNWIEQLK 109




Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242003701|ref|XP_002422827.1| GTP-binding nuclear protein RAN1, putative [Pediculus humanus corporis] gi|212505697|gb|EEB10089.1| GTP-binding nuclear protein RAN1, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|395845171|ref|XP_003795316.1| PREDICTED: ras-related protein Rab-25 [Otolemur garnettii] Back     alignment and taxonomy information
>gi|301783133|ref|XP_002926982.1| PREDICTED: ras-related protein Rab-25-like [Ailuropoda melanoleuca] Back     alignment and taxonomy information
>gi|281342890|gb|EFB18474.1| hypothetical protein PANDA_016684 [Ailuropoda melanoleuca] Back     alignment and taxonomy information
>gi|195456678|ref|XP_002075239.1| GK16937 [Drosophila willistoni] gi|194171324|gb|EDW86225.1| GK16937 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|332027480|gb|EGI67563.1| Ras-related protein Rab-27A [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|213510702|ref|NP_001134713.1| Ras-related protein Rab-27B [Salmo salar] gi|209735378|gb|ACI68558.1| Ras-related protein Rab-27B [Salmo salar] Back     alignment and taxonomy information
>gi|355714881|gb|AES05148.1| RAB25, member RAS oncoprotein family [Mustela putorius furo] Back     alignment and taxonomy information
>gi|195399430|ref|XP_002058323.1| GJ16030 [Drosophila virilis] gi|194150747|gb|EDW66431.1| GJ16030 [Drosophila virilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query179
WB|WBGene00000089215 aex-6 [Caenorhabditis elegans 0.402 0.334 0.440 6.1e-09
FB|FBgn0005586220 Rab3 "Rab3" [Drosophila melano 0.217 0.177 0.564 3.2e-08
UNIPROTKB|H3BS49136 RAB27A "Ras-related protein Ra 0.223 0.294 0.55 6.8e-08
UNIPROTKB|H3BVH7146 RAB27A "Ras-related protein Ra 0.223 0.273 0.55 6.8e-08
UNIPROTKB|Q94986219 rab-3 "Ras-related protein Rab 0.217 0.178 0.538 3.8e-07
UNIPROTKB|H3BN55185 RAB27A "Ras-related protein Ra 0.223 0.216 0.55 4.4e-07
WB|WBGene00004267233 rab-3 [Caenorhabditis elegans 0.217 0.167 0.538 4.9e-07
UNIPROTKB|Q95QV3233 rab-3 "Protein RAB-3, isoform 0.217 0.167 0.538 4.9e-07
FB|FBgn0025382236 Rab27 "Rab27" [Drosophila mela 0.530 0.402 0.370 5.1e-07
MGI|MGI:1858203213 Rab25 "RAB25, member RAS oncog 0.575 0.483 0.307 7.1e-07
WB|WBGene00000089 aex-6 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 133 (51.9 bits), Expect = 6.1e-09, P = 6.1e-09
 Identities = 37/84 (44%), Positives = 43/84 (51%)

Query:    64 TGTHGKTVGIVFPAISVTYS-----IGPRYFRFPLV-------SRFLSLTTGLYRGTMGF 111
             TG    TVGI F    V Y       G R  R  L         RF SLTT  +R  MGF
Sbjct:    33 TGQFISTVGIDFKEKKVVYKSSRGGFGGRGQRVLLQLWDTAGQERFRSLTTAFFRDAMGF 92

Query:   112 LLIFDVTNENSFKDVEKWLLQIKV 135
             +LIFD+TNE SF ++  WL Q+KV
Sbjct:    93 ILIFDITNEQSFLNIRDWLSQLKV 116




GO:0005525 "GTP binding" evidence=IEA
GO:0007264 "small GTPase mediated signal transduction" evidence=IEA
GO:0003924 "GTPase activity" evidence=IEA
GO:0006184 "GTP catabolic process" evidence=IEA
GO:0006886 "intracellular protein transport" evidence=IEA
GO:0006913 "nucleocytoplasmic transport" evidence=IEA
GO:0007165 "signal transduction" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0015031 "protein transport" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0040007 "growth" evidence=IMP
GO:0002119 "nematode larval development" evidence=IMP
GO:0040035 "hermaphrodite genitalia development" evidence=IMP
GO:0040011 "locomotion" evidence=IMP
FB|FBgn0005586 Rab3 "Rab3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|H3BS49 RAB27A "Ras-related protein Rab-27A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H3BVH7 RAB27A "Ras-related protein Rab-27A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q94986 rab-3 "Ras-related protein Rab-3" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|H3BN55 RAB27A "Ras-related protein Rab-27A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00004267 rab-3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q95QV3 rab-3 "Protein RAB-3, isoform a" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0025382 Rab27 "Rab27" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:1858203 Rab25 "RAB25, member RAS oncogene family" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query179
cd04127180 cd04127, Rab27A, Rab GTPase family 27a (Rab27a) 2e-11
smart00175164 smart00175, RAB, Rab subfamily of small GTPases 1e-10
cd01865165 cd01865, Rab3, Rab GTPase family 3 contains Rab3A, 2e-10
pfam00071162 pfam00071, Ras, Ras family 2e-10
cd00154159 cd00154, Rab, Ras-related in brain (Rab) family of 4e-10
cd01867167 cd01867, Rab8_Rab10_Rab13_like, Rab GTPase familie 7e-10
cd01868165 cd01868, Rab11_like, Rab GTPase family 11 (Rab11)- 1e-08
cd04110199 cd04110, Rab35, Rab GTPase family 35 (Rab35) 2e-07
cd04111211 cd04111, Rab39, Rab GTPase family 39 (Rab39) 1e-06
cd01869166 cd01869, Rab1_Ypt1, Rab GTPase family 1 includes t 3e-06
cd04113161 cd04113, Rab4, Rab GTPase family 4 (Rab4) 3e-06
PLN03110216 PLN03110, PLN03110, Rab GTPase; Provisional 4e-06
cd01862172 cd01862, Rab7, Rab GTPase family 7 (Rab7) 4e-06
cd04123162 cd04123, Rab21, Rab GTPase family 21 (Rab21) 7e-06
cd04120202 cd04120, Rab12, Rab GTPase family 12 (Rab12) 8e-06
cd01863161 cd01863, Rab18, Rab GTPase family 18 (Rab18) 2e-05
cd04112191 cd04112, Rab26, Rab GTPase family 26 (Rab26) 6e-05
cd04119168 cd04119, RJL, Rab GTPase family J-like (RabJ-like) 1e-04
cd04109213 cd04109, Rab28, Rab GTPase family 28 (Rab28) 7e-04
cd01866168 cd01866, Rab2, Rab GTPase family 2 (Rab2) 7e-04
cd04122166 cd04122, Rab14, Rab GTPase family 14 (Rab14) 8e-04
cd04107201 cd04107, Rab32_Rab38, Rab GTPase families 18 (Rab1 0.001
cd04121189 cd04121, Rab40, Rab GTPase family 40 (Rab40) conta 0.002
PLN03108210 PLN03108, PLN03108, Rab family protein; Provisiona 0.002
cd01860163 cd01860, Rab5_related, Rab-related GTPase family i 0.002
PTZ00099176 PTZ00099, PTZ00099, rab6; Provisional 0.003
COG1100219 COG1100, COG1100, GTPase SAR1 and related small G 0.003
cd04114169 cd04114, Rab30, Rab GTPase family 30 (Rab30) 0.004
>gnl|CDD|206700 cd04127, Rab27A, Rab GTPase family 27a (Rab27a) Back     alignment and domain information
 Score = 59.1 bits (143), Expect = 2e-11
 Identities = 34/79 (43%), Positives = 43/79 (54%), Gaps = 13/79 (16%)

Query: 70  TVGIVFPAISVTY-SIGP-----RYFRFPLV-------SRFLSLTTGLYRGTMGFLLIFD 116
           TVGI F    V Y S GP     + FR  L         RF SLTT  +R  MGFLL+FD
Sbjct: 36  TVGIDFREKRVVYNSQGPDGTSGKAFRVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFD 95

Query: 117 VTNENSFKDVEKWLLQIKV 135
           +T+E SF +V  W+ Q++ 
Sbjct: 96  LTSEQSFLNVRNWMSQLQA 114


The Rab27a subfamily consists of Rab27a and its highly homologous isoform, Rab27b. Unlike most Rab proteins whose functions remain poorly defined, Rab27a has many known functions. Rab27a has multiple effector proteins, and depending on which effector it binds, Rab27a has different functions as well as tissue distribution and/or cellular localization. Putative functions have been assigned to Rab27a when associated with the effector proteins Slp1, Slp2, Slp3, Slp4, Slp5, DmSlp, rabphilin, Dm/Ce-rabphilin, Slac2-a, Slac2-b, Slac2-c, Noc2, JFC1, and Munc13-4. Rab27a has been associated with several human diseases, including hemophagocytic syndrome (Griscelli syndrome or GS), Hermansky-Pudlak syndrome, and choroidermia. In the case of GS, a rare, autosomal recessive disease, a Rab27a mutation is directly responsible for the disorder. When Rab27a is localized to the secretory granules of pancreatic beta cells, it is believed to mediate glucose-stimulated insulin secretion, making it a potential target for diabetes therapy. When bound to JFC1 in prostate cells, Rab27a is believed to regulate the exocytosis of prostate- specific markers. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation. Length = 180

>gnl|CDD|197555 smart00175, RAB, Rab subfamily of small GTPases Back     alignment and domain information
>gnl|CDD|206657 cd01865, Rab3, Rab GTPase family 3 contains Rab3A, Rab3B, Rab3C and Rab3D Back     alignment and domain information
>gnl|CDD|215692 pfam00071, Ras, Ras family Back     alignment and domain information
>gnl|CDD|206640 cd00154, Rab, Ras-related in brain (Rab) family of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206659 cd01867, Rab8_Rab10_Rab13_like, Rab GTPase families 8, 10, 13 (Rab8, Rab10, Rab13) Back     alignment and domain information
>gnl|CDD|206660 cd01868, Rab11_like, Rab GTPase family 11 (Rab11)-like includes Rab11a, Rab11b, and Rab25 Back     alignment and domain information
>gnl|CDD|133310 cd04110, Rab35, Rab GTPase family 35 (Rab35) Back     alignment and domain information
>gnl|CDD|133311 cd04111, Rab39, Rab GTPase family 39 (Rab39) Back     alignment and domain information
>gnl|CDD|206661 cd01869, Rab1_Ypt1, Rab GTPase family 1 includes the yeast homolog Ypt1 Back     alignment and domain information
>gnl|CDD|206696 cd04113, Rab4, Rab GTPase family 4 (Rab4) Back     alignment and domain information
>gnl|CDD|178657 PLN03110, PLN03110, Rab GTPase; Provisional Back     alignment and domain information
>gnl|CDD|206655 cd01862, Rab7, Rab GTPase family 7 (Rab7) Back     alignment and domain information
>gnl|CDD|133323 cd04123, Rab21, Rab GTPase family 21 (Rab21) Back     alignment and domain information
>gnl|CDD|206699 cd04120, Rab12, Rab GTPase family 12 (Rab12) Back     alignment and domain information
>gnl|CDD|206656 cd01863, Rab18, Rab GTPase family 18 (Rab18) Back     alignment and domain information
>gnl|CDD|206695 cd04112, Rab26, Rab GTPase family 26 (Rab26) Back     alignment and domain information
>gnl|CDD|133319 cd04119, RJL, Rab GTPase family J-like (RabJ-like) Back     alignment and domain information
>gnl|CDD|206694 cd04109, Rab28, Rab GTPase family 28 (Rab28) Back     alignment and domain information
>gnl|CDD|206658 cd01866, Rab2, Rab GTPase family 2 (Rab2) Back     alignment and domain information
>gnl|CDD|133322 cd04122, Rab14, Rab GTPase family 14 (Rab14) Back     alignment and domain information
>gnl|CDD|206692 cd04107, Rab32_Rab38, Rab GTPase families 18 (Rab18) and 32 (Rab32) Back     alignment and domain information
>gnl|CDD|133321 cd04121, Rab40, Rab GTPase family 40 (Rab40) contains Rab40a, Rab40b and Rab40c Back     alignment and domain information
>gnl|CDD|178655 PLN03108, PLN03108, Rab family protein; Provisional Back     alignment and domain information
>gnl|CDD|206653 cd01860, Rab5_related, Rab-related GTPase family includes Rab5 and Rab22; regulates early endosome fusion Back     alignment and domain information
>gnl|CDD|185444 PTZ00099, PTZ00099, rab6; Provisional Back     alignment and domain information
>gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|133314 cd04114, Rab30, Rab GTPase family 30 (Rab30) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 179
KOG0084|consensus205 100.0
KOG0098|consensus216 100.0
KOG0087|consensus222 100.0
KOG0078|consensus207 100.0
KOG0080|consensus209 100.0
KOG0092|consensus200 100.0
KOG0094|consensus221 100.0
KOG0079|consensus198 100.0
KOG0095|consensus213 100.0
KOG0086|consensus214 100.0
KOG0091|consensus213 100.0
KOG0093|consensus193 99.98
KOG0081|consensus219 99.97
KOG0088|consensus218 99.97
KOG0394|consensus210 99.97
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 99.96
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 99.96
KOG0097|consensus215 99.96
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 99.96
KOG0083|consensus192 99.95
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 99.95
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 99.95
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 99.95
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 99.95
PLN00023 334 GTP-binding protein; Provisional 99.94
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 99.94
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 99.94
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 99.94
KOG0395|consensus196 99.93
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 99.93
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 99.93
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 99.93
PLN03110216 Rab GTPase; Provisional 99.93
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 99.93
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 99.93
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 99.93
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 99.93
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 99.93
KOG0393|consensus198 99.93
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 99.92
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 99.92
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 99.92
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 99.92
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.92
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 99.92
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 99.91
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 99.91
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 99.91
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 99.91
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.91
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 99.91
PLN03071219 GTP-binding nuclear protein Ran; Provisional 99.91
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.91
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.91
PLN03108210 Rab family protein; Provisional 99.91
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 99.91
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 99.91
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 99.9
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 99.9
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 99.9
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.9
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 99.9
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 99.9
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 99.9
PTZ00099176 rab6; Provisional 99.9
PTZ00369189 Ras-like protein; Provisional 99.9
KOG4252|consensus246 99.9
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 99.9
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.89
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 99.89
cd04143 247 Rhes_like Rhes_like subfamily. This subfamily incl 99.89
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 99.89
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 99.89
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 99.89
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.88
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 99.88
PLN03118211 Rab family protein; Provisional 99.88
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 99.88
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 99.88
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 99.88
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.88
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.87
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.87
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.87
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.87
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.87
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.87
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.86
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 99.86
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.86
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 99.86
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 99.86
cd04123162 Rab21 Rab21 subfamily. The localization and functi 99.85
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 99.85
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.85
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.84
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 99.84
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.84
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.83
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.83
PLN00223181 ADP-ribosylation factor; Provisional 99.82
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 99.82
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 99.82
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.82
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.82
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.82
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.8
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.8
PTZ00133182 ADP-ribosylation factor; Provisional 99.8
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.8
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.79
cd00876160 Ras Ras family. The Ras family of the Ras superfam 99.79
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 99.78
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.77
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 99.77
COG1100219 GTPase SAR1 and related small G proteins [General 99.77
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.76
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 99.76
KOG0096|consensus216 99.75
KOG4423|consensus229 99.73
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.73
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.73
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.72
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.71
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.71
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.71
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.7
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 99.7
KOG1673|consensus205 99.68
KOG0070|consensus181 99.68
PF00025175 Arf: ADP-ribosylation factor family The prints ent 99.66
KOG0073|consensus185 99.66
KOG3883|consensus198 99.65
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.62
KOG0071|consensus180 99.6
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.59
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.58
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.56
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.53
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.49
cd04105203 SR_beta Signal recognition particle receptor, beta 99.47
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.47
KOG0075|consensus186 99.46
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.45
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.4
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.4
PRK04213201 GTP-binding protein; Provisional 99.4
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.37
smart00010124 small_GTPase Small GTPase of the Ras superfamily; 99.33
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.32
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.32
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 99.31
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.27
PRK03003 472 GTP-binding protein Der; Reviewed 99.26
KOG0076|consensus197 99.25
KOG0074|consensus185 99.24
KOG1707|consensus 625 99.24
PRK03003 472 GTP-binding protein Der; Reviewed 99.24
PRK12299335 obgE GTPase CgtA; Reviewed 99.23
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.23
KOG0072|consensus182 99.22
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.19
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 99.18
PRK15494 339 era GTPase Era; Provisional 99.18
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.17
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.16
PRK11058426 GTPase HflX; Provisional 99.15
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.13
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.11
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 99.08
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 99.08
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.08
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 99.07
PRK00093 435 GTP-binding protein Der; Reviewed 99.07
COG2229187 Predicted GTPase [General function prediction only 99.03
TIGR00157 245 ribosome small subunit-dependent GTPase A. The Aqu 99.03
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.02
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.01
cd00881189 GTP_translation_factor GTP translation factor fami 99.0
TIGR00483 426 EF-1_alpha translation elongation factor EF-1 alph 98.99
PRK00454196 engB GTP-binding protein YsxC; Reviewed 98.98
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 98.97
PRK05306 787 infB translation initiation factor IF-2; Validated 98.94
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 98.93
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 98.91
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 98.9
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 98.9
TIGR00436 270 era GTP-binding protein Era. Era is an essential G 98.9
CHL00189 742 infB translation initiation factor 2; Provisional 98.89
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 98.86
PRK12297 424 obgE GTPase CgtA; Reviewed 98.85
KOG0077|consensus193 98.83
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 98.82
PRK04004 586 translation initiation factor IF-2; Validated 98.81
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 98.8
PRK12317 425 elongation factor 1-alpha; Reviewed 98.8
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 98.78
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 98.78
PRK05433 600 GTP-binding protein LepA; Provisional 98.77
PF04670232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 98.77
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 98.74
PRK00093 435 GTP-binding protein Der; Reviewed 98.74
cd01896233 DRG The developmentally regulated GTP-binding prot 98.73
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 98.71
cd04169 267 RF3 RF3 subfamily. Peptide chain release factor 3 98.7
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 98.69
PRK12296 500 obgE GTPase CgtA; Reviewed 98.65
PRK13351 687 elongation factor G; Reviewed 98.64
KOG3886|consensus 295 98.63
PRK10218 607 GTP-binding protein; Provisional 98.63
PF09439181 SRPRB: Signal recognition particle receptor beta s 98.62
PRK00089 292 era GTPase Era; Reviewed 98.62
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 98.61
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 98.6
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 98.59
PRK12298390 obgE GTPase CgtA; Reviewed 98.53
PRK04000 411 translation initiation factor IF-2 subunit gamma; 98.48
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 98.47
cd04170 268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 98.43
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 98.43
TIGR03680 406 eif2g_arch translation initiation factor 2 subunit 98.42
PRK00741 526 prfC peptide chain release factor 3; Provisional 98.42
cd00066317 G-alpha G protein alpha subunit. The alpha subunit 98.4
TIGR00485 394 EF-Tu translation elongation factor TU. This align 98.38
TIGR00503 527 prfC peptide chain release factor 3. This translat 98.36
smart00275342 G_alpha G protein alpha subunit. Subunit of G prot 98.36
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 98.28
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 98.23
TIGR00490 720 aEF-2 translation elongation factor aEF-2. This mo 98.22
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 98.16
PRK14845 1049 translation initiation factor IF-2; Provisional 98.15
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 98.12
cd01886 270 EF-G Elongation factor G (EF-G) subfamily. Translo 98.08
PLN00043 447 elongation factor 1-alpha; Provisional 98.06
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 98.05
PRK12736 394 elongation factor Tu; Reviewed 98.04
KOG0090|consensus238 98.03
PRK12735 396 elongation factor Tu; Reviewed 98.01
PLN03126 478 Elongation factor Tu; Provisional 97.93
PRK12740 668 elongation factor G; Reviewed 97.92
TIGR03597 360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 97.91
TIGR02034 406 CysN sulfate adenylyltransferase, large subunit. H 97.87
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 97.85
PRK05124 474 cysN sulfate adenylyltransferase subunit 1; Provis 97.84
KOG1707|consensus625 97.83
COG0486454 ThdF Predicted GTPase [General function prediction 97.81
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 97.72
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 97.71
PRK12289 352 GTPase RsgA; Reviewed 97.66
TIGR00991 313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 97.64
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 97.58
PLN03127 447 Elongation factor Tu; Provisional 97.58
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 97.56
PRK12739 691 elongation factor G; Reviewed 97.49
CHL00071 409 tufA elongation factor Tu 97.45
PRK00049 396 elongation factor Tu; Reviewed 97.43
PRK00098 298 GTPase RsgA; Reviewed 97.41
COG1160 444 Predicted GTPases [General function prediction onl 97.4
cd01854 287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 97.35
cd01899 318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 97.25
PRK12288 347 GTPase RsgA; Reviewed 97.13
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 97.11
COG1160 444 Predicted GTPases [General function prediction onl 97.09
KOG1191|consensus 531 97.06
PRK00007 693 elongation factor G; Reviewed 97.03
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 97.0
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 96.99
PRK13768253 GTPase; Provisional 96.96
COG1084346 Predicted GTPase [General function prediction only 96.92
KOG4273|consensus 418 96.88
PTZ00141 446 elongation factor 1- alpha; Provisional 96.84
KOG0705|consensus 749 96.83
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 96.7
COG1159 298 Era GTPase [General function prediction only] 96.63
PRK09866 741 hypothetical protein; Provisional 96.61
PRK09602 396 translation-associated GTPase; Reviewed 96.58
COG0218200 Predicted GTPase [General function prediction only 96.29
KOG1423|consensus 379 96.23
PF00503389 G-alpha: G-protein alpha subunit; InterPro: IPR001 96.1
COG0532 509 InfB Translation initiation factor 2 (IF-2; GTPase 96.09
PRK13796 365 GTPase YqeH; Provisional 96.08
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 96.07
KOG1145|consensus 683 96.07
PLN00116 843 translation elongation factor EF-2 subunit; Provis 96.07
PF0685858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); Inte 96.03
KOG0082|consensus354 95.98
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 95.97
TIGR00993 763 3a0901s04IAP86 chloroplast protein import componen 95.8
PTZ00416 836 elongation factor 2; Provisional 95.79
KOG1144|consensus 1064 95.63
PTZ00327 460 eukaryotic translation initiation factor 2 gamma s 95.57
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 95.56
PRK07560 731 elongation factor EF-2; Reviewed 95.53
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 95.52
KOG0462|consensus 650 95.48
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 95.42
COG0536369 Obg Predicted GTPase [General function prediction 95.36
COG2262411 HflX GTPases [General function prediction only] 95.34
TIGR03348 1169 VI_IcmF type VI secretion protein IcmF. Members of 95.2
PF05783 472 DLIC: Dynein light intermediate chain (DLIC); Inte 95.14
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 95.13
KOG1489|consensus366 94.49
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 94.49
KOG0468|consensus 971 94.39
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 94.12
COG3596 296 Predicted GTPase [General function prediction only 94.09
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 93.87
PF05049 376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 93.85
COG0480 697 FusA Translation elongation factors (GTPases) [Tra 93.77
KOG3905|consensus 473 93.56
cd03110179 Fer4_NifH_child This protein family's function is 93.33
COG0481 603 LepA Membrane GTPase LepA [Cell envelope biogenesi 93.25
COG1217 603 TypA Predicted membrane GTPase involved in stress 93.13
PF00735 281 Septin: Septin; InterPro: IPR000038 Septins consti 93.03
cd04178 172 Nucleostemin_like Nucleostemin-like. Nucleostemin 92.74
COG2895 431 CysN GTPases - Sulfate adenylate transferase subun 92.68
KOG0467|consensus 887 92.13
COG4108 528 PrfC Peptide chain release factor RF-3 [Translatio 92.06
KOG3887|consensus 347 91.86
COG5256 428 TEF1 Translation elongation factor EF-1alpha (GTPa 91.83
COG4917148 EutP Ethanolamine utilization protein [Amino acid 91.44
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 91.31
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 90.95
TIGR03596 276 GTPase_YlqF ribosome biogenesis GTP-binding protei 90.72
PRK01889 356 GTPase RsgA; Reviewed 90.2
COG0050 394 TufB GTPases - translation elongation factors [Tra 89.58
PRK09563 287 rbgA GTPase YlqF; Reviewed 89.4
cd02038139 FleN-like FleN is a member of the Fer4_NifH superf 88.35
COG1163 365 DRG Predicted GTPase [General function prediction 88.19
COG5257 415 GCD11 Translation initiation factor 2, gamma subun 88.04
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 86.97
smart00010124 small_GTPase Small GTPase of the Ras superfamily; 86.91
KOG1954|consensus 532 86.87
PRK09563287 rbgA GTPase YlqF; Reviewed 86.84
KOG3929|consensus 363 86.15
PF11111176 CENP-M: Centromere protein M (CENP-M); InterPro: I 85.7
PTZ00258 390 GTP-binding protein; Provisional 85.09
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 84.26
KOG1490|consensus 620 83.99
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 83.93
KOG0458|consensus 603 83.38
KOG1424|consensus 562 83.33
COG3523 1188 IcmF Type VI protein secretion system component Va 82.61
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 82.09
COG1161 322 Predicted GTPases [General function prediction onl 81.16
>KOG0084|consensus Back     alignment and domain information
Probab=100.00  E-value=2e-40  Score=248.58  Aligned_cols=136  Identities=24%  Similarity=0.400  Sum_probs=127.1

Q ss_pred             ccccCceeeEEE-EeCCCCc---eeEeee-ccCCCcccCcceeeeeEEEEEecCCCee----eeCCCchhchhhhhhhhc
Q psy15036         36 AAKEFSFNFGTQ-LGRRGIP---LLKHLK-YLGTGTHGKTVGIVFPAISVTYSIGPRY----FRFPLVSRFLSLTTGLYR  106 (179)
Q Consensus        36 ~~~~~~~~~Kiv-lG~~gvG---~~~~~~-~~~~~~~~~Ti~~~~~~k~v~~~~~~~i----wDt~G~e~~~~~~~~~~~  106 (179)
                      ++.+++|+|||| |||+|||   ++.++. +.|.+.|..|||++|..+++.++ |+.+    |||+|||||+++..+|||
T Consensus         2 ~~~~~dylFKiiliGds~VGKtCL~~Rf~~~~f~e~~~sTIGVDf~~rt~e~~-gk~iKlQIWDTAGQERFrtit~syYR   80 (205)
T KOG0084|consen    2 MNPEYDYLFKIILIGDSGVGKTCLLLRFKDDTFTESYISTIGVDFKIRTVELD-GKTIKLQIWDTAGQERFRTITSSYYR   80 (205)
T ss_pred             CCcccceEEEEEEECCCCcChhhhhhhhccCCcchhhcceeeeEEEEEEeeec-ceEEEEEeeeccccHHHhhhhHhhcc
Confidence            456899999998 9999999   555554 88999999999999999999999 9998    999999999999999999


Q ss_pred             CCcEEEEEEeCCChhhHHHHHHHHHHHHHHhCCccCccccceEEEEeeCCCcCCCCCCCHHHHHHHHhhhCC
Q psy15036        107 GTMGFLLIFDVTNENSFKDVEKWLLQIKVMDGALFTHFELQIVFMRGCLELLQRCREVVTPDQIMFGSTQSS  178 (179)
Q Consensus       107 ~~~~vilvyDit~~~Sf~~l~~w~~~i~~~~~~~~~~~~~~~iilvGnK~Dl~~~r~Vs~~e~~~~a~~~~~  178 (179)
                      +|||+|+|||+|+++||+++..|+.+++++...+      .|++|||||||+.++|.|+.++|++||.+...
T Consensus        81 ~ahGii~vyDiT~~~SF~~v~~Wi~Ei~~~~~~~------v~~lLVGNK~Dl~~~~~v~~~~a~~fa~~~~~  146 (205)
T KOG0084|consen   81 GAHGIIFVYDITKQESFNNVKRWIQEIDRYASEN------VPKLLVGNKCDLTEKRVVSTEEAQEFADELGI  146 (205)
T ss_pred             CCCeEEEEEEcccHHHhhhHHHHHHHhhhhccCC------CCeEEEeeccccHhheecCHHHHHHHHHhcCC
Confidence            9999999999999999999999999999999886      68899999999999999999999999998754



>KOG0098|consensus Back     alignment and domain information
>KOG0087|consensus Back     alignment and domain information
>KOG0078|consensus Back     alignment and domain information
>KOG0080|consensus Back     alignment and domain information
>KOG0092|consensus Back     alignment and domain information
>KOG0094|consensus Back     alignment and domain information
>KOG0079|consensus Back     alignment and domain information
>KOG0095|consensus Back     alignment and domain information
>KOG0086|consensus Back     alignment and domain information
>KOG0091|consensus Back     alignment and domain information
>KOG0093|consensus Back     alignment and domain information
>KOG0081|consensus Back     alignment and domain information
>KOG0088|consensus Back     alignment and domain information
>KOG0394|consensus Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>KOG0097|consensus Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>KOG0083|consensus Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>KOG0395|consensus Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>KOG0393|consensus Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>KOG4252|consensus Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>KOG0096|consensus Back     alignment and domain information
>KOG4423|consensus Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>KOG1673|consensus Back     alignment and domain information
>KOG0070|consensus Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>KOG0073|consensus Back     alignment and domain information
>KOG3883|consensus Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>KOG0071|consensus Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>KOG0075|consensus Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>smart00010 small_GTPase Small GTPase of the Ras superfamily; ill-defined subfamily Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>KOG0076|consensus Back     alignment and domain information
>KOG0074|consensus Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>KOG0072|consensus Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>KOG0077|consensus Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>KOG3886|consensus Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>cd00066 G-alpha G protein alpha subunit Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>smart00275 G_alpha G protein alpha subunit Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>KOG0090|consensus Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG1191|consensus Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG4273|consensus Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG1423|consensus Back     alignment and domain information
>PF00503 G-alpha: G-protein alpha subunit; InterPro: IPR001019 Guanine nucleotide binding proteins (G proteins) are membrane-associated, heterotrimeric proteins composed of three subunits: alpha (IPR001019 from INTERPRO), beta (IPR001632 from INTERPRO) and gamma (IPR001770 from INTERPRO) [] Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>KOG1145|consensus Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>PF06858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); InterPro: IPR010674 This domain represents a conserved region of approximately 60 residues in length within nucleolar GTP-binding protein 1 (NOG1) Back     alignment and domain information
>KOG0082|consensus Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>KOG1144|consensus Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>KOG0462|consensus Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>TIGR03348 VI_IcmF type VI secretion protein IcmF Back     alignment and domain information
>PF05783 DLIC: Dynein light intermediate chain (DLIC); InterPro: IPR022780 This entry consists of several eukaryotic dynein light intermediate chain proteins Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>KOG1489|consensus Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0468|consensus Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3905|consensus Back     alignment and domain information
>cd03110 Fer4_NifH_child This protein family's function is unkown Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0467|consensus Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3887|consensus Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>smart00010 small_GTPase Small GTPase of the Ras superfamily; ill-defined subfamily Back     alignment and domain information
>KOG1954|consensus Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>KOG3929|consensus Back     alignment and domain information
>PF11111 CENP-M: Centromere protein M (CENP-M); InterPro: IPR020987 The prime candidate for specifying centromere identity is the array of nucleosomes assembles associated with CENP-A [] Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>KOG1490|consensus Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>KOG0458|consensus Back     alignment and domain information
>KOG1424|consensus Back     alignment and domain information
>COG3523 IcmF Type VI protein secretion system component VasK [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query179
3tso_A178 Structure Of The Cancer Associated Rab25 Protein In 1e-08
2oil_A193 Crystal Structure Of Human Rab25 In Complex With Gd 2e-08
3dz8_A191 Crystal Structure Of Human Rab3b Gtpase Bound With 6e-08
3bc1_A195 Crystal Structure Of The Complex Rab27a-slp2a Lengt 8e-08
3rab_A169 Gppnhp-bound Rab3a At 2.0 A Resolution Length = 169 1e-07
3bfk_A181 Crystal Structure Of Plasmodium Falciparum Rab11a I 2e-07
2gf9_A189 Crystal Structure Of Human Rab3d In Complex With Gd 4e-07
1zbd_A203 Structural Basis Of Rab Effector Specificity: Cryst 5e-07
2fu5_C183 Structure Of Rab8 In Complex With Mss4 Length = 183 6e-07
3qbt_A174 Crystal Structure Of Ocrl1 540-678 In Complex With 6e-07
2f7s_A217 The Crystal Structure Of Human Rab27b Bound To Gdp 1e-06
2iez_A220 Crystal Structure Of Mouse Rab27b Bound To Gdp In M 2e-06
2if0_A200 Crystal Structure Of Mouse Rab27b Bound To Gdp In M 2e-06
3cph_A213 Crystal Structure Of Sec4 In Complex With Rab-Gdi L 3e-06
2eqb_A174 Crystal Structure Of The Rab Gtpase Sec4p, The Sec2 5e-06
2hv8_A172 Crystal Structure Of Gtp-Bound Rab11 In Complex Wit 1e-05
1oiw_A191 X-ray Structure Of The Small G Protein Rab11a In Co 1e-05
1g17_A170 Crystal Structure Of Sec4-Guanosine-5'-(Beta,Gamma) 1e-05
4fmb_B171 Vira-Rab1 Complex Structure Length = 171 2e-05
3tkl_A196 Crystal Structure Of The Gtp-Bound Rab1a In Complex 2e-05
1oiv_A191 X-Ray Structure Of The Small G Protein Rab11a In Co 2e-05
4fmc_B171 Espg-Rab1 Complex Length = 171 2e-05
4fmd_F164 Espg-Rab1 Complex Structure At 3.05 A Length = 164 2e-05
2wwx_A175 Crystal Structure Of The SidmDRRA(GEFGDF DOMAIN)-Ra 2e-05
3l0i_B199 Complex Structure Of Sidm/drra With The Wild Type R 2e-05
2fol_A191 Crystal Structure Of Human Rab1a In Complex With Gd 2e-05
3sfv_A181 Crystal Structure Of The Gdp-Bound Rab1a S25n Mutan 2e-05
1yzk_A184 Gppnhp Bound Rab11 Gtpase Length = 184 2e-05
2gzd_A173 Crystal Structure Of Rab11 In Complex With Rab11-Fi 3e-05
2d7c_A167 Crystal Structure Of Human Rab11 In Complex With Fi 3e-05
4fmc_F117 Espg-Rab1 Complex Length = 117 3e-05
2rhd_A175 Crystal Structure Of Cryptosporidium Parvum Small G 3e-05
2f9l_A199 3d Structure Of Inactive Human Rab11b Gtpase Length 3e-05
3jza_A175 Crystal Structure Of Human Rab1b In Complex With Th 4e-05
4i1o_A181 Crystal Structure Of The Legionella Pneumophila Gap 5e-05
2iey_A195 Crystal Structure Of Mouse Rab27b Bound To Gdp In H 5e-05
3tw8_B181 Gef Domain Of Dennd 1b In Complex With Rab Gtpase R 5e-05
2ocy_C170 Complex Of The Guanine Exchange Factor Sec2p And Th 5e-05
2zet_A203 Crystal Structure Of The Small Gtpase Rab27b Comple 6e-05
1yzn_A185 Gppnhp-Bound Ypt1p Gtpase Length = 185 9e-05
2bcg_Y206 Structure Of Doubly Prenylated Ypt1:gdi Complex Len 1e-04
1ukv_Y206 Structure Of Rabgdp-Dissociation Inhibitor In Compl 1e-04
1g16_A170 Crystal Structure Of Sec4-Gdp Length = 170 1e-04
2g6b_A180 Crystal Structure Of Human Rab26 In Complex With A 1e-04
1z0k_A172 Structure Of Gtp-Bound Rab4q67l Gtpase In Complex W 2e-04
4dkx_A216 Crystal Structure Of The Rab 6a'(Q72l) Length = 216 3e-04
2bmd_A186 High Resolution Structure Of Gdp-Bound Human Rab4a 3e-04
2efc_B181 Ara7-GdpATVPS9A Length = 181 3e-04
2il1_A192 Crystal Structure Of A Predicted Human Gtpase In Co 3e-04
1yu9_A175 Gppnhp-Bound Rab4a Length = 175 3e-04
3rwm_B185 Crystal Structure Of Ypt32 In Complex With Gppnhp L 6e-04
1yzt_A184 Gppnhp-Bound Rab21 Gtpase At 2.05 A Resolution Leng 6e-04
1yzq_A170 Gppnhp-Bound Rab6 Gtpase Length = 170 6e-04
1yzu_A170 Gppnhp-Bound Rab21 Gtpase At 2.50 A Resolution Leng 6e-04
1z08_A170 Gppnhp-Bound Rab21 Q53g Mutant Gtpase Length = 170 7e-04
>pdb|3TSO|A Chain A, Structure Of The Cancer Associated Rab25 Protein In Complex With Fip2 Length = 178 Back     alignment and structure

Iteration: 1

Score = 55.5 bits (132), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 34/111 (30%), Positives = 56/111 (50%), Gaps = 11/111 (9%) Query: 70 TVGIVFPAISV---TYSIGPRYFRFPLVSRFLSLTTGLYRGTMGFLLIFDVTNENSFKDV 126 T+G+ F +V T ++ + + + R+ ++T+ YRG +G LL+FD+T ++ V Sbjct: 42 TIGVEFSTRTVMLGTAAVKAQIWDTAGLERYRAITSAYYRGAVGALLVFDLTKHQTYAVV 101 Query: 127 EKWLLQIKVMDGALFTHFELQIVFMR-GCLELLQRCREVVTPDQIMFGSTQ 176 E+WL + L+ H E IV M G L + REV T + MF Sbjct: 102 ERWLKE-------LYDHAEATIVVMLVGNKSDLSQAREVPTEEARMFAENN 145
>pdb|2OIL|A Chain A, Crystal Structure Of Human Rab25 In Complex With Gdp Length = 193 Back     alignment and structure
>pdb|3DZ8|A Chain A, Crystal Structure Of Human Rab3b Gtpase Bound With Gdp Length = 191 Back     alignment and structure
>pdb|3BC1|A Chain A, Crystal Structure Of The Complex Rab27a-slp2a Length = 195 Back     alignment and structure
>pdb|3RAB|A Chain A, Gppnhp-bound Rab3a At 2.0 A Resolution Length = 169 Back     alignment and structure
>pdb|3BFK|A Chain A, Crystal Structure Of Plasmodium Falciparum Rab11a In Complex With Gdp Length = 181 Back     alignment and structure
>pdb|2GF9|A Chain A, Crystal Structure Of Human Rab3d In Complex With Gdp Length = 189 Back     alignment and structure
>pdb|1ZBD|A Chain A, Structural Basis Of Rab Effector Specificity: Crystal Structure Of The Small G Protein Rab3a Complexed With The Effector Domain Of Rabphilin-3a Length = 203 Back     alignment and structure
>pdb|2FU5|C Chain C, Structure Of Rab8 In Complex With Mss4 Length = 183 Back     alignment and structure
>pdb|3QBT|A Chain A, Crystal Structure Of Ocrl1 540-678 In Complex With Rab8a:gppnhp Length = 174 Back     alignment and structure
>pdb|2F7S|A Chain A, The Crystal Structure Of Human Rab27b Bound To Gdp Length = 217 Back     alignment and structure
>pdb|2IEZ|A Chain A, Crystal Structure Of Mouse Rab27b Bound To Gdp In Monoclinic Space Group Length = 220 Back     alignment and structure
>pdb|2IF0|A Chain A, Crystal Structure Of Mouse Rab27b Bound To Gdp In Monoclinic Space Group Length = 200 Back     alignment and structure
>pdb|3CPH|A Chain A, Crystal Structure Of Sec4 In Complex With Rab-Gdi Length = 213 Back     alignment and structure
>pdb|2EQB|A Chain A, Crystal Structure Of The Rab Gtpase Sec4p, The Sec2p Gef Domain, And Phosphate Complex Length = 174 Back     alignment and structure
>pdb|2HV8|A Chain A, Crystal Structure Of Gtp-Bound Rab11 In Complex With Fip3 Length = 172 Back     alignment and structure
>pdb|1OIW|A Chain A, X-ray Structure Of The Small G Protein Rab11a In Complex With Gtpgammas Length = 191 Back     alignment and structure
>pdb|1G17|A Chain A, Crystal Structure Of Sec4-Guanosine-5'-(Beta,Gamma)- Imidotriphosphate Length = 170 Back     alignment and structure
>pdb|4FMB|B Chain B, Vira-Rab1 Complex Structure Length = 171 Back     alignment and structure
>pdb|3TKL|A Chain A, Crystal Structure Of The Gtp-Bound Rab1a In Complex With The Coiled- Coil Domain Of Lida From Legionella Pneumophila Length = 196 Back     alignment and structure
>pdb|1OIV|A Chain A, X-Ray Structure Of The Small G Protein Rab11a In Complex With Gdp Length = 191 Back     alignment and structure
>pdb|4FMC|B Chain B, Espg-Rab1 Complex Length = 171 Back     alignment and structure
>pdb|4FMD|F Chain F, Espg-Rab1 Complex Structure At 3.05 A Length = 164 Back     alignment and structure
>pdb|2WWX|A Chain A, Crystal Structure Of The SidmDRRA(GEFGDF DOMAIN)-Rab1 (Gtpase Domain) Complex Length = 175 Back     alignment and structure
>pdb|3L0I|B Chain B, Complex Structure Of Sidm/drra With The Wild Type Rab1 Length = 199 Back     alignment and structure
>pdb|2FOL|A Chain A, Crystal Structure Of Human Rab1a In Complex With Gdp Length = 191 Back     alignment and structure
>pdb|3SFV|A Chain A, Crystal Structure Of The Gdp-Bound Rab1a S25n Mutant In Complex With The Coiled-Coil Domain Of Lida From Legionella Pneumophila Length = 181 Back     alignment and structure
>pdb|1YZK|A Chain A, Gppnhp Bound Rab11 Gtpase Length = 184 Back     alignment and structure
>pdb|2GZD|A Chain A, Crystal Structure Of Rab11 In Complex With Rab11-Fip2 Length = 173 Back     alignment and structure
>pdb|2D7C|A Chain A, Crystal Structure Of Human Rab11 In Complex With Fip3 Rab- Binding Domain Length = 167 Back     alignment and structure
>pdb|4FMC|F Chain F, Espg-Rab1 Complex Length = 117 Back     alignment and structure
>pdb|2RHD|A Chain A, Crystal Structure Of Cryptosporidium Parvum Small Gtpase Rab1a Length = 175 Back     alignment and structure
>pdb|2F9L|A Chain A, 3d Structure Of Inactive Human Rab11b Gtpase Length = 199 Back     alignment and structure
>pdb|3JZA|A Chain A, Crystal Structure Of Human Rab1b In Complex With The Gef Domain Of DrraSIDM FROM LEGIONELLA PNEUMOPHILA Length = 175 Back     alignment and structure
>pdb|4I1O|A Chain A, Crystal Structure Of The Legionella Pneumophila Gap Domain Of Lepb In Complex With Rab1b Bound To Gdp And Bef3 Length = 181 Back     alignment and structure
>pdb|2IEY|A Chain A, Crystal Structure Of Mouse Rab27b Bound To Gdp In Hexagonal Space Group Length = 195 Back     alignment and structure
>pdb|3TW8|B Chain B, Gef Domain Of Dennd 1b In Complex With Rab Gtpase Rab35 Length = 181 Back     alignment and structure
>pdb|2OCY|C Chain C, Complex Of The Guanine Exchange Factor Sec2p And The Rab Gtpase Sec4p Length = 170 Back     alignment and structure
>pdb|2ZET|A Chain A, Crystal Structure Of The Small Gtpase Rab27b Complexed With The Slp Homology Domain Of Slac2-AMELANOPHILIN Length = 203 Back     alignment and structure
>pdb|1YZN|A Chain A, Gppnhp-Bound Ypt1p Gtpase Length = 185 Back     alignment and structure
>pdb|2BCG|Y Chain Y, Structure Of Doubly Prenylated Ypt1:gdi Complex Length = 206 Back     alignment and structure
>pdb|1UKV|Y Chain Y, Structure Of Rabgdp-Dissociation Inhibitor In Complex With Prenylated Ypt1 Gtpase Length = 206 Back     alignment and structure
>pdb|1G16|A Chain A, Crystal Structure Of Sec4-Gdp Length = 170 Back     alignment and structure
>pdb|2G6B|A Chain A, Crystal Structure Of Human Rab26 In Complex With A Gtp Analogue Length = 180 Back     alignment and structure
>pdb|1Z0K|A Chain A, Structure Of Gtp-Bound Rab4q67l Gtpase In Complex With The Central Rab Binding Domain Of Rabenosyn-5 Length = 172 Back     alignment and structure
>pdb|4DKX|A Chain A, Crystal Structure Of The Rab 6a'(Q72l) Length = 216 Back     alignment and structure
>pdb|2BMD|A Chain A, High Resolution Structure Of Gdp-Bound Human Rab4a Length = 186 Back     alignment and structure
>pdb|2EFC|B Chain B, Ara7-GdpATVPS9A Length = 181 Back     alignment and structure
>pdb|2IL1|A Chain A, Crystal Structure Of A Predicted Human Gtpase In Complex With Gdp Length = 192 Back     alignment and structure
>pdb|1YU9|A Chain A, Gppnhp-Bound Rab4a Length = 175 Back     alignment and structure
>pdb|3RWM|B Chain B, Crystal Structure Of Ypt32 In Complex With Gppnhp Length = 185 Back     alignment and structure
>pdb|1YZT|A Chain A, Gppnhp-Bound Rab21 Gtpase At 2.05 A Resolution Length = 184 Back     alignment and structure
>pdb|1YZQ|A Chain A, Gppnhp-Bound Rab6 Gtpase Length = 170 Back     alignment and structure
>pdb|1YZU|A Chain A, Gppnhp-Bound Rab21 Gtpase At 2.50 A Resolution Length = 170 Back     alignment and structure
>pdb|1Z08|A Chain A, Gppnhp-Bound Rab21 Q53g Mutant Gtpase Length = 170 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query179
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 8e-13
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 9e-13
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 5e-12
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 6e-12
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 6e-12
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 7e-12
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 7e-12
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 7e-12
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 8e-12
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 9e-12
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 1e-11
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 1e-11
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 2e-11
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 2e-11
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 2e-11
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 2e-11
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 2e-11
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 3e-11
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 3e-11
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 4e-11
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 5e-11
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 6e-11
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 6e-11
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 6e-11
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 6e-11
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 7e-11
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 9e-11
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 1e-10
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 1e-10
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 1e-10
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 1e-10
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 1e-10
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 2e-10
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 2e-10
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 3e-10
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 4e-10
3bbp_A211 RAB-6, RAS-related protein RAB-6A; golgi complex, 6e-10
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 9e-10
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 1e-09
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 1e-09
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 1e-09
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 4e-09
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 5e-09
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 1e-08
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 1e-08
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 1e-08
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 1e-08
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 1e-08
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 1e-08
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 1e-08
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 2e-08
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 2e-08
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 2e-08
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 2e-08
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 2e-08
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 2e-08
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 3e-08
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 3e-08
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 4e-08
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 4e-08
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 1e-07
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 1e-07
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 1e-07
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 2e-07
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 3e-07
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 5e-07
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 7e-07
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 3e-06
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 2e-05
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 4e-04
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Length = 195 Back     alignment and structure
 Score = 62.6 bits (153), Expect = 8e-13
 Identities = 22/39 (56%), Positives = 29/39 (74%)

Query: 96  RFLSLTTGLYRGTMGFLLIFDVTNENSFKDVEKWLLQIK 134
           RF SLTT  +R  MGFLL+FD+TNE SF +V  W+ Q++
Sbjct: 82  RFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQ 120


>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Length = 217 Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Length = 189 Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Length = 183 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Length = 203 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Length = 182 Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} Length = 191 Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Length = 170 Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Length = 207 Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 180 Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Length = 181 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 213 Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Length = 192 Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Length = 178 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Length = 206 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Length = 177 Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Length = 199 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Length = 199 Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Length = 195 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Length = 196 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Length = 201 Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Length = 191 Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Length = 208 Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 201 Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Length = 168 Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 1qg4_A* 3ea5_A* 1qg2_A* 1byu_A* 3ran_A* 3gjx_C* ... Length = 221 Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Length = 218 Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Length = 193 Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Length = 200 Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Length = 199 Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Length = 186 Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Length = 223 Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Length = 179 Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Length = 208 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Length = 191 Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Length = 170 Back     alignment and structure
>3bbp_A RAB-6, RAS-related protein RAB-6A; golgi complex, GRIP domain, RAB GTPase, ARL GTPase, golgin, RAB effector, clAsp protein; HET: GTP; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Length = 189 Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Length = 179 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Length = 192 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Length = 170 Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Length = 195 Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Length = 170 Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Length = 181 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Length = 181 Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Length = 187 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} Length = 169 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Length = 190 Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Length = 206 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Length = 166 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Length = 183 Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Length = 189 Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Length = 166 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Length = 168 Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* Length = 181 Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Length = 167 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Length = 172 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 199 Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Length = 167 Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} Length = 184 Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Length = 184 Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Length = 178 Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Length = 211 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Length = 192 Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 170 Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Length = 175 Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 196 Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Length = 187 Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* Length = 194 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query179
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 99.97
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 99.93
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 99.92
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 99.92
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 99.91
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 99.91
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 99.91
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 99.91
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 99.91
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 99.91
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 99.91
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 99.91
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 99.91
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 99.91
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 99.91
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 99.91
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 99.91
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 99.9
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 99.9
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 99.9
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 99.9
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 99.9
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 99.9
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 99.9
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 99.9
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 99.9
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 99.9
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 99.9
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 99.9
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 99.9
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 99.9
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.89
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 99.89
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 99.89
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 99.89
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.89
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 99.89
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 99.89
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 99.89
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 99.89
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 99.89
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 99.89
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 99.89
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 99.88
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 99.88
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 99.88
3t1o_A198 Gliding protein MGLA; G domain containing protein, 99.88
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 99.88
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 99.88
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.88
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 99.88
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 99.88
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 99.87
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 99.87
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 99.87
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 99.87
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.87
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 99.87
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 99.87
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 99.87
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 99.87
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.87
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 99.86
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.86
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 99.86
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 99.86
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.86
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 99.86
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.86
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 99.86
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 99.85
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 99.85
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 99.85
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 99.85
3r7w_B 331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 99.85
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.85
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 99.85
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 99.85
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.85
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 99.84
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 99.84
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 99.84
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 99.84
3llu_A196 RAS-related GTP-binding protein C; structural geno 99.83
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 99.83
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.83
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 99.83
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 99.83
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.82
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.82
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.81
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.81
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 99.81
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.8
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.8
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 99.8
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.79
3r7w_A 307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 99.79
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 99.79
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.66
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 99.78
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 99.78
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 99.76
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.73
1nrj_B218 SR-beta, signal recognition particle receptor beta 99.72
2fh5_B214 SR-beta, signal recognition particle receptor beta 99.71
3o47_A329 ADP-ribosylation factor GTPase-activating protein 99.7
2wji_A165 Ferrous iron transport protein B homolog; membrane 99.69
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 99.66
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 99.65
2ged_A193 SR-beta, signal recognition particle receptor beta 99.65
1u0l_A 301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 99.64
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 99.63
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 99.62
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 99.62
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 99.62
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 99.61
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.6
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 99.59
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 99.59
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 99.58
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.57
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 99.56
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.55
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.52
3a1s_A 258 Iron(II) transport protein B; FEOB, iron transport 99.48
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.44
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 99.43
3lxx_A239 GTPase IMAP family member 4; structural genomics c 99.41
3b1v_A 272 Ferrous iron uptake transporter protein B; G prote 99.41
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.41
3iby_A 256 Ferrous iron transport protein B; G protein, G dom 99.41
3k53_A 271 Ferrous iron transport protein B; GTPase fold, hel 99.4
3i8s_A 274 Ferrous iron transport protein B; GTPase, GPCR, ir 99.39
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 99.39
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 99.38
3iev_A 308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.36
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 99.35
1wf3_A 301 GTP-binding protein; GTPase, riken structural geno 99.28
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 99.27
2qag_A 361 Septin-2, protein NEDD5; cell cycle, cell division 99.27
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 99.26
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.24
1jny_A 435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 99.24
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 99.24
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 99.23
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.23
1xzp_A 482 Probable tRNA modification GTPase TRME; GTP-bindin 99.21
3j2k_7 439 ERF3, eukaryotic polypeptide chain release factor 99.21
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.2
3lxw_A247 GTPase IMAP family member 1; immunity, structural 99.16
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 99.13
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.13
1s0u_A 408 EIF-2-gamma, translation initiation factor 2 gamma 99.12
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 99.11
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 99.11
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 99.1
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 99.1
1zun_B 434 Sulfate adenylate transferase, subunit 1/adenylyls 99.08
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.07
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 99.05
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 99.04
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 99.04
2elf_A 370 Protein translation elongation factor 1A; tRNA, py 99.03
2c78_A 405 Elongation factor TU-A; hydrolase, GTPase, transla 99.02
3sjy_A 403 Translation initiation factor 2 subunit gamma; zin 99.02
1d2e_A 397 Elongation factor TU (EF-TU); G-protein, beta-barr 99.02
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 99.0
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 98.98
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 98.98
1wb1_A 482 Translation elongation factor SELB; selenocysteine 98.97
1kk1_A 410 EIF2gamma; initiation of translation; HET: GNP; 1. 98.96
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 98.95
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 98.95
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 98.94
2yv5_A 302 YJEQ protein; hydrolase, GTPase, permutation, stru 98.94
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 98.92
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 98.87
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 98.87
3t34_A 360 Dynamin-related protein 1A, linker, dynamin-relat 98.81
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 98.8
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 98.8
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 98.78
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 98.78
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 98.76
2qnr_A 301 Septin-2, protein NEDD5; structural genomics conso 98.75
3mca_A 592 HBS1, elongation factor 1 alpha-like protein; prot 98.73
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 98.7
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 98.67
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 98.67
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 98.57
2hf9_A226 Probable hydrogenase nickel incorporation protein 98.41
1jal_A 363 YCHF protein; nucleotide-binding fold, structural 98.34
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 98.33
1wxq_A 397 GTP-binding protein; structural genomics, riken st 98.31
2x2e_A 353 Dynamin-1; nitration, hydrolase, membrane fission, 98.3
3h2y_A 368 GTPase family protein; GTP-binding protein YQEH, p 98.21
1udx_A 416 The GTP-binding protein OBG; TGS domain, riken str 98.2
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 98.09
3ec1_A 369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 97.9
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 97.73
2dby_A 368 GTP-binding protein; GDP, structural genomics, NPP 97.72
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 97.55
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 96.8
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 96.67
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 96.65
1puj_A 282 YLQF, conserved hypothetical protein YLQF; structu 96.4
4a9a_A 376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 96.08
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 96.04
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 96.04
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 95.41
3p32_A 355 Probable GTPase RV1496/MT1543; structural genomics 95.08
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 94.98
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 93.76
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 93.62
1t9h_A 307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 92.29
3cnl_A262 YLQF, putative uncharacterized protein; circular p 91.79
3cnl_A 262 YLQF, putative uncharacterized protein; circular p 91.67
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 87.05
2rcn_A 358 Probable GTPase ENGC; YJEQ, circularly permuted, G 86.56
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 85.13
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 84.38
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 83.87
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
Probab=99.97  E-value=6.3e-32  Score=209.59  Aligned_cols=130  Identities=22%  Similarity=0.305  Sum_probs=109.3

Q ss_pred             eeeEEE-EeCCCCc---eeEeee-ccCCCcccCcceeeeeEEEEEecCCCee----eeCCCchhchhhhhhhhcCCcEEE
Q psy15036         42 FNFGTQ-LGRRGIP---LLKHLK-YLGTGTHGKTVGIVFPAISVTYSIGPRY----FRFPLVSRFLSLTTGLYRGTMGFL  112 (179)
Q Consensus        42 ~~~Kiv-lG~~gvG---~~~~~~-~~~~~~~~~Ti~~~~~~k~v~~~~~~~i----wDt~G~e~~~~~~~~~~~~~~~vi  112 (179)
                      ..|||+ ||++|||   ++.++. +.|.+.|.||+|.++..+.+.++ +..+    |||+|+++|+.+++.||+++++++
T Consensus        12 k~~KivlvGd~~VGKTsLi~r~~~~~f~~~~~~Tig~d~~~k~~~~~-~~~v~l~iwDtaGqe~~~~l~~~~~~~a~~~i   90 (216)
T 4dkx_A           12 RKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLE-DRTIRLQLWDTAGLERFRSLIPSYIRDSAAAV   90 (216)
T ss_dssp             -CEEEEEECSTTSSHHHHHHHHHHSCCC----------CEEEEEECS-SCEEEEEEECCSCTTTCGGGHHHHHTTCSEEE
T ss_pred             CcEEEEEECcCCcCHHHHHHHHHhCCCCCCcCCccceEEEEEEEEec-ceEEEEEEEECCCchhhhhHHHHHhccccEEE
Confidence            468998 9999999   555554 77899999999999999999888 8877    999999999999999999999999


Q ss_pred             EEEeCCChhhHHHHHHHHHHHHHHhCCccCccccceEEEEeeCCCcCCCCCCCHHHHHHHHhhhCC
Q psy15036        113 LIFDVTNENSFKDVEKWLLQIKVMDGALFTHFELQIVFMRGCLELLQRCREVVTPDQIMFGSTQSS  178 (179)
Q Consensus       113 lvyDit~~~Sf~~l~~w~~~i~~~~~~~~~~~~~~~iilvGnK~Dl~~~r~Vs~~e~~~~a~~~~~  178 (179)
                      +|||+++++||+++..|+..+++....+      +|++|||||+||.++|+|+.+|+++||++.+.
T Consensus        91 lv~di~~~~Sf~~i~~~~~~i~~~~~~~------~piilVgNK~Dl~~~r~V~~~e~~~~a~~~~~  150 (216)
T 4dkx_A           91 VVYDITNVNSFQQTTKWIDDVRTERGSD------VIIMLVGNKTDLADKRQVSIEEGERKAKELNV  150 (216)
T ss_dssp             EEEETTCHHHHHTHHHHHHHHHHHHTTS------SEEEEEEECTTCGGGCCSCHHHHHHHHHHHTC
T ss_pred             EEeecchhHHHHHHHHHHHHHHHhcCCC------CeEEEEeeccchHhcCcccHHHHhhHHHHhCC
Confidence            9999999999999999999999887766      79999999999999999999999999998753



>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query179
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.95
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 99.95
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 99.95
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.94
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 99.94
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 99.94
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 99.94
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 99.94
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.94
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 99.94
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 99.94
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 99.94
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 99.93
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 99.93
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.93
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 99.93
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 99.93
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.93
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 99.93
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 99.92
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 99.92
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 99.9
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.9
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 99.89
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.88
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 99.87
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.8
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.8
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.79
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.78
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.76
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.7
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 99.64
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.63
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 99.63
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.58
d2fh5b1207 Signal recognition particle receptor beta-subunit 99.53
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.49
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.45
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.37
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.32
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 99.29
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.25
d1nrjb_209 Signal recognition particle receptor beta-subunit 99.21
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 98.69
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 98.66
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 98.63
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 98.59
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 98.58
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 98.1
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 97.98
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 97.97
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 97.78
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 97.78
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 97.75
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 97.72
d2dy1a2 267 Elongation factor G (EF-G), N-terminal (G) domain 97.38
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 97.34
d2bv3a2 276 Elongation factor G (EF-G), N-terminal (G) domain 97.27
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 97.25
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 97.21
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 96.98
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 96.84
d1n0ua2 341 Elongation factor 2 (eEF-2), N-terminal (G) domain 96.76
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 96.7
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 96.61
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 96.5
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 96.01
d1puja_ 273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 93.74
d1u0la2 225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 91.51
d1t9ha2 231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 88.38
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab21
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.96  E-value=5e-29  Score=183.27  Aligned_cols=131  Identities=23%  Similarity=0.375  Sum_probs=111.5

Q ss_pred             ceeeEEE-EeCCCCc---eeEeee-ccCCCcccCcceeeeeEEEEEecCCCee----eeCCCchhchhhhhhhhcCCcEE
Q psy15036         41 SFNFGTQ-LGRRGIP---LLKHLK-YLGTGTHGKTVGIVFPAISVTYSIGPRY----FRFPLVSRFLSLTTGLYRGTMGF  111 (179)
Q Consensus        41 ~~~~Kiv-lG~~gvG---~~~~~~-~~~~~~~~~Ti~~~~~~k~v~~~~~~~i----wDt~G~e~~~~~~~~~~~~~~~v  111 (179)
                      +|.|||+ +|++|||   ++.++. +.|.+.+.||++.++..+.+..+ +..+    ||++|+++++.+++.|+++++++
T Consensus         1 ~y~fKivlvG~~~vGKTsLi~r~~~~~f~~~~~~t~~~~~~~~~~~~~-~~~~~~~~~d~~g~~~~~~~~~~~~~~~~~~   79 (167)
T d1z08a1           1 AYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLGASFLTKKLNIG-GKRVNLAIWDTAGQERFHALGPIYYRDSNGA   79 (167)
T ss_dssp             CEEEEEEEECCTTSCHHHHHHHHHHCCCCSSCCCCCSCEEEEEEEESS-SCEEEEEEEECCCC-------CCSSTTCSEE
T ss_pred             CceEEEEEECCCCcCHHHHHHHHHhCCCCcccccccccchheeeeccC-CccceeeeeccCCcceecccchhhccCCcee
Confidence            4899998 9999999   666555 77899999999999888888888 7776    99999999999999999999999


Q ss_pred             EEEEeCCChhhHHHHHHHHHHHHHHhCCccCccccceEEEEeeCCCcCCCCCCCHHHHHHHHhhhCC
Q psy15036        112 LLIFDVTNENSFKDVEKWLLQIKVMDGALFTHFELQIVFMRGCLELLQRCREVVTPDQIMFGSTQSS  178 (179)
Q Consensus       112 ilvyDit~~~Sf~~l~~w~~~i~~~~~~~~~~~~~~~iilvGnK~Dl~~~r~Vs~~e~~~~a~~~~~  178 (179)
                      |+|||+++++||+++..|++.+.......      +|++|||||+|+.++|+|+.+|++++|++++.
T Consensus        80 i~v~d~~~~~Sf~~~~~~~~~~~~~~~~~------~~~ilvgnK~Dl~~~~~v~~~e~~~~a~~~~~  140 (167)
T d1z08a1          80 ILVYDITDEDSFQKVKNWVKELRKMLGNE------ICLCIVGNKIDLEKERHVSIQEAESYAESVGA  140 (167)
T ss_dssp             EEEEETTCHHHHHHHHHHHHHHHHHHGGG------SEEEEEEECGGGGGGCCSCHHHHHHHHHHTTC
T ss_pred             EEEEeCCchhHHHhhhhhhhhcccccccc------cceeeeccccccccccccchHHHHHHHHHcCC
Confidence            99999999999999999999988776655      78899999999999999999999999998753



>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure