Psyllid ID: psy15151


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-
MSGPATATLEDSSIWEGEESLGDDILRMSTDDINSRTRLLDNEIKIMKSEVMRISHELQAQNEKIRENTEKIKVNKNLPYLVSNVIELLDVDPQDTEEDGAVVDLDAQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEVDERPTEQYSDIGGLDKQIQELIEAVVLPMTHKEKFVNLGIQPPKGVLLYGPPGTGKTLLARACAAQTKSTFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFSSTADIKVIAATNRVDILDPALLRSGRLDRKIEFPHPNEEARARIMQIHSRKMNVSPDVNYEELSRSTDDFNGAQCKAVCVEAGMIALRRGAAIVTHEDFMDAIMEVQAKKKANLNYYA
ccccccccccccccccccccccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccccccHHHHHHccccEEEEEcccccEEEEEccccccccccccccEEEEEcccEEEEEccccccccccccEEEccccccccccccccHHHHHHHHHHHHcccccHHHHHHcccccccEEEEEcccccHHHHHHHHHHHHcccEEEEEEHHHHHHHHHccHHHHHHHHHHHHHHccccEEEEEcccccccccccccccccHHHHHHHHHHHHHcccccccccEEEEEEccccccccccccccccccEEEccccccHHHHHHHHHHHcccccccccccHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccccc
cccccccccccHHHcccHHHccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEccccHHHHcccccEEccHcccccEEEEEEccccEEEEEEEEcccHHHcccccEEEEEcccEEEEEcccccccccEEEEEEcccccccHcHcccHHHHHHHHHHHHccccccHHHHHHHccccccEEEEEcccccHHHHHHHHHHHHcccEEHHEHHHHHHHHHHcccHHHHHHHHHHHHHccccEEEEEcHHHEccEcccccccccHHHHHHHHHHHHHHccccccccEEEEEEEcccccccHHHccccccccEEEcccccHHHHHHHHHHHHHcccccccccHHHHHHccccccHHHHHHHHHHHHHHHHHccccEEcHHHHHHHHHHHHHHHHHcccEcc
msgpatatledssiwegeeslgddilRMSTDDINSRTRLLDNEIKIMKSEVMRISHELQAQNEKIRENTEkikvnknlpyLVSNVIElldvdpqdteedgavvdldaqrkgkcaviktstrqtyflpviglvdaeklkpgdlvgvnkdSYLILETLPAEYDARVKamevderpteqysdiggLDKQIQELIEAVVlpmthkekfvnlgiqppkgvllygppgtgktLLARACAAQTKSTFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDEldaigtkrfdsekagdREVQRTMLELLNQldgfsstaDIKVIAatnrvdildpallrsgrldrkiefphpnEEARARIMQIHSrkmnvspdvnyeelsrstddfngaQCKAVCVEAGMIALRRGAAIVTHEDFMDAIMEVQAKKKANLNYYA
msgpatatledssiwegEESLGDDILRMSTDDINSRTRLLDNEIKIMKSEVMRISHElqaqnekirentekikvnknlpYLVSNVIELLDVDPQDTEEDgavvdldaqrkgkcaviktstrqtyflPVIGLVdaeklkpgdlvgvnkdsyLILETLPAEYDARVKAMEVderpteqysdigglDKQIQELIEAVVLPMTHKEKFVNLGIQPPKGVLLYGPPGTGKTLLARACAAQTKSTFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFSSTADIKVIaatnrvdildpallrsgrldrkiefphpneeARARIMQIHSRKMNVSPDVNYEELSRSTDDFNGAQCKAVCVEAGMIALRRGAAIVTHEDFMDAIMEVQAKKKANLNYYA
MSGPATATLEDSSIWEGEESLGDDILRMSTDDINSRTRLLDNEIKIMKSEVMRISHELQAQNEKIRENTEKIKVNKNLPYLVSNVIELLDVDPQDTEEDGAVVDLDAQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEVDERPTEQYSDIGGLDKQIQELIEAVVLPMTHKEKFVNLGIQPPKGVLLYGPPGTGKTLLARACAAQTKSTFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFSSTADIKVIAATNRVDILDPALLRSGRLDRKIEFPHPNEEARARIMQIHSRKMNVSPDVNYEELSRSTDDFNGAQCKAVCVEAGMIALRRGAAIVTHEDFMDAIMEVQAKKKANLNYYA
*******************************************IKI************************KIKVNKNLPYLVSNVIELLDVDP*****DGAVVDLDAQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEV*******YSDIGGLDKQIQELIEAVVLPMTHKEKFVNLGIQPPKGVLLYGPPGTGKTLLARACAAQTKSTFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRF*********VQRTMLELLNQLDGFSSTADIKVIAATNRVDILDPALLRSGRL*****************************************DFNGAQCKAVCVEAGMIALRRGAAIVTHEDFMDAIMEVQ***********
*******************************DINSRTRLLDNEIKIMKSEVMR**************************YLVSNVIELLDVDPQDTEEDGAVVDLDAQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEVDERPTEQYSDIGGLDKQIQELIEAVVLPMTHKEKFVNLGIQPPKGVLLYGPPGTGKTLLARACAAQTKSTFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDELDAIG***************RTMLELLNQLDGFSSTADIKVIAATNRVDILDPALLRSGRLDRKIEFPHPNEEARARIMQIHSRKMNVSPDVNYEELSRSTDDFNGAQCKAVCVEAGMIALRRGAAIVTHEDFMDAIM***********YY*
***********SSIWEGEESLGDDILRMSTDDINSRTRLLDNEIKIMKSEVMRISHELQAQNEKIRENTEKIKVNKNLPYLVSNVIELLDVDPQDTEEDGAVVDLDAQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEVDERPTEQYSDIGGLDKQIQELIEAVVLPMTHKEKFVNLGIQPPKGVLLYGPPGTGKTLLARACAAQTKSTFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFSSTADIKVIAATNRVDILDPALLRSGRLDRKIEFPHPNEEARARIMQIHSRKMNVSPDVNYEELSRSTDDFNGAQCKAVCVEAGMIALRRGAAIVTHEDFMDAIMEVQAKKKANLNYYA
************S*WEGEESLGDDILRMSTDDINSRTRLLDNEIKIMKSEVMRISHELQAQNEKIRENTEKIKVNKNLPYLVSNVIELLDVDPQDTEEDGAVVDLDAQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEVDERPTEQYSDIGGLDKQIQELIEAVVLPMTHKEKFVNLGIQPPKGVLLYGPPGTGKTLLARACAAQTKSTFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFSSTADIKVIAATNRVDILDPALLRSGRLDRKIEFPHPNEEARARIMQIHSRKMNVSPDVNYEELSRSTDDFNGAQCKAVCVEAGMIALRRGAAIVTHEDFMDAIMEVQAKKKANLNYYA
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGPATATLEDSSIWEGEESLGDDILRMSTDDINSRTRLLDNEIKIMKSEVMRISHELQAQNEKIRENTEKIKVNKNLPYLVSNVIELLDVDPQDTEEDGAVVDLDAQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEVDERPTEQYSDIGGLDKQIQELIEAVVLPMTHKEKFVNLGIQPPKGVLLYGPPGTGKTLLARACAAQTKSTFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFSSTADIKVIAATNRVDILDPALLRSGRLDRKIEFPHPNEEARARIMQIHSRKMNVSPDVNYEELSRSTDDFNGAQCKAVCVEAGMIALRRGAAIVTHEDFMDAIMEVQAKKKANLNYYA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query431 2.2.26 [Sep-21-2011]
O88685442 26S protease regulatory s yes N/A 0.993 0.968 0.848 0.0
Q63569439 26S protease regulatory s yes N/A 0.993 0.974 0.848 0.0
P17980439 26S protease regulatory s yes N/A 1.0 0.981 0.842 0.0
O42586404 26S protease regulatory s N/A N/A 0.937 1.0 0.883 0.0
O42587405 26S protease regulatory s N/A N/A 0.911 0.970 0.850 0.0
Q9SEI2424 26S protease regulatory s yes N/A 0.979 0.995 0.761 0.0
P46465429 26S protease regulatory s yes N/A 0.937 0.941 0.790 0.0
O23894424 26S protease regulatory s N/A N/A 0.979 0.995 0.759 0.0
O04019423 26S protease regulatory s no N/A 0.976 0.995 0.757 0.0
P54776423 26S protease regulatory s N/A N/A 0.976 0.995 0.754 0.0
>sp|O88685|PRS6A_MOUSE 26S protease regulatory subunit 6A OS=Mus musculus GN=Psmc3 PE=1 SV=2 Back     alignment and function desciption
 Score =  761 bits (1966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/430 (84%), Positives = 398/430 (92%), Gaps = 2/430 (0%)

Query: 4   PATATLEDSSIWEGEE--SLGDDILRMSTDDINSRTRLLDNEIKIMKSEVMRISHELQAQ 61
           P T   + +++W+  E   +G+++L+MST++I  RTRLLD+EIKIMKSEV+R++HELQA 
Sbjct: 13  PVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIVQRTRLLDSEIKIMKSEVLRVTHELQAM 72

Query: 62  NEKIRENTEKIKVNKNLPYLVSNVIELLDVDPQDTEEDGAVVDLDAQRKGKCAVIKTSTR 121
            +KI+EN+EKIKVNK LPYLVSNVIELLDVDP D EEDGA +DLD+QRKGKCAVIKTSTR
Sbjct: 73  KDKIKENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGKCAVIKTSTR 132

Query: 122 QTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEVDERPTEQYSDIG 181
           QTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLP EYD+RVKAMEVDERPTEQYSDIG
Sbjct: 133 QTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDERPTEQYSDIG 192

Query: 182 GLDKQIQELIEAVVLPMTHKEKFVNLGIQPPKGVLLYGPPGTGKTLLARACAAQTKSTFL 241
           GLDKQIQEL+EA+VLPM HKEKF NLGIQPPKGVL+YGPPGTGKTLLARACAAQTK+TFL
Sbjct: 193 GLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARACAAQTKATFL 252

Query: 242 KLAGPQLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKAGDREVQRT 301
           KLAGPQLVQMFIGDGAKLVRDAFALAKEKAP+IIFIDELDAIGTKRFDSEKAGDREVQRT
Sbjct: 253 KLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKAGDREVQRT 312

Query: 302 MLELLNQLDGFSSTADIKVIAATNRVDILDPALLRSGRLDRKIEFPHPNEEARARIMQIH 361
           MLELLNQLDGF     +KVIAATNRVDILDPALLRSGRLDRKIEFP PNEEARARIMQIH
Sbjct: 313 MLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARARIMQIH 372

Query: 362 SRKMNVSPDVNYEELSRSTDDFNGAQCKAVCVEAGMIALRRGAAIVTHEDFMDAIMEVQA 421
           SRKMNVSPDVNYEEL+R TDDFNGAQCKAVCVEAGMIALRRGA  +THED+M+ I+EVQA
Sbjct: 373 SRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDYMEGILEVQA 432

Query: 422 KKKANLNYYA 431
           KKKANL YYA
Sbjct: 433 KKKANLQYYA 442




The 26S protease is involved in the ATP-dependent degradation of ubiquitinated proteins. The regulatory (or ATPase) complex confers ATP dependency and substrate specificity to the 26S complex.
Mus musculus (taxid: 10090)
>sp|Q63569|PRS6A_RAT 26S protease regulatory subunit 6A OS=Rattus norvegicus GN=Psmc3 PE=2 SV=1 Back     alignment and function description
>sp|P17980|PRS6A_HUMAN 26S protease regulatory subunit 6A OS=Homo sapiens GN=PSMC3 PE=1 SV=3 Back     alignment and function description
>sp|O42586|PR6AB_XENLA 26S protease regulatory subunit 6A-B OS=Xenopus laevis GN=psmc3-b PE=2 SV=1 Back     alignment and function description
>sp|O42587|PR6AA_XENLA 26S protease regulatory subunit 6A-A OS=Xenopus laevis GN=psmc3-a PE=2 SV=1 Back     alignment and function description
>sp|Q9SEI2|PS6AA_ARATH 26S protease regulatory subunit 6A homolog A OS=Arabidopsis thaliana GN=RPT5A PE=2 SV=1 Back     alignment and function description
>sp|P46465|PRS6A_ORYSJ 26S protease regulatory subunit 6A homolog OS=Oryza sativa subsp. japonica GN=TBP1 PE=2 SV=2 Back     alignment and function description
>sp|O23894|PRS6A_BRACM 26S protease regulatory subunit 6A homolog OS=Brassica campestris GN=TBP1 PE=2 SV=1 Back     alignment and function description
>sp|O04019|PS6AB_ARATH 26S protease regulatory subunit 6A homolog B OS=Arabidopsis thaliana GN=RPT5B PE=1 SV=3 Back     alignment and function description
>sp|P54776|PRS6A_SOLLC 26S protease regulatory subunit 6A homolog OS=Solanum lycopersicum GN=TBP1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query431
357613322428 26S protease regulatory subunit 6A [Dana 0.983 0.990 0.945 0.0
308512763428 proteasome 26S subunit 6A [Biston betula 0.983 0.990 0.943 0.0
321478961430 hypothetical protein DAPPUDRAFT_299812 [ 0.990 0.993 0.929 0.0
383852816428 PREDICTED: 26S protease regulatory subun 0.986 0.992 0.946 0.0
307190289428 26S protease regulatory subunit 6A [Camp 0.986 0.992 0.943 0.0
340709555428 PREDICTED: 26S protease regulatory subun 0.986 0.992 0.936 0.0
195449908428 GK22416 [Drosophila willistoni] gi|19416 0.983 0.990 0.936 0.0
48101907428 PREDICTED: 26S protease regulatory subun 0.986 0.992 0.936 0.0
125774761428 GA10280 [Drosophila pseudoobscura pseudo 0.983 0.990 0.931 0.0
156553813428 PREDICTED: 26S protease regulatory subun 0.983 0.990 0.936 0.0
>gi|357613322|gb|EHJ68433.1| 26S protease regulatory subunit 6A [Danaus plexippus] Back     alignment and taxonomy information
 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/425 (94%), Positives = 414/425 (97%), Gaps = 1/425 (0%)

Query: 8   TLEDSSIWE-GEESLGDDILRMSTDDINSRTRLLDNEIKIMKSEVMRISHELQAQNEKIR 66
           TLED SIWE GEE+L +++LRM TD+I SRTRLLDNEIKIMKSEVMRISHELQAQN+KI+
Sbjct: 4   TLEDKSIWEDGEEALSEEVLRMPTDEIISRTRLLDNEIKIMKSEVMRISHELQAQNDKIK 63

Query: 67  ENTEKIKVNKNLPYLVSNVIELLDVDPQDTEEDGAVVDLDAQRKGKCAVIKTSTRQTYFL 126
           ENTEKIKVNK LPYLVSNVIELLDVDPQ+ EEDGAVVDLD+QRKGKCAVIKTSTRQTYFL
Sbjct: 64  ENTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGAVVDLDSQRKGKCAVIKTSTRQTYFL 123

Query: 127 PVIGLVDAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEVDERPTEQYSDIGGLDKQ 186
           PVIGLVDAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEVDERPTEQYSDIGGLDKQ
Sbjct: 124 PVIGLVDAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEVDERPTEQYSDIGGLDKQ 183

Query: 187 IQELIEAVVLPMTHKEKFVNLGIQPPKGVLLYGPPGTGKTLLARACAAQTKSTFLKLAGP 246
           IQELIEAVVLPMTHKEKFVNLGI PPKGVLLYGPPGTGKTLLARACAAQTKSTFLKLAGP
Sbjct: 184 IQELIEAVVLPMTHKEKFVNLGIHPPKGVLLYGPPGTGKTLLARACAAQTKSTFLKLAGP 243

Query: 247 QLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKAGDREVQRTMLELL 306
           QLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKAGDREVQRTMLELL
Sbjct: 244 QLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKAGDREVQRTMLELL 303

Query: 307 NQLDGFSSTADIKVIAATNRVDILDPALLRSGRLDRKIEFPHPNEEARARIMQIHSRKMN 366
           NQLDGFSSTADIKVIAATNRVDILDPALLRSGRLDRKIEFPHPNEEARARIMQIHSRKMN
Sbjct: 304 NQLDGFSSTADIKVIAATNRVDILDPALLRSGRLDRKIEFPHPNEEARARIMQIHSRKMN 363

Query: 367 VSPDVNYEELSRSTDDFNGAQCKAVCVEAGMIALRRGAAIVTHEDFMDAIMEVQAKKKAN 426
           VSPDVN+EELSRSTDDFNGAQCKAVCVEAGMIALRR A  VTHEDFMDAI+EVQAKKKAN
Sbjct: 364 VSPDVNFEELSRSTDDFNGAQCKAVCVEAGMIALRRSATAVTHEDFMDAILEVQAKKKAN 423

Query: 427 LNYYA 431
           L+YYA
Sbjct: 424 LSYYA 428




Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|308512763|gb|ADO33035.1| proteasome 26S subunit 6A [Biston betularia] Back     alignment and taxonomy information
>gi|321478961|gb|EFX89917.1| hypothetical protein DAPPUDRAFT_299812 [Daphnia pulex] Back     alignment and taxonomy information
>gi|383852816|ref|XP_003701921.1| PREDICTED: 26S protease regulatory subunit 6A-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307190289|gb|EFN74381.1| 26S protease regulatory subunit 6A [Camponotus floridanus] gi|322796826|gb|EFZ19244.1| hypothetical protein SINV_06515 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|340709555|ref|XP_003393371.1| PREDICTED: 26S protease regulatory subunit 6A-like [Bombus terrestris] gi|350401128|ref|XP_003486056.1| PREDICTED: 26S protease regulatory subunit 6A-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|195449908|ref|XP_002072279.1| GK22416 [Drosophila willistoni] gi|194168364|gb|EDW83265.1| GK22416 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|48101907|ref|XP_392722.1| PREDICTED: 26S protease regulatory subunit 6A [Apis mellifera] gi|380027625|ref|XP_003697522.1| PREDICTED: 26S protease regulatory subunit 6A-like [Apis florea] Back     alignment and taxonomy information
>gi|125774761|ref|XP_001358632.1| GA10280 [Drosophila pseudoobscura pseudoobscura] gi|195145428|ref|XP_002013695.1| GL23259 [Drosophila persimilis] gi|54638371|gb|EAL27773.1| GA10280 [Drosophila pseudoobscura pseudoobscura] gi|194102638|gb|EDW24681.1| GL23259 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|156553813|ref|XP_001604886.1| PREDICTED: 26S protease regulatory subunit 6A [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query431
FB|FBgn0028684431 Rpt5 "Regulatory particle trip 0.981 0.981 0.915 5e-202
ZFIN|ZDB-GENE-030131-666427 psmc3 "proteasome (prosome, ma 0.986 0.995 0.856 1.3e-194
UNIPROTKB|F1SID4446 PSMC3 "Uncharacterized protein 1.0 0.966 0.845 1.7e-194
UNIPROTKB|P17980439 PSMC3 "26S protease regulatory 1.0 0.981 0.845 2.1e-194
UNIPROTKB|F1PBK7439 PSMC3 "Uncharacterized protein 0.993 0.974 0.851 2.7e-194
MGI|MGI:1098754442 Psmc3 "proteasome (prosome, ma 0.993 0.968 0.851 2.7e-194
RGD|61905439 Psmc3 "proteasome (prosome, ma 0.993 0.974 0.851 2.7e-194
UNIPROTKB|Q6P6U2442 Psmc3 "26S protease regulatory 0.993 0.968 0.851 2.7e-194
UNIPROTKB|J9NWA6434 LOC100687152 "Uncharacterized 0.974 0.967 0.850 5.3e-191
UNIPROTKB|F1MWE0456 PSMC3 "Uncharacterized protein 1.0 0.945 0.815 2.3e-190
FB|FBgn0028684 Rpt5 "Regulatory particle triple-A ATPase 5" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1955 (693.3 bits), Expect = 5.0e-202, P = 5.0e-202
 Identities = 389/425 (91%), Positives = 406/425 (95%)

Query:     8 TLEDSSIWE-GEESLGDDILRMSTDDINSRTRLLDNEIKIMKSEVMRISHELQAQNEKIR 66
             TLED SIWE GEESLG+ ++RMSTD+I SRTRL+DNEIKIMKSEV+RI+HE+QAQNEKI+
Sbjct:     8 TLEDKSIWEDGEESLGEKVMRMSTDEIVSRTRLMDNEIKIMKSEVIRITHEIQAQNEKIK 67

Query:    67 ENTEKIKVNKNLPYLVSNVIELLDVDPQDTEEDGAVVDLDAQRKGKCAVIKTSTRQTYFL 126
             +NTEKIKVNK LPYLVSNVIELLDVDPQ+ E+DG+V  LD QRKGKCAVIKTSTRQ YFL
Sbjct:    68 DNTEKIKVNKTLPYLVSNVIELLDVDPQEEEDDGSVTVLDNQRKGKCAVIKTSTRQAYFL 127

Query:   127 PVIGLVDAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEVDERPTEQYSDIGGLDKQ 186
             PVIGLVDAEKLKPGDL GVNKD YLILETLPAEYDARVKAMEVDERPTEQ+SDIGGLDKQ
Sbjct:   128 PVIGLVDAEKLKPGDLAGVNKDFYLILETLPAEYDARVKAMEVDERPTEQFSDIGGLDKQ 187

Query:   187 IQELIEAVVLPMTHKEKFVNLGIQPPKGVLLYGPPGTGKTLLARACAAQTKSTFLKLAGP 246
             IQELIEAVVLPMTHKEKF NLGI PPKGV+LYGPPGTGKTLLARACAAQTKSTFLKLAGP
Sbjct:   188 IQELIEAVVLPMTHKEKFKNLGIHPPKGVILYGPPGTGKTLLARACAAQTKSTFLKLAGP 247

Query:   247 QLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKAGDREVQRTMLELL 306
             QLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKAGDREVQRTMLELL
Sbjct:   248 QLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKAGDREVQRTMLELL 307

Query:   307 NQLDGFSSTADIKVIAATNRVDILDPALLRSGRLDRKIEFPHPNEEARARIMQIHSRKMN 366
             NQL+GFSSTADIKVIAATNRVDIL PALLRSGRLDRKIEFPHPNEEARARIMQIHSRKMN
Sbjct:   308 NQLNGFSSTADIKVIAATNRVDIL-PALLRSGRLDRKIEFPHPNEEARARIMQIHSRKMN 366

Query:   367 VSPDVNYEELSRSTDDFNGAQCKAVCVEAGMIALRRGAAIVTHEDFMDAIMEVQAKKKAN 426
             VS DVN+EELSRSTDDFNGAQCKAVCVEAGMIALRR A  VTHEDFMDAIMEVQAKKKAN
Sbjct:   367 VSNDVNFEELSRSTDDFNGAQCKAVCVEAGMIALRRSANSVTHEDFMDAIMEVQAKKKAN 426

Query:   427 LNYYA 431
             LNYYA
Sbjct:   427 LNYYA 431




GO:0008540 "proteasome regulatory particle, base subcomplex" evidence=ISS;NAS
GO:0004175 "endopeptidase activity" evidence=IDA;NAS
GO:0005838 "proteasome regulatory particle" evidence=ISS;IDA
GO:0006508 "proteolysis" evidence=ISS;IDA
GO:0030163 "protein catabolic process" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0009987 "cellular process" evidence=IMP
ZFIN|ZDB-GENE-030131-666 psmc3 "proteasome (prosome, macropain) 26S subunit, ATPase, 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1SID4 PSMC3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P17980 PSMC3 "26S protease regulatory subunit 6A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PBK7 PSMC3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1098754 Psmc3 "proteasome (prosome, macropain) 26S subunit, ATPase 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|61905 Psmc3 "proteasome (prosome, macropain) 26S subunit, ATPase 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6P6U2 Psmc3 "26S protease regulatory subunit 6A" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9NWA6 LOC100687152 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MWE0 PSMC3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A4G0S4PAN_METM5No assigned EC number0.42670.86770.9189yesN/A
Q8SR13PRS6A_ENCCUNo assigned EC number0.59350.87930.9451yesN/A
A3CV35PAN_METMJNo assigned EC number0.49580.81200.8495yesN/A
O04019PS6AB_ARATHNo assigned EC number0.75700.97670.9952noN/A
O28303PAN_ARCFUNo assigned EC number0.48310.83060.8994yesN/A
P46465PRS6A_ORYSJNo assigned EC number0.79010.93730.9417yesN/A
A6UQT3PAN_METVSNo assigned EC number0.50150.74470.7886yesN/A
B8GGN4PAN_METPENo assigned EC number0.49520.72850.7621yesN/A
P17980PRS6A_HUMANNo assigned EC number0.84291.00.9817yesN/A
Q6LWR0PAN_METMPNo assigned EC number0.42920.86770.9189yesN/A
O14126PRS6A_SCHPONo assigned EC number0.70070.97440.9589yesN/A
P33297PRS6A_YEASTNo assigned EC number0.67660.98600.9792yesN/A
Q9SEI2PS6AA_ARATHNo assigned EC number0.76160.97910.9952yesN/A
A7I8B8PAN_METB6No assigned EC number0.44050.91180.9013yesN/A
Q2FQ56PAN_METHJNo assigned EC number0.46710.86070.9004yesN/A
O88685PRS6A_MOUSENo assigned EC number0.84880.99300.9683yesN/A
Q54PN7PRS6A_DICDINo assigned EC number0.68750.97440.9976yesN/A
Q9YAC7PAN_AERPENo assigned EC number0.50.82590.8704yesN/A
O42586PR6AB_XENLANo assigned EC number0.88360.93731.0N/AN/A
O42587PR6AA_XENLANo assigned EC number0.85060.91180.9703N/AN/A
Q8TX03PAN_METKANo assigned EC number0.47700.84910.8394yesN/A
P54776PRS6A_SOLLCNo assigned EC number0.75460.97670.9952N/AN/A
Q63569PRS6A_RATNo assigned EC number0.84880.99300.9749yesN/A
Q58576PAN_METJANo assigned EC number0.53120.73540.7372yesN/A
A6VHR1PAN_METM7No assigned EC number0.43170.86770.9189yesN/A
A9A916PAN_METM6No assigned EC number0.42920.86770.9189yesN/A
O26824PAN_METTHNo assigned EC number0.43730.80970.8512yesN/A
O23894PRS6A_BRACMNo assigned EC number0.75930.97910.9952N/AN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query431
COG1222406 COG1222, RPT1, ATP-dependent 26S proteasome regula 0.0
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleoti 1e-165
TIGR01242364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 1e-137
PTZ00361438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 1e-129
PTZ00454398 PTZ00454, PTZ00454, 26S protease regulatory subuni 1e-122
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 1e-78
TIGR01241 495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 1e-74
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 4e-71
CHL00176 638 CHL00176, ftsH, cell division protein; Validated 2e-65
COG0465 596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 1e-64
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 8e-63
PRK10733 644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 3e-54
pfam00004131 pfam00004, AAA, ATPase family associated with vari 8e-51
TIGR03689512 TIGR03689, pup_AAA, proteasome ATPase 2e-49
COG1223368 COG1223, COG1223, Predicted ATPase (AAA+ superfami 9e-43
COG0464 494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 4e-37
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 2e-23
CHL00195489 CHL00195, ycf46, Ycf46; Provisional 6e-22
smart00382148 smart00382, AAA, ATPases associated with a variety 1e-17
PRK13342 413 PRK13342, PRK13342, recombination factor protein R 8e-08
pfam07728135 pfam07728, AAA_5, AAA domain (dynein-related subfa 1e-06
PHA02544316 PHA02544, 44, clamp loader, small subunit; Provisi 5e-06
COG2256 436 COG2256, MGS1, ATPase related to the helicase subu 6e-06
COG0714329 COG0714, COG0714, MoxR-like ATPases [General funct 8e-05
COG2255332 COG2255, RuvB, Holliday junction resolvasome, heli 7e-04
TIGR00635305 TIGR00635, ruvB, Holliday junction DNA helicase, R 0.001
TIGR02903 615 TIGR02903, spore_lon_C, ATP-dependent protease, Lo 0.001
pfam13191154 pfam13191, AAA_16, AAA ATPase domain 0.001
PRK04195 482 PRK04195, PRK04195, replication factor C large sub 0.001
PRK00080328 PRK00080, ruvB, Holliday junction DNA helicase Ruv 0.002
PRK13341 725 PRK13341, PRK13341, recombination factor protein R 0.002
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
 Score =  556 bits (1434), Expect = 0.0
 Identities = 207/411 (50%), Positives = 273/411 (66%), Gaps = 24/411 (5%)

Query: 18  EESLGDDILRM----STDDINSRTRLLDNEIKIMKSEVMRISHELQAQNEKIRENTEKIK 73
           +E LGD              +++ +LL+ E +++  E  R+  E      ++    E+I+
Sbjct: 7   DEILGDLESYEPQEYLNKLEDTKLKLLEKEKRLLLLEEQRLEAEGLRLKREVDRLREEIE 66

Query: 74  VNKNLPYLVSNVIELLDVDPQDTEEDGAVVDLDAQRKGKCAVIKTSTRQTYFLPVIGLVD 133
             K  P +V  V+E+LD                       A++K+ST   + + ++  VD
Sbjct: 67  RLKEPPLIVGTVLEVLDDGR--------------------AIVKSSTGPKFVVNILSFVD 106

Query: 134 AEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEVDERPTEQYSDIGGLDKQIQELIEA 193
            + L+PG  V +N+DSY I+  LP E D RV  MEV+E+P   Y DIGGLD+QIQE+ E 
Sbjct: 107 RDLLEPGMRVALNRDSYSIVRVLPPEVDPRVSVMEVEEKPDVTYEDIGGLDEQIQEIREV 166

Query: 194 VVLPMTHKEKFVNLGIQPPKGVLLYGPPGTGKTLLARACAAQTKSTFLKLAGPQLVQMFI 253
           V LP+ + E F  LGI PPKGVLLYGPPGTGKTLLA+A A QT +TF+++ G +LVQ +I
Sbjct: 167 VELPLKNPELFEELGIDPPKGVLLYGPPGTGKTLLAKAVANQTDATFIRVVGSELVQKYI 226

Query: 254 GDGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFS 313
           G+GA+LVR+ F LA+EKAP+IIFIDE+DAIG KRFDS  +GDREVQRTMLELLNQLDGF 
Sbjct: 227 GEGARLVRELFELAREKAPSIIFIDEIDAIGAKRFDSGTSGDREVQRTMLELLNQLDGFD 286

Query: 314 STADIKVIAATNRVDILDPALLRSGRLDRKIEFPHPNEEARARIMQIHSRKMNVSPDVNY 373
              ++KVI ATNR DILDPALLR GR DRKIEFP P+EE RA I++IH+RKMN++ DV+ 
Sbjct: 287 PRGNVKVIMATNRPDILDPALLRPGRFDRKIEFPLPDEEGRAEILKIHTRKMNLADDVDL 346

Query: 374 EELSRSTDDFNGAQCKAVCVEAGMIALRRGAAIVTHEDFMDAIMEVQAKKK 424
           E L+R T+ F+GA  KA+C EAGM A+R     VT EDF+ A+ +V  KKK
Sbjct: 347 ELLARLTEGFSGADLKAICTEAGMFAIRERRDEVTMEDFLKAVEKVVKKKK 397


Length = 406

>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|177094 CHL00195, ycf46, Ycf46; Provisional Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed Back     alignment and domain information
>gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
>gnl|CDD|222866 PHA02544, 44, clamp loader, small subunit; Provisional Back     alignment and domain information
>gnl|CDD|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|225164 COG2255, RuvB, Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|129721 TIGR00635, ruvB, Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>gnl|CDD|234053 TIGR02903, spore_lon_C, ATP-dependent protease, Lon family Back     alignment and domain information
>gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|234619 PRK00080, ruvB, Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>gnl|CDD|237354 PRK13341, PRK13341, recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 431
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 100.0
KOG0652|consensus424 100.0
KOG0727|consensus408 100.0
KOG0726|consensus440 100.0
KOG0728|consensus404 100.0
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 100.0
KOG0729|consensus435 100.0
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 100.0
PRK03992389 proteasome-activating nucleotidase; Provisional 100.0
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 100.0
KOG0730|consensus693 100.0
KOG0651|consensus388 100.0
KOG0733|consensus802 100.0
KOG0734|consensus 752 100.0
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 100.0
KOG0736|consensus953 100.0
KOG0733|consensus 802 100.0
KOG0738|consensus491 100.0
KOG0731|consensus 774 100.0
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 100.0
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 100.0
KOG0735|consensus952 100.0
KOG0739|consensus439 100.0
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 100.0
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 100.0
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 100.0
KOG0737|consensus386 100.0
CHL00195489 ycf46 Ycf46; Provisional 100.0
CHL00176 638 ftsH cell division protein; Validated 100.0
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 100.0
CHL00206 2281 ycf2 Ycf2; Provisional 100.0
KOG0730|consensus 693 100.0
KOG0732|consensus 1080 100.0
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 100.0
KOG0741|consensus 744 100.0
KOG0740|consensus428 100.0
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.98
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 99.92
CHL00181287 cbbX CbbX; Provisional 99.9
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.89
KOG0743|consensus457 99.89
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.88
PRK10865857 protein disaggregation chaperone; Provisional 99.88
KOG0742|consensus630 99.87
PF00004132 AAA: ATPase family associated with various cellula 99.87
KOG0744|consensus423 99.87
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.86
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 99.86
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.85
KOG0736|consensus 953 99.85
KOG0735|consensus 952 99.85
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.85
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.84
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.84
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 99.84
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 99.83
KOG1051|consensus898 99.82
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 99.82
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.81
CHL00095821 clpC Clp protease ATP binding subunit 99.81
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.81
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.8
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 99.8
COG2256 436 MGS1 ATPase related to the helicase subunit of the 99.8
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.78
KOG2004|consensus 906 99.77
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 99.77
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 99.76
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.75
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 99.75
PRK13342 413 recombination factor protein RarA; Reviewed 99.73
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.73
PRK04195 482 replication factor C large subunit; Provisional 99.73
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 99.73
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 99.73
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.73
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.73
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.72
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 99.72
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.72
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 99.71
PTZ00112 1164 origin recognition complex 1 protein; Provisional 99.71
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 99.71
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.71
PRK12402337 replication factor C small subunit 2; Reviewed 99.71
PLN03025319 replication factor C subunit; Provisional 99.7
PRK00149450 dnaA chromosomal replication initiation protein; R 99.7
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 99.69
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 99.69
TIGR00362405 DnaA chromosomal replication initiator protein Dna 99.69
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 99.69
PRK06893229 DNA replication initiation factor; Validated 99.69
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.68
KOG2028|consensus 554 99.68
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 99.68
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.68
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.68
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 99.68
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 99.68
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 99.68
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 99.67
PRK07940 394 DNA polymerase III subunit delta'; Validated 99.67
PRK10865 857 protein disaggregation chaperone; Provisional 99.67
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 99.67
CHL00095 821 clpC Clp protease ATP binding subunit 99.66
PHA02544316 44 clamp loader, small subunit; Provisional 99.66
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.66
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 99.66
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.66
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.66
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.66
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.65
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.65
PRK13341 725 recombination factor protein RarA/unknown domain f 99.65
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 99.65
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 99.65
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 99.65
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 99.64
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 99.64
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 99.64
PRK14088440 dnaA chromosomal replication initiation protein; P 99.64
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.63
PRK14086617 dnaA chromosomal replication initiation protein; P 99.63
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 99.63
PRK08084235 DNA replication initiation factor; Provisional 99.62
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 99.62
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 99.62
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 99.62
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 99.62
PRK12422445 chromosomal replication initiation protein; Provis 99.61
KOG0989|consensus346 99.61
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 99.61
PRK00440319 rfc replication factor C small subunit; Reviewed 99.6
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 99.6
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 99.6
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 99.6
PRK05642234 DNA replication initiation factor; Validated 99.6
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 99.59
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 99.58
COG3829560 RocR Transcriptional regulator containing PAS, AAA 99.57
PRK08727233 hypothetical protein; Validated 99.57
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 99.56
PRK14087450 dnaA chromosomal replication initiation protein; P 99.55
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 99.55
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 99.55
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 99.55
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 99.54
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 99.53
PRK13531 498 regulatory ATPase RavA; Provisional 99.53
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.52
TIGR02974329 phageshock_pspF psp operon transcriptional activat 99.52
PRK06620214 hypothetical protein; Validated 99.52
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 99.51
TIGR01817534 nifA Nif-specific regulatory protein. This model r 99.51
COG2204464 AtoC Response regulator containing CheY-like recei 99.51
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.51
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 99.5
COG0714329 MoxR-like ATPases [General function prediction onl 99.49
COG0593408 DnaA ATPase involved in DNA replication initiation 99.49
COG1221403 PspF Transcriptional regulators containing an AAA- 99.48
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 99.48
PRK15424538 propionate catabolism operon regulatory protein Pr 99.48
TIGR02329526 propionate_PrpR propionate catabolism operon regul 99.47
PRK11608326 pspF phage shock protein operon transcriptional ac 99.47
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 99.47
PHA02244383 ATPase-like protein 99.47
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 99.46
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 99.45
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 99.45
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 99.45
PRK09087226 hypothetical protein; Validated 99.44
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 99.42
PRK05022509 anaerobic nitric oxide reductase transcription reg 99.41
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 99.41
smart00350509 MCM minichromosome maintenance proteins. 99.4
PRK09862506 putative ATP-dependent protease; Provisional 99.4
PRK09112351 DNA polymerase III subunit delta'; Validated 99.38
PRK13765 637 ATP-dependent protease Lon; Provisional 99.37
PRK07471365 DNA polymerase III subunit delta'; Validated 99.37
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 99.37
KOG1942|consensus456 99.35
PRK05564313 DNA polymerase III subunit delta'; Validated 99.35
KOG1969|consensus 877 99.35
PRK11331459 5-methylcytosine-specific restriction enzyme subun 99.35
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 99.34
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 99.34
PRK15429686 formate hydrogenlyase transcriptional activator Fh 99.34
COG0470325 HolB ATPase involved in DNA replication [DNA repli 99.32
PRK07399314 DNA polymerase III subunit delta'; Validated 99.32
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 99.32
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 99.32
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 99.3
COG0606490 Predicted ATPase with chaperone activity [Posttran 99.27
smart00382148 AAA ATPases associated with a variety of cellular 99.27
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 99.26
KOG1514|consensus767 99.26
KOG2680|consensus454 99.25
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 99.25
PRK04132846 replication factor C small subunit; Provisional 99.24
PRK05707328 DNA polymerase III subunit delta'; Validated 99.23
PRK08058329 DNA polymerase III subunit delta'; Validated 99.22
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 99.22
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 99.22
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 99.2
KOG0745|consensus 564 99.19
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 99.17
COG3283511 TyrR Transcriptional regulator of aromatic amino a 99.17
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 99.16
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 99.15
PF07726131 AAA_3: ATPase family associated with various cellu 99.15
KOG0991|consensus333 99.14
PTZ00111915 DNA replication licensing factor MCM4; Provisional 99.14
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 99.14
PRK15115444 response regulator GlrR; Provisional 99.13
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 99.13
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 99.13
PRK08116268 hypothetical protein; Validated 99.11
KOG2227|consensus 529 99.11
PRK06964342 DNA polymerase III subunit delta'; Validated 99.04
PRK06871325 DNA polymerase III subunit delta'; Validated 99.04
PRK12377248 putative replication protein; Provisional 98.98
PRK08769319 DNA polymerase III subunit delta'; Validated 98.98
PRK08181269 transposase; Validated 98.97
PRK07993334 DNA polymerase III subunit delta'; Validated 98.96
KOG0741|consensus744 98.96
PRK10365441 transcriptional regulatory protein ZraR; Provision 98.95
KOG0990|consensus360 98.93
PRK06090319 DNA polymerase III subunit delta'; Validated 98.92
PRK07952244 DNA replication protein DnaC; Validated 98.91
PRK08699325 DNA polymerase III subunit delta'; Validated 98.89
PRK06835329 DNA replication protein DnaC; Validated 98.89
KOG2035|consensus351 98.88
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 98.86
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 98.85
PRK06526254 transposase; Provisional 98.84
PRK06921266 hypothetical protein; Provisional 98.81
COG3284606 AcoR Transcriptional activator of acetoin/glycerol 98.81
PRK08939306 primosomal protein DnaI; Reviewed 98.8
PF13173128 AAA_14: AAA domain 98.76
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 98.76
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 98.76
KOG2170|consensus344 98.76
PRK09183259 transposase/IS protein; Provisional 98.75
PF00493331 MCM: MCM2/3/5 family This family extends the MCM d 98.74
COG1484254 DnaC DNA replication protein [DNA replication, rec 98.71
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 98.68
KOG0478|consensus804 98.64
COG1241682 MCM2 Predicted ATPase involved in replication cont 98.63
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.6
PF05729166 NACHT: NACHT domain 98.54
KOG0480|consensus 764 98.54
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 98.54
PRK05917290 DNA polymerase III subunit delta'; Validated 98.52
PRK07276290 DNA polymerase III subunit delta'; Validated 98.47
PRK05818261 DNA polymerase III subunit delta'; Validated 98.47
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 98.46
COG1485367 Predicted ATPase [General function prediction only 98.44
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 98.44
COG4650531 RtcR Sigma54-dependent transcription regulator con 98.4
PRK07132299 DNA polymerase III subunit delta'; Validated 98.4
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.39
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 98.36
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 98.35
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 98.33
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 98.31
KOG2228|consensus 408 98.31
KOG1970|consensus 634 98.26
TIGR02237209 recomb_radB DNA repair and recombination protein R 98.24
TIGR02688449 conserved hypothetical protein TIGR02688. Members 98.21
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 98.19
KOG0477|consensus854 98.16
KOG0482|consensus721 98.15
KOG1968|consensus 871 98.12
PF14516331 AAA_35: AAA-like domain 98.12
PRK11823 446 DNA repair protein RadA; Provisional 98.09
PRK08533230 flagellar accessory protein FlaH; Reviewed 98.08
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 98.07
KOG2543|consensus 438 98.06
cd01124187 KaiC KaiC is a circadian clock protein primarily f 98.06
cd00983325 recA RecA is a bacterial enzyme which has roles in 98.06
COG1373 398 Predicted ATPase (AAA+ superfamily) [General funct 98.06
PRK09361225 radB DNA repair and recombination protein RadB; Pr 98.04
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 98.02
COG1618179 Predicted nucleotide kinase [Nucleotide transport 98.01
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 98.01
KOG2383|consensus 467 98.0
TIGR02012321 tigrfam_recA protein RecA. This model describes or 98.0
cd01128249 rho_factor Transcription termination factor rho is 97.99
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 97.97
COG4178604 ABC-type uncharacterized transport system, permeas 97.97
PF07693325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 97.96
KOG0481|consensus729 97.92
PHA00729226 NTP-binding motif containing protein 97.89
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.88
PRK06067234 flagellar accessory protein FlaH; Validated 97.88
cd01394218 radB RadB. The archaeal protein radB shares simila 97.87
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 97.86
KOG1051|consensus 898 97.85
COG4619223 ABC-type uncharacterized transport system, ATPase 97.84
PRK09376416 rho transcription termination factor Rho; Provisio 97.84
PRK00131175 aroK shikimate kinase; Reviewed 97.81
PRK08118167 topology modulation protein; Reviewed 97.8
PHA02624647 large T antigen; Provisional 97.77
PRK04841 903 transcriptional regulator MalT; Provisional 97.77
PRK15455 644 PrkA family serine protein kinase; Provisional 97.76
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 97.74
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 97.73
cd03216163 ABC_Carb_Monos_I This family represents the domain 97.71
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 97.71
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 97.71
PRK04296190 thymidine kinase; Provisional 97.7
PRK07261171 topology modulation protein; Provisional 97.69
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 97.69
PRK00771437 signal recognition particle protein Srp54; Provisi 97.69
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 97.69
PRK09354349 recA recombinase A; Provisional 97.69
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 97.68
PF05707193 Zot: Zonular occludens toxin (Zot); InterPro: IPR0 97.67
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 97.67
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 97.67
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 97.66
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 97.65
PRK06581263 DNA polymerase III subunit delta'; Validated 97.65
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 97.64
COG1126240 GlnQ ABC-type polar amino acid transport system, A 97.63
cd01393226 recA_like RecA is a bacterial enzyme which has rol 97.62
PRK13948182 shikimate kinase; Provisional 97.62
PHA02774613 E1; Provisional 97.61
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 97.6
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 97.59
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 97.59
PRK12339197 2-phosphoglycerate kinase; Provisional 97.59
COG1136226 SalX ABC-type antimicrobial peptide transport syst 97.59
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 97.58
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.57
PRK04040188 adenylate kinase; Provisional 97.56
PRK13695174 putative NTPase; Provisional 97.55
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 97.55
KOG3928|consensus461 97.55
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 97.55
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 97.52
PRK06762166 hypothetical protein; Provisional 97.52
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 97.51
PRK10536262 hypothetical protein; Provisional 97.51
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 97.51
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 97.5
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 97.5
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 97.49
PRK05973237 replicative DNA helicase; Provisional 97.48
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 97.48
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 97.48
PRK10867433 signal recognition particle protein; Provisional 97.48
PRK13947171 shikimate kinase; Provisional 97.48
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 97.47
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 97.47
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 97.46
PRK03839180 putative kinase; Provisional 97.46
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 97.46
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 97.45
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 97.45
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 97.45
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 97.44
TIGR00767415 rho transcription termination factor Rho. Members 97.44
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 97.44
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 97.43
COG0703172 AroK Shikimate kinase [Amino acid transport and me 97.43
PRK00625173 shikimate kinase; Provisional 97.43
KOG3347|consensus176 97.42
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 97.42
cd03246173 ABCC_Protease_Secretion This family represents the 97.42
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 97.42
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 97.41
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 97.41
PRK09519 790 recA DNA recombination protein RecA; Reviewed 97.4
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 97.39
PRK04328249 hypothetical protein; Provisional 97.38
PRK13949169 shikimate kinase; Provisional 97.36
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 97.36
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 97.36
PRK14532188 adenylate kinase; Provisional 97.36
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 97.35
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 97.35
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 97.35
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.35
PTZ00202550 tuzin; Provisional 97.34
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 97.34
PRK12608380 transcription termination factor Rho; Provisional 97.34
PF01745233 IPT: Isopentenyl transferase; InterPro: IPR002648 97.33
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 97.32
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 97.32
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 97.31
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 97.31
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 97.3
PRK06217183 hypothetical protein; Validated 97.3
COG4088261 Predicted nucleotide kinase [Nucleotide transport 97.3
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 97.3
PLN02200234 adenylate kinase family protein 97.3
PRK04301317 radA DNA repair and recombination protein RadA; Va 97.29
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 97.29
COG2874235 FlaH Predicted ATPases involved in biogenesis of a 97.29
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 97.29
PRK14531183 adenylate kinase; Provisional 97.28
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 97.28
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 97.27
smart00487201 DEXDc DEAD-like helicases superfamily. 97.26
COG5245 3164 DYN1 Dynein, heavy chain [Cytoskeleton] 97.26
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 97.25
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 97.25
PTZ00088229 adenylate kinase 1; Provisional 97.25
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 97.24
PF05970 364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 97.24
TIGR02236310 recomb_radA DNA repair and recombination protein R 97.24
PRK05057172 aroK shikimate kinase I; Reviewed 97.23
PF10443 431 RNA12: RNA12 protein; InterPro: IPR018850 Mitochon 97.23
cd03215182 ABC_Carb_Monos_II This family represents domain II 97.23
PRK06547172 hypothetical protein; Provisional 97.22
TIGR00959428 ffh signal recognition particle protein. This mode 97.22
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 97.22
PRK14530215 adenylate kinase; Provisional 97.22
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 97.2
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 97.19
COG1119257 ModF ABC-type molybdenum transport system, ATPase 97.19
PTZ00035337 Rad51 protein; Provisional 97.18
PRK13833323 conjugal transfer protein TrbB; Provisional 97.18
PLN02674244 adenylate kinase 97.18
PRK14974336 cell division protein FtsY; Provisional 97.17
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 97.17
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 97.17
PRK08154309 anaerobic benzoate catabolism transcriptional regu 97.16
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 97.16
COG1117253 PstB ABC-type phosphate transport system, ATPase c 97.16
PRK03731171 aroL shikimate kinase II; Reviewed 97.15
COG2884223 FtsE Predicted ATPase involved in cell division [C 97.15
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 97.15
TIGR02239316 recomb_RAD51 DNA repair protein RAD51. This eukary 97.14
PF05272198 VirE: Virulence-associated protein E; InterPro: IP 97.14
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.14
PRK13851344 type IV secretion system protein VirB11; Provision 97.14
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 97.13
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 97.13
cd03115173 SRP The signal recognition particle (SRP) mediates 97.13
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 97.13
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 97.13
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 97.13
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 97.13
PF08303168 tRNA_lig_kinase: tRNA ligase kinase domain; InterP 97.12
KOG0058|consensus716 97.12
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 97.12
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 97.11
KOG1808|consensus 1856 97.11
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.11
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 97.11
PRK13946184 shikimate kinase; Provisional 97.1
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 97.1
COG1066 456 Sms Predicted ATP-dependent serine protease [Postt 97.1
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 97.1
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 97.1
PRK14528186 adenylate kinase; Provisional 97.09
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 97.09
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 97.08
PRK11650 356 ugpC glycerol-3-phosphate transporter ATP-binding 97.08
PLN03186342 DNA repair protein RAD51 homolog; Provisional 97.08
PF10236309 DAP3: Mitochondrial ribosomal death-associated pro 97.07
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 97.07
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 97.07
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 97.07
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 97.07
PRK14527191 adenylate kinase; Provisional 97.07
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 97.06
PRK09452 375 potA putrescine/spermidine ABC transporter ATPase 97.06
PRK13894319 conjugal transfer ATPase TrbB; Provisional 97.06
PRK10436462 hypothetical protein; Provisional 97.05
PRK13764 602 ATPase; Provisional 97.05
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 97.05
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 97.05
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 97.04
PRK02496184 adk adenylate kinase; Provisional 97.04
PRK14730195 coaE dephospho-CoA kinase; Provisional 97.04
PF08298358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 97.04
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 97.04
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 97.04
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 97.03
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 97.03
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 97.03
PRK06696223 uridine kinase; Validated 97.02
TIGR01526325 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr 97.02
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 97.02
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 97.02
COG1936180 Predicted nucleotide kinase (related to CMP and AM 97.01
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 97.01
TIGR01613304 primase_Cterm phage/plasmid primase, P4 family, C- 97.01
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 96.99
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 96.99
TIGR00064272 ftsY signal recognition particle-docking protein F 96.99
COG1127263 Ttg2A ABC-type transport system involved in resist 96.99
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 96.99
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 96.99
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 96.99
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 96.99
PRK00279215 adk adenylate kinase; Reviewed 96.99
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=1.8e-80  Score=587.18  Aligned_cols=371  Identities=55%  Similarity=0.879  Sum_probs=354.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCCceeeeeeecccCCCCCccccccccccccccCCcE
Q psy15151         34 NSRTRLLDNEIKIMKSEVMRISHELQAQNEKIRENTEKIKVNKNLPYLVSNVIELLDVDPQDTEEDGAVVDLDAQRKGKC  113 (431)
Q Consensus        34 ~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  113 (431)
                      +.+.+.++.....+..+..++..+...++.+|+.++++++.++.+|+.++++.+.+|+.                    .
T Consensus        27 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~l~~~pl~vg~v~e~id~~--------------------~   86 (406)
T COG1222          27 DTKLKLLEKEKRLLLLEEQRLEAEGLRLKREVDRLREEIERLKEPPLIVGTVLEVLDDG--------------------R   86 (406)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhhcchHHHHHHHHHHHHHhcCCCceEEEEEEEcCCc--------------------e
Confidence            33444445555555556667777777888899999999999999999999999999984                    6


Q ss_pred             EEEecCCCceEEEeecccccccCCCCCCeEEEcCcchhhhhcCchhHHHHhhhhhcccCCCCCcccccCchHHHHHHHHH
Q psy15151        114 AVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEVDERPTEQYSDIGGLDKQIQELIEA  193 (431)
Q Consensus       114 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~i~G~~~~i~~l~~~  193 (431)
                      ++++.++++.+++++.+.++.+.++||++|++++.++.++..||.+.++.+..|++.+.|+++|++|+|++++++++++.
T Consensus        87 ~iVks~~g~~~vV~i~~~vd~~~L~pG~rVal~~~s~~Iv~vLp~~~Dp~V~~M~v~e~PdvtY~dIGGL~~Qi~EirE~  166 (406)
T COG1222          87 AIVKSSTGPKFVVNILSFVDRDLLEPGMRVALNRDSYSIVRVLPPEVDPRVSVMEVEEKPDVTYEDIGGLDEQIQEIREV  166 (406)
T ss_pred             EEEEeCCCCeEEEeccCCcCHHHcCCCCEEEEcCCcceeeeeCCCccCchhheeeeccCCCCChhhccCHHHHHHHHHHH
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhccccChHHHHhcCCCCCCCceeeCCCCCchHHHHHHHHHHcCCceEEeehhhhhHhhhcchHHHHHHHHHHHHhCCCe
Q psy15151        194 VVLPMTHKEKFVNLGIQPPKGVLLYGPPGTGKTLLARACAAQTKSTFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPA  273 (431)
Q Consensus       194 i~~~~~~~~~~~~~g~~~~~~vLl~GppGtGKT~lakala~~~~~~~i~i~~~~l~~~~~g~~~~~~~~lf~~a~~~~p~  273 (431)
                      |++|+.+|++|.++|+.||+|||||||||||||+||||+|++.++.|+++.+|+++++|+|++++.++++|+.|+.++||
T Consensus       167 VELPL~~PElF~~~GI~PPKGVLLYGPPGTGKTLLAkAVA~~T~AtFIrvvgSElVqKYiGEGaRlVRelF~lArekaPs  246 (406)
T COG1222         167 VELPLKNPELFEELGIDPPKGVLLYGPPGTGKTLLAKAVANQTDATFIRVVGSELVQKYIGEGARLVRELFELAREKAPS  246 (406)
T ss_pred             hcccccCHHHHHHcCCCCCCceEeeCCCCCcHHHHHHHHHhccCceEEEeccHHHHHHHhccchHHHHHHHHHHhhcCCe
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEccccccccCCCCCCCcCcHHHHHHHHHHHHhhcCCCCCCCeEEEEEeCCCCCCChhhhcCCCcceEEEcCCCCHHH
Q psy15151        274 IIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFSSTADIKVIAATNRVDILDPALLRSGRLDRKIEFPHPNEEA  353 (431)
Q Consensus       274 vl~iDEid~l~~~r~~~~~~~~~~~~~~l~~lL~~~~~~~~~~~v~vI~ttn~~~~l~~~l~r~gR~~~~i~~~~p~~~~  353 (431)
                      ||||||||+++.+|.++++++++++|++|++||+++|||+..++|.||||||+++.||||++||||||+.|+||+|+.+.
T Consensus       247 IIFiDEIDAIg~kR~d~~t~gDrEVQRTmleLL~qlDGFD~~~nvKVI~ATNR~D~LDPALLRPGR~DRkIEfplPd~~g  326 (406)
T COG1222         247 IIFIDEIDAIGAKRFDSGTSGDREVQRTMLELLNQLDGFDPRGNVKVIMATNRPDILDPALLRPGRFDRKIEFPLPDEEG  326 (406)
T ss_pred             EEEEechhhhhcccccCCCCchHHHHHHHHHHHHhccCCCCCCCeEEEEecCCccccChhhcCCCcccceeecCCCCHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhcCCCCCCCCHHHHHHHcCCCCHHHHHHHHHHHHHHHHHhCCCCcCHHHHHHHHHHHHHhhh
Q psy15151        354 RARIMQIHSRKMNVSPDVNYEELSRSTDDFNGAQCKAVCVEAGMIALRRGAAIVTHEDFMDAIMEVQAKKK  424 (431)
Q Consensus       354 r~~Il~~~l~~~~~~~~~~~~~la~~~~g~s~~di~~l~~~A~~~A~~~~~~~It~ed~~~Al~~~~~~~~  424 (431)
                      |.+||+.|.+++++..++|++.|+..+.|+||+||+++|.+|++.|+++.+..||++||.+|++++.....
T Consensus       327 R~~Il~IHtrkM~l~~dvd~e~la~~~~g~sGAdlkaictEAGm~AiR~~R~~Vt~~DF~~Av~KV~~~~~  397 (406)
T COG1222         327 RAEILKIHTRKMNLADDVDLELLARLTEGFSGADLKAICTEAGMFAIRERRDEVTMEDFLKAVEKVVKKKK  397 (406)
T ss_pred             HHHHHHHHhhhccCccCcCHHHHHHhcCCCchHHHHHHHHHHhHHHHHhccCeecHHHHHHHHHHHHhccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999998653



>KOG0652|consensus Back     alignment and domain information
>KOG0727|consensus Back     alignment and domain information
>KOG0726|consensus Back     alignment and domain information
>KOG0728|consensus Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0729|consensus Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>KOG0651|consensus Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>KOG0731|consensus Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>KOG0737|consensus Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>KOG0740|consensus Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>KOG0743|consensus Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>KOG0742|consensus Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>KOG1051|consensus Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>KOG2004|consensus Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG1942|consensus Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1969|consensus Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1514|consensus Back     alignment and domain information
>KOG2680|consensus Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>KOG0745|consensus Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>KOG2227|consensus Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>KOG0990|consensus Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG2035|consensus Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2170|consensus Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>KOG0478|consensus Back     alignment and domain information
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>KOG0480|consensus Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>COG1485 Predicted ATPase [General function prediction only] Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>KOG2228|consensus Back     alignment and domain information
>KOG1970|consensus Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>KOG0477|consensus Back     alignment and domain information
>KOG0482|consensus Back     alignment and domain information
>KOG1968|consensus Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>KOG2543|consensus Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>KOG2383|consensus Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>KOG0481|consensus Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>KOG1051|consensus Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06581 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>KOG3928|consensus Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>KOG3347|consensus Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG5245 DYN1 Dynein, heavy chain [Cytoskeleton] Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>PF05272 VirE: Virulence-associated protein E; InterPro: IPR007936 This family contains several bacterial virulence-associated protein E like proteins Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PF08303 tRNA_lig_kinase: tRNA ligase kinase domain; InterPro: IPR015966 This entry represents a kinase domain found in fungal tRNA ligases [] Back     alignment and domain information
>KOG0058|consensus Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>KOG1808|consensus Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR01613 primase_Cterm phage/plasmid primase, P4 family, C-terminal domain Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query431
4b4t_M434 Near-Atomic Resolution Structural Model Of The Yeas 1e-174
4b4t_I437 Near-Atomic Resolution Structural Model Of The Yeas 1e-91
3h4m_A285 Aaa Atpase Domain Of The Proteasome- Activating Nuc 3e-87
4b4t_J405 Near-Atomic Resolution Structural Model Of The Yeas 2e-85
4b4t_H467 Near-Atomic Resolution Structural Model Of The Yeas 9e-81
4b4t_K428 Near-Atomic Resolution Structural Model Of The Yeas 5e-77
4b4t_L437 Near-Atomic Resolution Structural Model Of The Yeas 5e-72
2ce7_A 476 Edta Treated Length = 476 1e-53
3kds_E 465 Apo-ftsh Crystal Structure Length = 465 6e-53
3hu3_A489 Structure Of P97 N-D1 R155h Mutant In Complex With 6e-51
3cf1_A 806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 6e-51
3hu1_A489 Structure Of P97 N-D1 R95g Mutant In Complex With A 7e-51
3hu2_A489 Structure Of P97 N-D1 R86a Mutant In Complex With A 7e-51
1e32_A458 Structure Of The N-Terminal Domain And The D1 Aaa D 9e-51
1r7r_A 816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 1e-50
1lv7_A257 Crystal Structure Of The Aaa Domain Of Ftsh Length 1e-49
3cf0_A301 Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH 1e-49
2r62_A268 Crystal Structure Of Helicobacter Pylori Atp Depend 4e-49
2dhr_A 499 Whole Cytosolic Region Of Atp-Dependent Metalloprot 2e-45
4eiw_A 508 Whole Cytosolic Region Of Atp-Dependent Metalloprot 2e-45
1iy2_A278 Crystal Structure Of The Ftsh Atpase Domain From Th 2e-44
1ixz_A254 Crystal Structure Of The Ftsh Atpase Domain From Th 3e-44
2x8a_A274 Human Nuclear Valosin Containing Protein Like (Nvl) 2e-41
2qz4_A262 Human Paraplegin, Aaa Domain In Complex With Adp Le 1e-40
3d8b_A357 Crystal Structure Of Human Fidgetin-Like Protein 1 4e-36
2zam_A444 Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt 5e-36
1xwi_A322 Crystal Structure Of Vps4b Length = 322 9e-36
3vfd_A389 Human Spastin Aaa Domain Length = 389 1e-33
2qp9_X355 Crystal Structure Of S.Cerevisiae Vps4 Length = 355 4e-33
2rko_A331 Crystal Structure Of The Vps4p-Dimer Length = 331 6e-33
3eie_A322 Crystal Structure Of S.Cerevisiae Vps4 In The So4-B 1e-32
3eih_A340 Crystal Structure Of S.Cerevisiae Vps4 In The Prese 1e-32
3b9p_A297 Spastin Length = 297 1e-31
2krk_A86 Solution Nmr Structure Of 26s Protease Regulatory S 4e-12
3kw6_A78 Crystal Structure Of A Domain Of 26s Proteasome Reg 2e-11
4a3v_B95 Yeast Regulatory Particle Proteasome Assembly Chape 6e-10
3vlf_B88 Crystal Structure Of Yeast Proteasome Interacting P 1e-07
1ofh_A310 Asymmetric Complex Between Hslv And I-domain Delete 6e-05
3u5z_B324 Structure Of T4 Bacteriophage Clamp Loader Bound To 1e-04
2dvw_B83 Structure Of The Oncoprotein Gankyrin In Complex Wi 2e-04
>pdb|4B4T|M Chain M, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 Back     alignment and structure

Iteration: 1

Score = 608 bits (1568), Expect = e-174, Method: Compositional matrix adjust. Identities = 293/433 (67%), Positives = 363/433 (83%), Gaps = 8/433 (1%) Query: 7 ATLE--DSSIWEGEESLGDDILRMSTDDINSRTRLLDNEIKIMKSEVMRISHELQAQNEK 64 ATLE D+ G++ L +IL +ST ++ +R +LLDNEI+I +SE+ R+SHE EK Sbjct: 2 ATLEELDAQTLPGDDELDQEILNLSTQELQTRAKLLDNEIRIFRSELQRLSHENNVMLEK 61 Query: 65 IRENTEKIKVNKNLPYLVSNVIELLDVDPQDTEED------GAVVDLDAQRKGKCAVIKT 118 I++N EKIK N+ LPYLV+NV+E++D++ + +E+ G V+LD GK AV+KT Sbjct: 62 IKDNKEKIKNNRQLPYLVANVVEVMDMNEIEDKENSESTTQGGNVNLDNTAVGKAAVVKT 121 Query: 119 STRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEVDERPTEQYS 178 S+RQT FLP++GLVD +KLKP DLVGVNKDSYLIL+TLP+E+D+RVKAMEVDE+PTE YS Sbjct: 122 SSRQTVFLPMVGLVDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYS 181 Query: 179 DIGGLDKQIQELIEAVVLPMTHKEKFVNLGIQPPKGVLLYGPPGTGKTLLARACAAQTKS 238 D+GGLDKQI+EL+EA+VLPM +KF ++GI+ PKG L+YGPPGTGKTLLARACAAQT + Sbjct: 182 DVGGLDKQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNA 241 Query: 239 TFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKAGDREV 298 TFLKLA PQLVQM+IG+GAKLVRDAFALAKEKAP IIFIDELDAIGTKRFDSEK+GDREV Sbjct: 242 TFLKLAAPQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREV 301 Query: 299 QRTMLELLNQLDGFSSTADIKVIAATNRVDILDPALLRSGRLDRKIEFPHPNEEARARIM 358 QRTMLELLNQLDGFSS +KV+AATNRVD+LDPALLRSGRLDRKIEFP P+E++RA+I+ Sbjct: 302 QRTMLELLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQIL 361 Query: 359 QIHSRKMNVSPDVNYEELSRSTDDFNGAQCKAVCVEAGMIALRRGAAIVTHEDFMDAIME 418 QIHSRKM D+N++EL+RSTD+FNGAQ KAV VEAGMIALR G + V HEDF++ I E Sbjct: 362 QIHSRKMTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISE 421 Query: 419 VQAKKKANLNYYA 431 VQA+K ++++YA Sbjct: 422 VQARKSKSVSFYA 434
>pdb|4B4T|I Chain I, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 Back     alignment and structure
>pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 Back     alignment and structure
>pdb|4B4T|H Chain H, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 467 Back     alignment and structure
>pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 Back     alignment and structure
>pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|2CE7|A Chain A, Edta Treated Length = 476 Back     alignment and structure
>pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 Back     alignment and structure
>pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure
>pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 Back     alignment and structure
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure
>pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 Back     alignment and structure
>pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 Back     alignment and structure
>pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 Back     alignment and structure
>pdb|2DHR|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 499 Back     alignment and structure
>pdb|4EIW|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 508 Back     alignment and structure
>pdb|1IY2|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 278 Back     alignment and structure
>pdb|1IXZ|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 254 Back     alignment and structure
>pdb|2X8A|A Chain A, Human Nuclear Valosin Containing Protein Like (Nvl), C- Terminal Aaa-Atpase Domain Length = 274 Back     alignment and structure
>pdb|2QZ4|A Chain A, Human Paraplegin, Aaa Domain In Complex With Adp Length = 262 Back     alignment and structure
>pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357 Back     alignment and structure
>pdb|2ZAM|A Chain A, Crystal Structure Of Mouse Skd1VPS4B APO-Form Length = 444 Back     alignment and structure
>pdb|1XWI|A Chain A, Crystal Structure Of Vps4b Length = 322 Back     alignment and structure
>pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 Back     alignment and structure
>pdb|2QP9|X Chain X, Crystal Structure Of S.Cerevisiae Vps4 Length = 355 Back     alignment and structure
>pdb|2RKO|A Chain A, Crystal Structure Of The Vps4p-Dimer Length = 331 Back     alignment and structure
>pdb|3EIE|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The So4-Bound State Length = 322 Back     alignment and structure
>pdb|3EIH|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The Presence Of Atpgammas Length = 340 Back     alignment and structure
>pdb|3B9P|A Chain A, Spastin Length = 297 Back     alignment and structure
>pdb|2KRK|A Chain A, Solution Nmr Structure Of 26s Protease Regulatory Subunit 8 From H.Sapiens, Northeast Structural Genomics Consortium Target Target Hr3102a Length = 86 Back     alignment and structure
>pdb|3KW6|A Chain A, Crystal Structure Of A Domain Of 26s Proteasome Regulatory Subunit 8 From Homo Sapiens. Northeast Structural Genomics Consortium Target Id Hr3102a Length = 78 Back     alignment and structure
>pdb|4A3V|B Chain B, Yeast Regulatory Particle Proteasome Assembly Chaperone Hsm3 In Complex With Rpt1 C-Terminal Fragment Length = 95 Back     alignment and structure
>pdb|3VLF|B Chain B, Crystal Structure Of Yeast Proteasome Interacting Protein Length = 88 Back     alignment and structure
>pdb|1OFH|A Chain A, Asymmetric Complex Between Hslv And I-domain Deleted Hslu (h. Influenzae) Length = 310 Back     alignment and structure
>pdb|3U5Z|B Chain B, Structure Of T4 Bacteriophage Clamp Loader Bound To The T4 Clamp, Primer-Template Dna, And Atp Analog Length = 324 Back     alignment and structure
>pdb|2DVW|B Chain B, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 83 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query431
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 1e-171
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 1e-105
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 3e-96
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 4e-93
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 2e-91
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 3e-78
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 7e-82
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 2e-80
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 6e-79
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 1e-78
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 3e-78
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 1e-77
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 2e-77
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 2e-76
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 4e-76
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 6e-76
2r62_A268 Cell division protease FTSH homolog; ATPase domain 2e-75
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 2e-75
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 3e-72
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 1e-71
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 1e-71
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 2e-55
2krk_A86 26S protease regulatory subunit 8; structural geno 2e-41
3kw6_A78 26S protease regulatory subunit 8; structural geno 8e-39
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 6e-34
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 3e-27
2wg5_A109 General control protein GCN4, proteasome-activatin 9e-22
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 1e-20
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 2e-18
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
3m9b_A251 Proteasome-associated ATPase; coil COIL with 5 bet 9e-13
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 1e-12
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 2e-12
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 5e-10
3pvs_A 447 Replication-associated recombination protein A; ma 3e-09
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 3e-09
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 2e-08
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 5e-08
3h43_A85 Proteasome-activating nucleotidase; regulatory par 3e-07
2v1u_A387 Cell division control protein 6 homolog; DNA repli 5e-05
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 2e-04
2chg_A226 Replication factor C small subunit; DNA-binding pr 3e-04
2chq_A319 Replication factor C small subunit; DNA-binding pr 7e-04
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 9e-04
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
 Score =  479 bits (1235), Expect = e-171
 Identities = 153/265 (57%), Positives = 202/265 (76%)

Query: 163 RVKAMEVDERPTEQYSDIGGLDKQIQELIEAVVLPMTHKEKFVNLGIQPPKGVLLYGPPG 222
           R KAMEVDERP  +Y DIGGL+KQ+QE+ E V LP+ H E F  +GI+PPKG+LLYGPPG
Sbjct: 2   RAKAMEVDERPNVRYEDIGGLEKQMQEIREVVELPLKHPELFEKVGIEPPKGILLYGPPG 61

Query: 223 TGKTLLARACAAQTKSTFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDELDA 282
           TGKTLLA+A A +T +TF+++ G +LV+ FIG+GA LV+D F LAKEKAP+IIFIDE+DA
Sbjct: 62  TGKTLLAKAVATETNATFIRVVGSELVKKFIGEGASLVKDIFKLAKEKAPSIIFIDEIDA 121

Query: 283 IGTKRFDSEKAGDREVQRTMLELLNQLDGFSSTADIKVIAATNRVDILDPALLRSGRLDR 342
           I  KR D+   GDREVQRT+++LL ++DGF +  D+K+I ATNR DILDPA+LR GR DR
Sbjct: 122 IAAKRTDALTGGDREVQRTLMQLLAEMDGFDARGDVKIIGATNRPDILDPAILRPGRFDR 181

Query: 343 KIEFPHPNEEARARIMQIHSRKMNVSPDVNYEELSRSTDDFNGAQCKAVCVEAGMIALRR 402
            IE P P+E+ R  I++IH+RKMN++ DVN EE+++ T+   GA+ KA+C EAGM A+R 
Sbjct: 182 IIEVPAPDEKGRLEILKIHTRKMNLAEDVNLEEIAKMTEGCVGAELKAICTEAGMNAIRE 241

Query: 403 GAAIVTHEDFMDAIMEVQAKKKANL 427
               VT +DF  A+ ++  KKK  +
Sbjct: 242 LRDYVTMDDFRKAVEKIMEKKKVKV 266


>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Length = 78 Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Length = 83 Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Length = 82 Back     alignment and structure
>2wg5_A General control protein GCN4, proteasome-activating nucleotidase; transcription hydrolase complex, nucleotide-binding; 2.10A {Saccharomyces cerevisiae} PDB: 2wg6_A Length = 109 Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Length = 88 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A Length = 251 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Length = 456 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 386 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Length = 447 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Length = 412 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Length = 389 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 384 Back     alignment and structure
>3h43_A Proteasome-activating nucleotidase; regulatory particle, nucleosidase, ATP-binding, cytoplasm, nucleotide-binding, hydrolase; 2.10A {Methanocaldococcus jannaschii} Length = 85 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Length = 387 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Length = 310 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Length = 226 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Length = 319 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Length = 327 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query431
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 100.0
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 100.0
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 100.0
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 100.0
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 100.0
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 100.0
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 100.0
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 100.0
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 100.0
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 100.0
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 100.0
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 100.0
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 100.0
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 100.0
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 100.0
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 100.0
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 100.0
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 100.0
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 100.0
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 100.0
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 100.0
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 100.0
2r62_A268 Cell division protease FTSH homolog; ATPase domain 100.0
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 100.0
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 100.0
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 100.0
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 100.0
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.97
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 99.94
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 99.9
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.9
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.89
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 99.89
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.88
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 99.87
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 99.86
2v1u_A387 Cell division control protein 6 homolog; DNA repli 99.85
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 99.85
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 99.84
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.84
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 99.83
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.83
2r44_A331 Uncharacterized protein; putative ATPase, structur 99.83
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.82
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 99.82
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.82
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 99.8
3pvs_A 447 Replication-associated recombination protein A; ma 99.8
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 99.8
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.8
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 99.79
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 99.79
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.79
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 99.79
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 99.77
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 99.77
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 99.77
3bos_A242 Putative DNA replication factor; P-loop containing 99.77
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 99.77
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 99.77
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 99.76
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 99.76
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.75
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 99.74
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 99.74
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 99.74
2chq_A319 Replication factor C small subunit; DNA-binding pr 99.73
1ojl_A304 Transcriptional regulatory protein ZRAR; response 99.72
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 99.72
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 99.71
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 99.71
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 99.71
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 99.7
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.7
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 99.7
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 99.65
3co5_A143 Putative two-component system transcriptional RES 99.65
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 99.65
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 99.64
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 99.6
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 99.58
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 99.47
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 99.45
2gno_A305 DNA polymerase III, gamma subunit-related protein; 99.45
3kw6_A78 26S protease regulatory subunit 8; structural geno 99.43
2krk_A86 26S protease regulatory subunit 8; structural geno 99.41
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 99.4
3f8t_A506 Predicted ATPase involved in replication control, 99.37
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 99.34
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 99.34
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 99.31
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 99.27
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.24
2wg5_A109 General control protein GCN4, proteasome-activatin 99.22
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 99.18
2fna_A357 Conserved hypothetical protein; structural genomic 99.18
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 99.13
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 99.06
2kjq_A149 DNAA-related protein; solution structure, NESG, st 99.0
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 98.96
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 98.93
2qgz_A308 Helicase loader, putative primosome component; str 98.89
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 98.81
3h43_A85 Proteasome-activating nucleotidase; regulatory par 98.76
1tue_A212 Replication protein E1; helicase, replication, E1E 98.7
3m9b_A251 Proteasome-associated ATPase; coil COIL with 5 bet 98.67
1jr3_D 343 DNA polymerase III, delta subunit; processivity, p 98.61
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 98.59
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 98.55
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 98.51
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 98.51
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 98.48
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 98.44
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 98.14
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 98.1
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 98.1
2cvh_A220 DNA repair and recombination protein RADB; filamen 98.08
1xp8_A366 RECA protein, recombinase A; recombination, radior 98.07
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 98.02
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 98.02
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 98.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 97.93
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 97.93
1u94_A356 RECA protein, recombinase A; homologous recombinat 97.89
2z43_A324 DNA repair and recombination protein RADA; archaea 97.89
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 97.82
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 97.79
3io5_A333 Recombination and repair protein; storage dimer, i 97.76
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 97.75
4a74_A231 DNA repair and recombination protein RADA; hydrola 97.74
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 97.73
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 97.69
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 97.69
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 97.68
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 97.68
3vaa_A199 Shikimate kinase, SK; structural genomics, center 97.66
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 97.62
2eyu_A261 Twitching motility protein PILT; pilus retraction 97.61
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.6
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 97.58
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 97.57
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 97.57
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 97.57
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 97.56
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 97.56
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 97.55
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 97.5
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 97.46
1kag_A173 SKI, shikimate kinase I; transferase, structural g 97.45
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 97.45
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 97.43
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 97.4
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 97.39
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 97.39
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 97.39
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 97.37
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 97.35
2r6a_A454 DNAB helicase, replicative helicase; replication, 97.35
1via_A175 Shikimate kinase; structural genomics, transferase 97.34
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 97.33
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 97.31
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 97.31
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 97.29
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 97.26
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 97.25
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 97.24
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 97.22
3cmw_A1706 Protein RECA, recombinase A; homologous recombinat 97.22
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 97.21
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 97.2
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 97.2
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 97.19
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 97.18
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 97.18
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 97.17
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 97.16
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.16
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 97.16
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 97.15
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 97.14
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 97.12
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 97.12
2ewv_A372 Twitching motility protein PILT; pilus retraction 97.11
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 97.1
2vli_A183 Antibiotic resistance protein; transferase, tunica 97.1
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 97.1
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 97.09
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 97.08
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 97.08
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 97.08
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 97.08
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 97.08
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 97.08
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 97.07
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 97.07
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 97.07
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 97.07
3tlx_A243 Adenylate kinase 2; structural genomics, structura 97.06
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 97.06
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 97.06
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 97.05
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 97.04
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 97.02
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 97.02
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 97.01
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 97.01
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 96.99
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 96.99
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 96.98
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 96.98
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 96.98
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 96.95
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 96.93
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 96.93
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 96.92
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 96.92
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 96.91
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 96.9
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 96.89
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 96.89
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 96.89
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 96.87
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 96.86
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 96.85
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 96.84
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 96.83
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 96.81
1vma_A306 Cell division protein FTSY; TM0570, structural gen 96.81
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 96.79
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 96.78
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 96.78
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 96.77
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 96.77
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 96.75
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 96.73
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 96.71
3b6e_A216 Interferon-induced helicase C domain-containing P; 96.69
3r20_A233 Cytidylate kinase; structural genomics, seattle st 96.69
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 96.68
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 96.66
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 96.66
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 96.63
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 96.63
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 96.62
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 96.61
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 96.6
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 96.59
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 96.58
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 96.56
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 96.54
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 96.54
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 96.54
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 96.53
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 96.52
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 96.52
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 96.52
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 96.51
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 96.5
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 96.5
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 96.5
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 96.49
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 96.49
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 96.48
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 96.47
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 96.43
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 96.43
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 96.43
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 96.43
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 96.42
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 96.39
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 96.39
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 96.38
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 96.34
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 96.34
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 96.33
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 96.32
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 96.31
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 96.31
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 96.3
4etp_A403 Kinesin-like protein KAR3; kinesin motor protein, 96.29
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 96.29
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 96.26
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 96.22
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 96.21
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 96.21
3u06_A412 Protein claret segregational; motor domain, stalk 96.2
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 96.19
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 96.18
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 96.18
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 96.18
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 96.16
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 96.14
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 96.13
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 96.12
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 96.12
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 96.11
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 96.1
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 96.09
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 96.08
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 96.07
2oap_1511 GSPE-2, type II secretion system protein; hexameri 96.06
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 96.03
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 95.99
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 95.97
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 95.96
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 95.94
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 95.93
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 95.88
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 95.87
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 95.85
4aby_A415 DNA repair protein RECN; hydrolase, double strand 95.84
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 95.82
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 95.81
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 95.79
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 95.75
3ice_A422 Transcription termination factor RHO; transcriptio 95.72
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 95.66
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 95.66
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 95.63
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 95.62
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 95.61
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 95.59
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 95.59
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 95.57
3bor_A237 Human initiation factor 4A-II; translation initiat 95.56
2xxa_A433 Signal recognition particle protein; protein trans 95.55
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 95.53
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 95.52
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 95.51
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 95.51
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 95.5
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 95.5
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 95.49
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 95.49
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 95.47
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 95.46
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 95.44
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 95.41
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 95.36
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 95.36
2og2_A359 Putative signal recognition particle receptor; nuc 95.33
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 95.29
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 95.26
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 95.25
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 95.23
1p9r_A418 General secretion pathway protein E; bacterial typ 95.2
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 95.2
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 95.19
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 95.16
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 95.13
1b0u_A262 Histidine permease; ABC transporter, transport pro 95.13
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 95.13
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 95.1
1sgw_A214 Putative ABC transporter; structural genomics, P p 95.1
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 95.09
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 95.08
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 95.06
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 95.03
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 95.02
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 95.02
2ghi_A260 Transport protein; multidrug resistance protein, M 95.01
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 95.0
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 95.0
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 95.0
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 95.0
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 94.99
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 94.98
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 94.98
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 94.98
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 94.97
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 94.97
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 94.97
3lxx_A239 GTPase IMAP family member 4; structural genomics c 94.96
1g6h_A257 High-affinity branched-chain amino acid transport 94.96
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 94.95
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 94.93
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 94.93
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 94.91
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 94.91
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 94.88
1ji0_A240 ABC transporter; ATP binding protein, structural g 94.86
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 94.85
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 94.85
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 94.84
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 94.79
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 94.77
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 94.72
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 94.69
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 94.66
3h1t_A 590 Type I site-specific restriction-modification syst 94.65
3t1o_A198 Gliding protein MGLA; G domain containing protein, 94.64
2ged_A193 SR-beta, signal recognition particle receptor beta 94.64
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 94.64
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 94.63
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 94.61
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 94.6
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 94.59
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 94.53
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 94.46
1xjc_A169 MOBB protein homolog; structural genomics, midwest 94.42
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 94.41
3kta_A182 Chromosome segregation protein SMC; structural mai 94.4
3lxw_A247 GTPase IMAP family member 1; immunity, structural 94.36
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 94.34
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 94.33
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 94.29
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 94.29
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 94.22
1nrj_B218 SR-beta, signal recognition particle receptor beta 94.22
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 94.2
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 94.17
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 94.16
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 94.16
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 94.15
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 94.15
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 94.14
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 94.14
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 94.12
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 94.1
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 94.08
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 94.04
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 93.99
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 93.99
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 93.98
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 93.98
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 93.97
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 93.92
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 93.89
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 93.87
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 93.86
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 93.85
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 93.84
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 93.81
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 93.8
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 93.78
2wji_A165 Ferrous iron transport protein B homolog; membrane 93.77
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 93.77
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 93.77
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 93.73
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 93.68
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 93.68
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 93.62
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 93.59
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 93.58
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 93.58
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 93.56
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 93.55
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 93.54
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 93.54
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 93.51
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 93.49
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 93.49
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 93.45
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 93.43
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 93.43
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 93.42
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 93.39
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 93.35
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 93.34
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 93.34
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 93.3
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 93.28
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 93.28
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 93.28
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 93.28
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 93.27
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 93.25
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 93.24
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 93.24
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 93.2
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 93.2
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 93.17
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 93.15
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 93.14
3m91_A51 Proteasome-associated ATPase; coil COIL alpha heli 93.1
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 93.08
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 93.07
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 93.07
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 93.06
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 93.01
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 93.0
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 92.95
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 92.92
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 92.91
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 92.91
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 92.87
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 92.83
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 92.83
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 92.82
2www_A349 Methylmalonic aciduria type A protein, mitochondri 92.79
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 92.79
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 92.79
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 92.79
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 92.78
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 92.78
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 92.76
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 92.75
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 92.67
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 92.67
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 92.64
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=1.1e-68  Score=540.69  Aligned_cols=415  Identities=69%  Similarity=1.088  Sum_probs=357.7

Q ss_pred             cccchhhHHhcCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCCceeeeeeecccCCCCCc
Q psy15151         17 GEESLGDDILRMSTDDINSRTRLLDNEIKIMKSEVMRISHELQAQNEKIRENTEKIKVNKNLPYLVSNVIELLDVDPQDT   96 (431)
Q Consensus        17 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   96 (431)
                      +.+.+.+++.++..++++.|.+.++.++..++.++.+++.+.+.++++++..++++..++.+|+.++++.+.+|......
T Consensus        14 ~~~~l~~ei~~~~~~~l~~r~~~le~e~~~l~~e~~r~~~e~~~~~~~~~~~~~~i~~~~~~p~~v~~~~e~~d~~~~~~   93 (434)
T 4b4t_M           14 GDDELDQEILNLSTQELQTRAKLLDNEIRIFRSELQRLSHENNVMLEKIKDNKEKIKNNRQLPYLVANVVEVMDMNEIED   93 (434)
T ss_dssp             ---------------------------CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCSSSCCEEEECCC--------
T ss_pred             CcchHHHHHHhccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccCCcchhhhhhhhhccchhhh
Confidence            45677888888888889999999999999999999999999999999999999999999999999999999887643211


Q ss_pred             ------cccccccccccccCCcEEEEecCCCceEEEeecccccccCCCCCCeEEEcCcchhhhhcCchhHHHHhhhhhcc
Q psy15151         97 ------EEDGAVVDLDAQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEVD  170 (431)
Q Consensus        97 ------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~  170 (431)
                            ...+..........+..++++.++++.+++.+.+.++++.++||+.|++++.++.++..+|...++.+..|...
T Consensus        94 ~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~l~~~~~v~~~~~~~~~~~~l~~~~d~~~~~~~~~  173 (434)
T 4b4t_M           94 KENSESTTQGGNVNLDNTAVGKAAVVKTSSRQTVFLPMVGLVDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVD  173 (434)
T ss_dssp             -------------------CCSEEEEEETTSCEEEEECCSSSCTTTSCSSEEEEECSSSCSEEEEEEESSSCSCSCCEEE
T ss_pred             hccchhhhhhhhhhhhhcccCceEEEEcCCCCeEEEecccccCHhHCCCCCEEeEcCcchhhheecCcccCchhhhcccC
Confidence                  22233444555566788999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCCcccccCchHHHHHHHHHhhccccChHHHHhcCCCCCCCceeeCCCCCchHHHHHHHHHHcCCceEEeehhhhhH
Q psy15151        171 ERPTEQYSDIGGLDKQIQELIEAVVLPMTHKEKFVNLGIQPPKGVLLYGPPGTGKTLLARACAAQTKSTFLKLAGPQLVQ  250 (431)
Q Consensus       171 ~~~~~~~~~i~G~~~~i~~l~~~i~~~~~~~~~~~~~g~~~~~~vLl~GppGtGKT~lakala~~~~~~~i~i~~~~l~~  250 (431)
                      +.|+++|++|+|++++++.|.+.+.+|+.+|+.|.++|+++|+|+|||||||||||++|+++|++++.+|+.++++++.+
T Consensus       174 ~~p~~t~~digGl~~~k~~l~e~v~~pl~~pe~f~~~g~~~prGvLLyGPPGTGKTllAkAiA~e~~~~f~~v~~s~l~~  253 (434)
T 4b4t_M          174 EKPTETYSDVGGLDKQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLAAPQLVQ  253 (434)
T ss_dssp             SSCSCCGGGSCSCHHHHHHHHHHTHHHHHCSHHHHHHCCCCCCEEEEESCTTSSHHHHHHHHHHHHTCEEEEEEGGGGCS
T ss_pred             CCCCCChHhcCcHHHHHHHHHHHHHHHHhCHHHHHhCCCCCCCeeEEECcCCCCHHHHHHHHHHHhCCCEEEEehhhhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhcchHHHHHHHHHHHHhCCCeEEEEccccccccCCCCCCCcCcHHHHHHHHHHHHhhcCCCCCCCeEEEEEeCCCCCC
Q psy15151        251 MFIGDGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFSSTADIKVIAATNRVDIL  330 (431)
Q Consensus       251 ~~~g~~~~~~~~lf~~a~~~~p~vl~iDEid~l~~~r~~~~~~~~~~~~~~l~~lL~~~~~~~~~~~v~vI~ttn~~~~l  330 (431)
                      +|+|++++.++.+|..|+..+||||||||+|.++++|.++..+++.+..+++.++|+.++++.+..+|+||+|||+|+.+
T Consensus       254 ~~vGese~~ir~lF~~A~~~aP~IifiDEiDal~~~R~~~~~~~~~~~~~~~~~lL~~ldg~~~~~~ViVIaaTNrp~~L  333 (434)
T 4b4t_M          254 MYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLELLNQLDGFSSDDRVKVLAATNRVDVL  333 (434)
T ss_dssp             SCSSHHHHHHHHHHHHHHHHCSEEEEEECTHHHHCCCSSGGGGTTHHHHHHHHHHHHHHTTSCSSCSSEEEEECSSCCCC
T ss_pred             cccchHHHHHHHHHHHHHhcCCeEEeecchhhhhhccCCCCCCCchHHHHHHHHHHHHhhccCCCCCEEEEEeCCCchhc
Confidence            99999999999999999999999999999999999998888888889999999999999999999999999999999999


Q ss_pred             ChhhhcCCCcceEEEcCCCCHHHHHHHHHHHHhcCCCCCCCCHHHHHHHcCCCCHHHHHHHHHHHHHHHHHhCCCCcCHH
Q psy15151        331 DPALLRSGRLDRKIEFPHPNEEARARIMQIHSRKMNVSPDVNYEELSRSTDDFNGAQCKAVCVEAGMIALRRGAAIVTHE  410 (431)
Q Consensus       331 ~~~l~r~gR~~~~i~~~~p~~~~r~~Il~~~l~~~~~~~~~~~~~la~~~~g~s~~di~~l~~~A~~~A~~~~~~~It~e  410 (431)
                      ||+++||||||+.|+|+.|+.++|.+||+.+++++.+..++++..||..|.||||+||.++|++|++.|+++++..|+.+
T Consensus       334 D~AllRpGRfD~~I~i~lPd~~~R~~Il~~~~~~~~~~~dvdl~~lA~~t~G~sGADi~~l~~eA~~~a~r~~~~~i~~~  413 (434)
T 4b4t_M          334 DPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRKMTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHE  413 (434)
T ss_dssp             CTTTCSTTSEEEEEECCCCCHHHHHHHHHHHHHHSCBCSCCCHHHHHHHCSSCCHHHHHHHHHHHHHHHHHHTCSSBCHH
T ss_pred             CHhHhcCCceeEEEEeCCcCHHHHHHHHHHHhcCCCCCCcCCHHHHHHhCCCCCHHHHHHHHHHHHHHHHHcCCCCcCHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhhhcccCCCC
Q psy15151        411 DFMDAIMEVQAKKKANLNYYA  431 (431)
Q Consensus       411 d~~~Al~~~~~~~~~~~~~~~  431 (431)
                      ||..|+++++++++..+.|||
T Consensus       414 Df~~Al~~v~~~~~~~i~~Ya  434 (434)
T 4b4t_M          414 DFVEGISEVQARKSKSVSFYA  434 (434)
T ss_dssp             HHHHHHHSCSSSCCCCCCCCC
T ss_pred             HHHHHHHHHhCCCCcCccccC
Confidence            999999999999999999997



>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2wg5_A General control protein GCN4, proteasome-activating nucleotidase; transcription hydrolase complex, nucleotide-binding; 2.10A {Saccharomyces cerevisiae} PDB: 2wg6_A Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>3h43_A Proteasome-activating nucleotidase; regulatory particle, nucleosidase, ATP-binding, cytoplasm, nucleotide-binding, hydrolase; 2.10A {Methanocaldococcus jannaschii} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 431
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 1e-99
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 4e-98
d1r7ra3265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 7e-74
d1e32a2258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 1e-59
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 1e-45
d1d2na_246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 7e-30
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 1e-28
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 2e-27
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 2e-21
d1ixsb2239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 3e-20
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 3e-17
d1ofha_309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 7e-16
d1in4a2238 c.37.1.20 (A:17-254) Holliday junction helicase Ru 7e-12
d1sxja2253 c.37.1.20 (A:295-547) Replication factor C1 {Baker 1e-07
d1g8pa_333 c.37.1.20 (A:) ATPase subunit of magnesium chelata 2e-06
d1ny5a2247 c.37.1.20 (A:138-384) Transcriptional activator si 2e-05
d1g41a_ 443 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 4e-05
d1sxje2252 c.37.1.20 (E:4-255) Replication factor C5 {Baker's 6e-05
d2fnaa2283 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfo 4e-04
d1r6bx2268 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, A 0.001
d1a5ta2207 c.37.1.20 (A:1-207) delta prime subunit of DNA pol 0.003
d1um8a_364 c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 2 0.003
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]
 Score =  295 bits (758), Expect = 1e-99
 Identities = 101/255 (39%), Positives = 155/255 (60%), Gaps = 1/255 (0%)

Query: 167 MEVDERPTEQYSDIGGLDKQIQELIEAVVLPMTHKEKFVNLGIQPPKGVLLYGPPGTGKT 226
           M  +++    ++D+ G D+  +E+ E V   +    +F  LG + PKGVL+ GPPGTGKT
Sbjct: 1   MLTEDQIKTTFADVAGCDEAKEEVAELVEY-LREPSRFQKLGGKIPKGVLMVGPPGTGKT 59

Query: 227 LLARACAAQTKSTFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDELDAIGTK 286
           LLA+A A + K  F  ++G   V+MF+G GA  VRD F  AK+ AP IIFIDE+DA+G +
Sbjct: 60  LLAKAIAGEAKVPFFTISGSDFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQ 119

Query: 287 RFDSEKAGDREVQRTMLELLNQLDGFSSTADIKVIAATNRVDILDPALLRSGRLDRKIEF 346
           R      G  E ++T+ ++L ++DGF     I VIAATNR D+LDPALLR GR DR++  
Sbjct: 120 RGAGLGGGHDEREQTLNQMLVEMDGFEGNEGIIVIAATNRPDVLDPALLRPGRFDRQVVV 179

Query: 347 PHPNEEARARIMQIHSRKMNVSPDVNYEELSRSTDDFNGAQCKAVCVEAGMIALRRGAAI 406
             P+   R +I+++H R++ ++PD++   ++R T  F+GA    +  EA + A R    +
Sbjct: 180 GLPDVRGREQILKVHMRRVPLAPDIDAAIIARGTPGFSGADLANLVNEAALFAARGNKRV 239

Query: 407 VTHEDFMDAIMEVQA 421
           V+  +F  A  ++  
Sbjct: 240 VSMVEFEKAKDKIMM 254


>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253 Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 247 Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 252 Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Length = 283 Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 268 Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 207 Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Length = 364 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query431
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 100.0
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 100.0
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.93
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.92
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.91
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.91
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.88
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.81
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.81
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.81
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.8
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.8
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.8
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.79
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.76
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.75
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.73
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.72
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.71
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 99.7
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.67
d1svma_362 Papillomavirus large T antigen helicase domain {Si 99.66
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.59
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 99.58
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 99.52
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.51
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.5
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 99.42
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 99.25
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 99.25
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 99.09
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.62
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 98.2
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 98.19
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 98.13
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.94
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.94
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.91
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.89
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.86
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.84
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 97.8
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.79
d2hyda1255 Putative multidrug export ATP-binding/permease pro 97.76
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.74
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.74
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.73
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 97.71
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.68
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.62
d1tuea_205 Replication protein E1 helicase domain {Human papi 97.61
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.61
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 97.6
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 97.59
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 97.59
d1g2912240 Maltose transport protein MalK, N-terminal domain 97.56
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.55
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 97.54
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.54
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 97.54
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.53
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.52
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 97.52
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 97.49
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 97.48
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 97.48
d2awna2232 Maltose transport protein MalK, N-terminal domain 97.46
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.43
d2qy9a2211 GTPase domain of the signal recognition particle r 97.4
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 97.39
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 97.39
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.38
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 97.38
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.38
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 97.36
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 97.36
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 97.36
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 97.32
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 97.31
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 97.31
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.29
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 97.27
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 97.26
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 97.26
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 97.24
d1okkd2207 GTPase domain of the signal recognition particle r 97.24
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 97.21
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 97.2
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 97.2
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 97.19
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 97.15
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 97.13
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.08
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 97.08
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 97.07
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 97.01
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 96.97
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.96
d1vmaa2213 GTPase domain of the signal recognition particle r 96.95
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.92
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.91
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 96.91
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 96.84
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.84
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.83
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 96.81
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 96.78
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 96.71
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 96.63
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.58
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 96.52
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 96.49
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 96.42
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 96.41
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 96.4
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 96.38
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 96.33
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.29
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 96.29
d2fh5b1207 Signal recognition particle receptor beta-subunit 96.24
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 96.17
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 96.12
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 95.92
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 95.9
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 95.88
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 95.87
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 95.69
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 95.67
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 95.66
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 95.65
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 95.58
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 95.56
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 95.52
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.49
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 95.48
d1nrjb_209 Signal recognition particle receptor beta-subunit 95.41
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.41
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.37
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 95.15
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 95.1
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 95.07
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 94.96
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 94.89
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 94.87
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 94.77
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.74
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 94.68
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 94.68
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 94.67
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.6
d2ncda_368 Kinesin motor Ncd (non-claret disjunctional) {Frui 94.56
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 94.55
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 94.54
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 94.48
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 94.46
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 94.4
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 94.38
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 94.33
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.23
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 94.15
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 94.01
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 94.01
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 93.91
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 93.86
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 93.85
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 93.81
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 93.81
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 93.76
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 93.7
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 93.66
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.6
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 93.56
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 93.51
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 93.5
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 93.46
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 93.38
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 93.37
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 93.31
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 93.3
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 93.29
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 93.28
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 93.27
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 93.24
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 93.24
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 93.16
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 93.11
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 92.95
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 92.93
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 92.91
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 92.86
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 92.8
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 92.79
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 92.75
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 92.75
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 92.75
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 92.66
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 92.66
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 92.6
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 92.55
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 92.53
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 92.47
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 92.44
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 92.4
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 92.33
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 92.28
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 92.25
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 92.17
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 92.14
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 92.06
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 91.98
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 91.84
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 91.81
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 91.75
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 91.49
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 91.48
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 91.45
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 91.45
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 91.43
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 91.32
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 91.32
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 91.25
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 91.09
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 90.86
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 90.78
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 90.69
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 90.56
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 90.49
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 90.44
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 90.31
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 89.77
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 89.73
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 89.59
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 89.57
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 89.53
d1t5la1 413 Nucleotide excision repair enzyme UvrB {Bacillus c 88.6
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 88.29
d1xpua3289 Transcription termination factor Rho, ATPase domai 87.52
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 87.25
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 87.21
d1p6xa_ 333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 87.04
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 86.55
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 85.78
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 85.6
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 84.72
d1e2ka_ 329 Thymidine kinase {Herpes simplex virus type 1, dif 83.95
d1osna_ 331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 83.64
d1j3ba1318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 83.59
d2olra1313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 82.65
d1c4oa1 408 Nucleotide excision repair enzyme UvrB {Thermus th 82.24
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 82.18
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 81.82
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 81.57
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 81.17
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 81.05
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 80.95
d1ii2a1323 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 80.51
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 80.4
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=1e-47  Score=362.06  Aligned_cols=250  Identities=40%  Similarity=0.684  Sum_probs=231.2

Q ss_pred             ccCCCCCcccccCchHHHHHHHHHhhccccChHHHHhcCCCCCCCceeeCCCCCchHHHHHHHHHHcCCceEEeehhhhh
Q psy15151        170 DERPTEQYSDIGGLDKQIQELIEAVVLPMTHKEKFVNLGIQPPKGVLLYGPPGTGKTLLARACAAQTKSTFLKLAGPQLV  249 (431)
Q Consensus       170 ~~~~~~~~~~i~G~~~~i~~l~~~i~~~~~~~~~~~~~g~~~~~~vLl~GppGtGKT~lakala~~~~~~~i~i~~~~l~  249 (431)
                      ++.+.++|+||+|++++++++.+.+. ++.+++.|.++|..+++++|||||||||||++|+++|++++.+++.++++.+.
T Consensus         4 ~~~~~~t~~Di~Gl~~~k~~l~e~v~-~~~~~~~~~~~g~~~~~~iLL~GppGtGKT~la~~iA~~~~~~~~~i~~~~l~   82 (256)
T d1lv7a_           4 EDQIKTTFADVAGCDEAKEEVAELVE-YLREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFV   82 (256)
T ss_dssp             ECSSCCCGGGSCSCHHHHHHTHHHHH-HHHCGGGC-----CCCCEEEEECCTTSCHHHHHHHHHHHHTCCEEEECSCSST
T ss_pred             CCCCCCCHHHHhchHHHHHHHHHHHH-HHHCHHHHHHcCCCCCCeEEeeCCCCCCccHHHHHHHHHcCCCEEEEEhHHhh
Confidence            45678999999999999999998776 58899999999999999999999999999999999999999999999999999


Q ss_pred             HhhhcchHHHHHHHHHHHHhCCCeEEEEccccccccCCCCCCCcCcHHHHHHHHHHHHhhcCCCCCCCeEEEEEeCCCCC
Q psy15151        250 QMFIGDGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFSSTADIKVIAATNRVDI  329 (431)
Q Consensus       250 ~~~~g~~~~~~~~lf~~a~~~~p~vl~iDEid~l~~~r~~~~~~~~~~~~~~l~~lL~~~~~~~~~~~v~vI~ttn~~~~  329 (431)
                      ++|+|+++..++.+|+.|+.++||||||||+|.++..|.......+....+.+.++++.+++.....+++||+|||+|+.
T Consensus        83 ~~~~g~~~~~l~~~f~~A~~~~P~il~iDeiD~l~~~r~~~~~~~~~~~~~~~~~ll~~~d~~~~~~~v~vIatTn~~~~  162 (256)
T d1lv7a_          83 EMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFEGNEGIIVIAATNRPDV  162 (256)
T ss_dssp             TSCCCCCHHHHHHHHHHHHTTCSEEEEETTHHHHTCCCSTTSCCTTCHHHHHHHHHHHHHHTCCSSSCEEEEEEESCTTT
T ss_pred             hcchhHHHHHHHHHHHHHHHcCCEEEEEEChhhhCccCCCCCCCCcHHHHHHHHHHHHHhhCCCCCCCEEEEEeCCCccc
Confidence            99999999999999999999999999999999999988776666666777788899999998888889999999999999


Q ss_pred             CChhhhcCCCcceEEEcCCCCHHHHHHHHHHHHhcCCCCCCCCHHHHHHHcCCCCHHHHHHHHHHHHHHHHHhCCCCcCH
Q psy15151        330 LDPALLRSGRLDRKIEFPHPNEEARARIMQIHSRKMNVSPDVNYEELSRSTDDFNGAQCKAVCVEAGMIALRRGAAIVTH  409 (431)
Q Consensus       330 l~~~l~r~gR~~~~i~~~~p~~~~r~~Il~~~l~~~~~~~~~~~~~la~~~~g~s~~di~~l~~~A~~~A~~~~~~~It~  409 (431)
                      +||+++||||||..|+|++|+.++|.+|++.+++++.+..++++..++..+.||+++||.++|++|+..|.++++..|+.
T Consensus       163 ld~al~R~gRfd~~i~i~~P~~~~R~~il~~~l~~~~~~~~~~~~~la~~t~G~s~adi~~l~~~A~~~a~~~~~~~i~~  242 (256)
T d1lv7a_         163 LDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVPLAPDIDAAIIARGTPGFSGADLANLVNEAALFAARGNKRVVSM  242 (256)
T ss_dssp             SCGGGGSTTSSCEEEECCCCCHHHHHHHHHHHHTTSCBCTTCCHHHHHHTCTTCCHHHHHHHHHHHHHHHHHTTCSSBCH
T ss_pred             CCHhHcCCCCCCEEEECCCcCHHHHHHHHHHhccCCCcCcccCHHHHHHhCCCCCHHHHHHHHHHHHHHHHHcCCCccCH
Confidence            99999999999999999999999999999999999999899999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHH
Q psy15151        410 EDFMDAIMEVQ  420 (431)
Q Consensus       410 ed~~~Al~~~~  420 (431)
                      +||..|++++.
T Consensus       243 ~d~~~Al~rv~  253 (256)
T d1lv7a_         243 VEFEKAKDKIM  253 (256)
T ss_dssp             HHHHHHHHHHT
T ss_pred             HHHHHHHHHHh
Confidence            99999999874



>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure