Psyllid ID: psy15852


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-
MTAESQDVEMTTTENGQENGGAPVSVKDDDRKLFCPLSSYLELDYLQLWQYFDWVSSSFSENCLLEDSIGKPLTVSCSHHYYLFDQILRTHFFYIMEAKNKMVSHPGIVHKITEELKEHFSKYGEIENVTLKSDPNTGRSRGFAFIVFKDTESLEKASVEDVIAEGNHVINNKKIEAKKAKAKSGKIFVGGLSPEMKDEEIKAHFAQFGNIIETEMPYDKSKSQRKNFCFITFEHESVVIDLLKNPKQKINDKEVDVKKATPKPEPFGVRGGRGGRGGRGGRGGRMAGGYGGYGGYGGGYGGILYKPLLFYELNELGISGRSLVCRTGPMVQATPPLAEVDVTGVIMILLGAKNHNSDENPTSRSHPSQNAIKLYLTRSSYREWGHVADNLLLCDNFPSIRELEIPEAFLTKTTTVPMTTTEHMVLVTGTDMMHMEVTEAVPMEIIETEMPYDKSKSQRKNFCFITFEHESVVIDLLKNPKQKINDKEVDVKKATPKPEPFGVRGGRGGRGGRGGRGGRMAGGYGGYGGYGGGYGELDYLQLWQFFDWISSSFSENCLLEDSIGKPLTVSCSHYHYLFDQNLRTHYFYIVEAKNKMVSHPGIVDKITEELKEHFSKYGEIENVTLKSDPNTGRSRGFAFIVFKDTESLEKASVEDVYFYSN
ccccccccccccccccccccccccccccccccEEEcccccccccHHHHHHHHHccccEEEEEEEcccccccccccccccEEEEccEEEccccccccccccccEEEccccccccHHHHHHHHccccEEEEEEEcccccccccccEEEEEccHHHHHHHHHHHHHcccccEEccccccccccccccccEEEEcccccccHHHHHHHHHccccEEEEEEEccccccccccEEEEEEcccHHHHHHHHcccEEEccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccEEEEccccccccccccccEEEcccccccEEEEcccccccccccccccccccEEEEEcccccHHHHHHcccccEEEEEEEccccccccccEEEEEEcccHHHHHHHHcccEEEccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccHHHHHHHHHccccEEEEEEEEcccccccccEEEEEEcccHHHHHHHHcccccccc
ccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHHHcccEEEEEEEEcccccccEEEEEccccccccccccccccccccccccEEEEcccccccHHHHHHHHHHcccEEEEEEEEcccccccccEEEEEEccHHHHHHHHHcccccccccEEEcEEEccccccccccEEEEccccccccHHHHHHHHHHcccEEEEEEEEccccccccccEEEEEccHHHHHHHHHccccEEcccEEEEEEcccccccccHcccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccHHHHHHHHcHHHHHHHcccccccHHHcccHHHHHHccHHHcccccccccccccEEEEcccccccccEEEEEEcccEEEEEEEEEcccccccccEEEEEEccHHHHHHHHHHccccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccHccccccEEEEccccEEccccccccEEEEHHHHHHHcccccccccccHHHHHHHHHHcccEEEEEEEEcccccccccEEEEEEcccccccHEEEccccEEcc
mtaesqdvemtttengqenggapvsvkdddrklfcplssyleLDYLQLWQYFDwvsssfsenclledsigkpltvscshHYYLFDQILRTHFFYIMEAKnkmvshpgiVHKITEELKEHFskygeienvtlksdpntgrsrgfAFIVFKDTESLEKASVEDVIAEGNHVINNKKIEAKKAkaksgkifvgglspemkDEEIKAHFAQFGNiietempydksksqrknfcfiTFEHESVVIDLlknpkqkindkevdvkkatpkpepfgvrggrggrggrggrggrmaggyggyggygggyggilykplLFYELNElgisgrslvcrtgpmvqatpplaevdVTGVIMILLGaknhnsdenptsrshpsqnAIKLYLTRSsyrewghvadnlllcdnfpsireleipeafltktttvpmtttEHMVLVTGTDMMHMEVTEAVPMEiietempydksksqrknfcfiTFEHESVVIDLlknpkqkindkevdvkkatpkpepfgvrggrggrggrggrggrmaggyggyggygggygelDYLQLWQFFDwisssfsenclledsigkpltvscshyhylfdqNLRTHYFYIVEAKnkmvshpgiVDKITEELKEHFSkygeienvtlksdpntgrsrgfAFIVFKDteslekasvedvyfysn
mtaesqdvemtttengqenggapvsvkdddRKLFCPLSSYLELDYLQLWQYFDWVSSSFSENCLLEDSIGKPLTVSCSHHYYLFDQILRTHFFYIMEAKNKMVSHPGIVHKITEELKEHFSKYGEIEnvtlksdpntgrsRGFAFIVFKDTESLEKASVEdviaegnhvinnkkieakkakaksgkifvgglspeMKDEEIKAHFAQFGNIIETEMPYDKSKSQRKNFCFITFEHESVVidllknpkqkindkevdvkkatpkpepfgvrggrggrggrggrggRMAGGYGGYGGYGGGYGGILYKPLLFYELNELGISGRSLVCRTGPMVQATPPLAEVDVTGVIMILLGAKnhnsdenptsrshpsqnAIKLYLTRSSYREWGHVADNLLLCDNFPSIRELEIpeafltktttvpmttTEHMVLVTGTDMMHMEVTEAVPMEIIETEMPYDKSKSQRKNFCFITFEHESVVidllknpkqkindkevdvkkatpkpepfgvrggrggrggrggrggrMAGGYGGYGGYGGGYGELDYLQLWQFFDWISSSFSENCLLEDSIGKPLTVSCSHYHYLFDQNLRTHYFYIVEAKNKMVSHPGIVDKITEELKEHFSKYgeienvtlksdpntgrsRGFAFIVfkdteslekasvedvyfysn
MTAESQDVEMTTTENGQENGGAPVSVKDDDRKLFCPLSSYLELDYLQLWQYFDWVSSSFSENCLLEDSIGKPLTVSCSHHYYLFDQILRTHFFYIMEAKNKMVSHPGIVHKITEELKEHFSKYGEIENVTLKSDPNTGRSRGFAFIVFKDTESLEKASVEDVIAEGNHVINNkkieakkakaksgkIFVGGLSPEMKDEEIKAHFAQFGNIIETEMPYDKSKSQRKNFCFITFEHESVVIDLLKNPKQKINDKEVDVKKATPKPEPFgvrggrggrggrggrggrmaggyggyggygggyggILYKPLLFYELNELGISGRSLVCRTGPMVQATPPLAEVDVTGVIMILLGAKNHNSDENPTSRSHPSQNAIKLYLTRSSYREWGHVADNLLLCDNFPSIRELEIPEAFLtktttvpmtttEHMVLVTGTDMMHMEVTEAVPMEIIETEMPYDKSKSQRKNFCFITFEHESVVIDLLKNPKQKINDKEVDVKKATPKPEPFgvrggrggrggrggrggrmaggyggyggygggygELDYLQLWQFFDWISSSFSENCLLEDSIGKPLTVSCSHYHYLFDQNLRTHYFYIVEAKNKMVSHPGIVDKITEELKEHFSKYGEIENVTLKSDPNTGRSRGFAFIVFKDTESLEKASVEDVYFYSN
*******************************KLFCPLSSYLELDYLQLWQYFDWVSSSFSENCLLEDSIGKPLTVSCSHHYYLFDQILRTHFFYIMEAKNKMVSHPGIVHKITEELKEHFSKYGEIENVTL********SRGFAFIVFKDTESLEKASVEDVIAEGNHVINN*************KIFVGGL********IKAHFAQFGNIIETEMPY******RKNFCFITFEHESVVIDLLK*****************************************MAGGYGGYGGYGGGYGGILYKPLLFYELNELGISGRSLVCRTGPMVQATPPLAEVDVTGVIMILLGA******************AIKLYLTRSSYREWGHVADNLLLCDNFPSIRELEIPEAFLTKTTTVPMTTTEHMVLVTGTDMMHMEVTEAVPMEIIETE*********RKNFCFITFEHESVVIDLLK*****************************************MAGGYGGYGGYGGGYGELDYLQLWQFFDWISSSFSENCLLEDSIGKPLTVSCSHYHYLFDQNLRTHYFYIVEAKNKMVSHPGIVDKITEELKEHFSKYGEIENVTL********SRGFAFIVFKDTESLEKASVEDVYF***
********************************LFCPLSSYLELDYLQLWQYFDWVSSSFSENCLLEDSIGKPLTVSCSHHYYLF******************VSHPGIVHKITEELKEHFSKYGEIENVTLKSDPNTGRSRGFAFIVFKDTESLEKASVEDVIAEGNHVIN***IE*****AKSGKIFVGGLSPEMKDEEIKAHFAQFGNIIETEMPYDKSKSQRKNFCFITFEHESVVIDLLKNPKQKINDKEVDV*********************************************************************************************************************YLTRSSYREWGHVADNLLLCDNFPSIREL**********************LVTGTDMMHMEVTEAVPMEIIETEMPYDKSKSQRKNFCFITFEHESVVIDLLKNPKQKINDKEVDV**********************GGRGGRMAGGYGGYGGYGGGYGELDYLQLWQFFDWISSSFSENCLLEDS*********************************MVSHPGIVDKITEELKEHFSKYGEIENVTLKSDPNTGRSRGFAFIVFKDTESLEKASVEDVYF***
*********************APVSVKDDDRKLFCPLSSYLELDYLQLWQYFDWVSSSFSENCLLEDSIGKPLTVSCSHHYYLFDQILRTHFFYIMEAKNKMVSHPGIVHKITEELKEHFSKYGEIENVTLKSDPNTGRSRGFAFIVFKDTESLEKASVEDVIAEGNHVINNKKIE********GKIFVGGLSPEMKDEEIKAHFAQFGNIIETEMPYDKSKSQRKNFCFITFEHESVVIDLLKNPKQKINDKEVDVKKATPKPEPFGVRGG**********GGRMAGGYGGYGGYGGGYGGILYKPLLFYELNELGISGRSLVCRTGPMVQATPPLAEVDVTGVIMILLGAKNH*************QNAIKLYLTRSSYREWGHVADNLLLCDNFPSIRELEIPEAFLTKTTTVPMTTTEHMVLVTGTDMMHMEVTEAVPMEIIETEMPYDKSKSQRKNFCFITFEHESVVIDLLKNPKQKINDKEVDVKKATPKPEPFGVRGG**********GGRMAGGYGGYGGYGGGYGELDYLQLWQFFDWISSSFSENCLLEDSIGKPLTVSCSHYHYLFDQNLRTHYFYIVEAKNKMVSHPGIVDKITEELKEHFSKYGEIENVTLKSDPNTGRSRGFAFIVFKDTESLEKASVEDVYFYSN
*****************************DRKLFCPLSSYLELDYLQLWQYFDWVSSSFSENCLLEDSIGKPLTVSCSHHYYLFDQIL*********AKNKMVSHPGIVHKITEELKEHFSKYGEIENVTLKSDPNTGRSRGFAFIVFKDTESLEKASVEDVIAEGNHVINNKKIEAKKAKAKSGKIFVGGLSPEMKDEEIKAHFAQFGNIIETEMPYDKSKSQRKNFCFITFEHESVVIDLLKNPKQKINDKEVDVKKATP****************RGGRGGRMAGGYGGYGGYGGGYGGILYKPLLFYELNELGISGRSLVCRTGPMVQATPPLAEVDVTGVIMILLGAKN************PSQNAIKLYLTRSSYREWGHVADNLLLCDNFPSIRELEIPEAFLTKTTTVPMTTTEHMVLVTGTDMMHMEVTEAVPMEIIETEMPYDKSKSQRKNFCFITFEHESVVIDLLKNPKQKINDKEVDVKKATPK******************RGGRMAGGYGGYGGYGGGYGELDYLQLWQFFDWISSSFSENCLLEDSIGKPLTVSCSHYHYLFDQNLRTHYFYIVEAKNKMVSHPGIVDKITEELKEHFSKYGEIENVTLKSDPNTGRSRGFAFIVFKDTESLEKASVEDVYFYSN
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTAESQDVEMTTTENGQENGGAPVSVKDDDRKLFCPLSSYLELDYLQLWQYFDWVSSSFSENCLLEDSIGKPLTVSCSHHYYLFDQILRTHFFYIMEAKNKMVSHPGIVHKITEELKEHFSKYGEIENVTLKSDPNTGRSRGFAFIVFKDTESLEKASVEDVIAEGNHVINNKKIEAKKAKAKSGKIFVGGLSPEMKDEEIKAHFAQFGNIIETEMPYDKSKSQRKNFCFITFEHESVVIDLLKNPKQKINDKEVDVKKATPKPEPFGVRGGRGGRGGRGGRGGRMAGGYGGYGGYGGGYGGILYKPLLFYELNELGISGRSLVCRTGPMVQATPPLAEVDVTGVIMILLGAKNHNSDENPTSRSHPSQNAIKLYLTRSSYREWGHVADNLLLCDNFPSIRELEIPEAFLTKTTTVPMTTTEHMVLVTGTDMMHMEVTEAVPMEIIETEMPYDKSKSQRKNFCFITFEHESVVIDLLKNPKQKINDKEVDVKKATPKPEPFGVRGGRGGRGGRGGRGGRMAGGYGGYGGYGGGYGELDYLQLWQFFDWISSSFSENCLLEDSIGKPLTVSCSHYHYLFDQNLRTHYFYIVEAKNKMVSHPGIVDKITEELKEHFSKYGEIENVTLKSDPNTGRSRGFAFIVFKDTESLEKASVEDVYFYSN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query661 2.2.26 [Sep-21-2011]
Q08473344 RNA-binding protein squid no N/A 0.232 0.447 0.65 4e-54
Q3SWU3322 Heterogeneous nuclear rib no N/A 0.219 0.450 0.419 7e-28
Q5ZI72301 Heterogeneous nuclear rib yes N/A 0.219 0.481 0.425 8e-28
O14979420 Heterogeneous nuclear rib no N/A 0.219 0.345 0.419 1e-27
Q6NU14291 Heterogeneous nuclear rib N/A N/A 0.219 0.498 0.412 2e-27
Q9Z130301 Heterogeneous nuclear rib no N/A 0.219 0.481 0.419 3e-27
Q640A2297 Heterogeneous nuclear rib no N/A 0.219 0.488 0.412 3e-27
Q7ZX83293 Heterogeneous nuclear rib N/A N/A 0.219 0.494 0.412 4e-27
Q99020285 Heterogeneous nuclear rib no N/A 0.219 0.508 0.422 2e-26
Q60668355 Heterogeneous nuclear rib no N/A 0.219 0.408 0.406 8e-26
>sp|Q08473|SQD_DROME RNA-binding protein squid OS=Drosophila melanogaster GN=sqd PE=1 SV=3 Back     alignment and function desciption
 Score =  213 bits (542), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 128/160 (80%), Gaps = 6/160 (3%)

Query: 107 GIVHKITE-ELKEHFSKYGEIENVTLKSDPNTGRSRGFAFIVFKDTESLEKASVEDVIAE 165
           G+  + TE EL++HF KYGEIE++ +K+DP TGRSRGFAFIVF +TE+++K S  D    
Sbjct: 62  GLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAAD---- 117

Query: 166 GNHVINNKKIEAKKAKAKSGKIFVGGLSPEMKDEEIKAHFAQFGNIIETEMPYDKSKSQR 225
             H+IN+KK++ KKAKA+ GKIFVGGL+ E+ DEEIK +F QFGNI+E EMP+DK KSQR
Sbjct: 118 -EHIINSKKVDPKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQR 176

Query: 226 KNFCFITFEHESVVIDLLKNPKQKINDKEVDVKKATPKPE 265
           K FCFITF+ E VV DLLK PKQKI  KEVDVK+ATPKPE
Sbjct: 177 KGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPKPE 216




This protein is a component of ribonucleosomes. Could be needed to organize a concentration gradient of a dorsalizing morphogen (Dm) originating in the germinal vesicle. At least one of the isoforms is essential in somatic tissues.
Drosophila melanogaster (taxid: 7227)
>sp|Q3SWU3|HNRDL_RAT Heterogeneous nuclear ribonucleoprotein D-like OS=Rattus norvegicus GN=Hnrpdl PE=2 SV=1 Back     alignment and function description
>sp|Q5ZI72|HNRDL_CHICK Heterogeneous nuclear ribonucleoprotein D-like OS=Gallus gallus GN=HNRPDL PE=2 SV=1 Back     alignment and function description
>sp|O14979|HNRDL_HUMAN Heterogeneous nuclear ribonucleoprotein D-like OS=Homo sapiens GN=HNRPDL PE=1 SV=3 Back     alignment and function description
>sp|Q6NU14|HNDLB_XENLA Heterogeneous nuclear ribonucleoprotein D-like-B OS=Xenopus laevis GN=hnrpdl-b PE=2 SV=1 Back     alignment and function description
>sp|Q9Z130|HNRDL_MOUSE Heterogeneous nuclear ribonucleoprotein D-like OS=Mus musculus GN=Hnrpdl PE=1 SV=1 Back     alignment and function description
>sp|Q640A2|HNRDL_XENTR Heterogeneous nuclear ribonucleoprotein D-like OS=Xenopus tropicalis GN=hnrpdl PE=2 SV=1 Back     alignment and function description
>sp|Q7ZX83|HNDLA_XENLA Heterogeneous nuclear ribonucleoprotein D-like-A OS=Xenopus laevis GN=hnrpdl-a PE=2 SV=1 Back     alignment and function description
>sp|Q99020|ROAA_MOUSE Heterogeneous nuclear ribonucleoprotein A/B OS=Mus musculus GN=Hnrnpab PE=1 SV=1 Back     alignment and function description
>sp|Q60668|HNRPD_MOUSE Heterogeneous nuclear ribonucleoprotein D0 OS=Mus musculus GN=Hnrnpd PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query661
1209409297 hnRNP protein [Chironomus tentans] 0.232 0.518 0.631 9e-53
312372973293 hypothetical protein AND_19410 [Anophele 0.226 0.511 0.664 1e-52
24646609321 squid, isoform A [Drosophila melanogaste 0.232 0.479 0.65 2e-52
390178414310 GA14206, isoform C [Drosophila pseudoobs 0.232 0.496 0.643 2e-52
390178412319 GA14206, isoform B [Drosophila pseudoobs 0.232 0.482 0.643 2e-52
24646605308 squid, isoform C [Drosophila melanogaste 0.232 0.5 0.65 2e-52
11040345 hrp40.2 [Drosophila melanogaster] 0.232 0.446 0.65 3e-52
24646607344 squid, isoform B [Drosophila melanogaste 0.232 0.447 0.65 3e-52
194901408345 GG17035 [Drosophila erecta] gi|190651947 0.232 0.446 0.65 3e-52
157110306292 heterogeneous nuclear ribonucleoprotein 0.222 0.503 0.671 3e-52
>gi|1209409|emb|CAA90716.1| hnRNP protein [Chironomus tentans] Back     alignment and taxonomy information
 Score =  214 bits (546), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 134/160 (83%), Gaps = 6/160 (3%)

Query: 107 GIVHKITE-ELKEHFSKYGEIENVTLKSDPNTGRSRGFAFIVFKDTESLEKASVEDVIAE 165
           G+  + TE EL++HF +YGEI+++ +K+DP TGRSRGFAFIV+K  +S++K     V+A 
Sbjct: 46  GLSWETTEKELRDHFGQYGEIDSINVKTDPTTGRSRGFAFIVYKSADSIDK-----VVAA 100

Query: 166 GNHVINNKKIEAKKAKAKSGKIFVGGLSPEMKDEEIKAHFAQFGNIIETEMPYDKSKSQR 225
           G+H+INNKK++ KKAKA++GKIFVGGL PE+ D+EI+A+FAQFGNI+E EMP+DK K+QR
Sbjct: 101 GDHIINNKKVDPKKAKARTGKIFVGGLIPEISDDEIRAYFAQFGNIVEMEMPFDKQKNQR 160

Query: 226 KNFCFITFEHESVVIDLLKNPKQKINDKEVDVKKATPKPE 265
           K FCFITF+ E+VV +LLK PKQ I+ KEVDVKKATPKP+
Sbjct: 161 KAFCFITFDSETVVNELLKTPKQTISGKEVDVKKATPKPD 200




Source: Chironomus tentans

Species: Chironomus tentans

Genus: Chironomus

Family: Chironomidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|312372973|gb|EFR20814.1| hypothetical protein AND_19410 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|24646609|ref|NP_731826.1| squid, isoform A [Drosophila melanogaster] gi|11038|emb|CAA44503.1| hrp40.1 [Drosophila melanogaster] gi|21428420|gb|AAM49870.1| LD09691p [Drosophila melanogaster] gi|23171185|gb|AAF54964.2| squid, isoform A [Drosophila melanogaster] gi|220943526|gb|ACL84306.1| sqd-PA [synthetic construct] gi|220953540|gb|ACL89313.1| sqd-PA [synthetic construct] Back     alignment and taxonomy information
>gi|390178414|ref|XP_001359012.3| GA14206, isoform C [Drosophila pseudoobscura pseudoobscura] gi|388859439|gb|EAL28155.3| GA14206, isoform C [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|390178412|ref|XP_003736644.1| GA14206, isoform B [Drosophila pseudoobscura pseudoobscura] gi|388859438|gb|EIM52717.1| GA14206, isoform B [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|24646605|ref|NP_652209.1| squid, isoform C [Drosophila melanogaster] gi|386765705|ref|NP_001247088.1| squid, isoform E [Drosophila melanogaster] gi|23171183|gb|AAN13570.1| squid, isoform C [Drosophila melanogaster] gi|73853364|gb|AAZ86753.1| LD29474p [Drosophila melanogaster] gi|220951946|gb|ACL88516.1| sqd-PC [synthetic construct] gi|383292688|gb|AFH06406.1| squid, isoform E [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|11040|emb|CAA44504.1| hrp40.2 [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|24646607|ref|NP_731825.1| squid, isoform B [Drosophila melanogaster] gi|55584092|sp|Q08473.3|SQD_DROME RecName: Full=RNA-binding protein squid; AltName: Full=Heterogeneous nuclear ribonucleoprotein 40; Short=HNRNP 40 gi|23171184|gb|AAF54963.2| squid, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|194901408|ref|XP_001980244.1| GG17035 [Drosophila erecta] gi|190651947|gb|EDV49202.1| GG17035 [Drosophila erecta] Back     alignment and taxonomy information
>gi|157110306|ref|XP_001651044.1| heterogeneous nuclear ribonucleoprotein [Aedes aegypti] gi|108878768|gb|EAT42993.1| AAEL005515-PB [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query661
FB|FBgn0263396344 sqd "squid" [Drosophila melano 0.232 0.447 0.593 3.8e-46
MGI|MGI:1330294285 Hnrnpab "heterogeneous nuclear 0.225 0.522 0.393 2e-24
RGD|69255298 Hnrnpab "heterogeneous nuclear 0.225 0.5 0.393 2e-24
UNIPROTKB|E9PTS0331 Hnrnpab "Protein Hnrnpab" [Rat 0.225 0.450 0.393 2e-24
UNIPROTKB|Q9QX80285 Hnrnpab "Hnrpab protein" [Ratt 0.225 0.522 0.393 2e-24
UNIPROTKB|Q9QX81332 Hnrnpab "RCG34663, isoform CRA 0.225 0.448 0.393 2e-24
UNIPROTKB|Q3ZC44285 HNRNPAB "Uncharacterized prote 0.225 0.522 0.393 3.2e-24
UNIPROTKB|F1NCW4258 HNRNPD "Uncharacterized protei 0.229 0.589 0.361 3.2e-24
UNIPROTKB|Q5ZIH1257 HNRNPD "Uncharacterized protei 0.229 0.591 0.361 3.2e-24
UNIPROTKB|A5D9H5306 HNRPD "Heterogeneous nuclear r 0.229 0.496 0.361 4.2e-24
FB|FBgn0263396 sqd "squid" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 484 (175.4 bits), Expect = 3.8e-46, P = 3.8e-46
 Identities = 95/160 (59%), Positives = 116/160 (72%)

Query:   107 GIVHKITE-ELKEHFSKYGEIENVTLKSDPNTGRSRGFAFIVFKDTESLEKASVEDVIAE 165
             G+  + TE EL++HF KYGEIE++ +K+DP TGRSRGFAFIVF +TE+++K S  D    
Sbjct:    62 GLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAAD---- 117

Query:   166 GNHVINNXXXXXXXXXXXXXXIFVGGLSPEMKDEEIKAHFAQFGNIIETEMPYDKSKSQR 225
               H+IN+              IFVGGL+ E+ DEEIK +F QFGNI+E EMP+DK KSQR
Sbjct:   118 -EHIINSKKVDPKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQR 176

Query:   226 KNFCFITFEHESVVIDLLKNPKQKINDKEVDVKKATPKPE 265
             K FCFITF+ E VV DLLK PKQKI  KEVDVK+ATPKPE
Sbjct:   177 KGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPKPE 216


GO:0005634 "nucleus" evidence=IC;IDA;TAS
GO:0005730 "nucleolus" evidence=IDA
GO:0005703 "polytene chromosome puff" evidence=IDA
GO:0008069 "dorsal/ventral axis specification, ovarian follicular epithelium" evidence=IMP
GO:0007297 "ovarian follicle cell migration" evidence=IMP
GO:0048477 "oogenesis" evidence=IMP;TAS
GO:0008298 "intracellular mRNA localization" evidence=NAS;TAS
GO:0017148 "negative regulation of translation" evidence=TAS
GO:0003730 "mRNA 3'-UTR binding" evidence=TAS
GO:0009953 "dorsal/ventral pattern formation" evidence=IMP;TAS
GO:0006405 "RNA export from nucleus" evidence=TAS
GO:0030529 "ribonucleoprotein complex" evidence=ISS;NAS
GO:0003729 "mRNA binding" evidence=ISS;NAS
GO:0035062 "omega speckle" evidence=IDA
GO:0000785 "chromatin" evidence=IDA
GO:0005737 "cytoplasm" evidence=TAS
GO:0000184 "nuclear-transcribed mRNA catabolic process, nonsense-mediated decay" evidence=TAS
GO:0006406 "mRNA export from nucleus" evidence=NAS
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0019094 "pole plasm mRNA localization" evidence=IMP
GO:0000381 "regulation of alternative mRNA splicing, via spliceosome" evidence=IMP
GO:0030720 "oocyte localization involved in germarium-derived egg chamber formation" evidence=IMP
GO:0016325 "oocyte microtubule cytoskeleton organization" evidence=IMP
GO:0007293 "germarium-derived egg chamber formation" evidence=IMP
GO:0007314 "oocyte anterior/posterior axis specification" evidence=IMP
GO:0045451 "pole plasm oskar mRNA localization" evidence=IEP
GO:0071011 "precatalytic spliceosome" evidence=IDA
GO:0000398 "mRNA splicing, via spliceosome" evidence=IC
GO:0071013 "catalytic step 2 spliceosome" evidence=IDA
GO:0033119 "negative regulation of RNA splicing" evidence=IMP
MGI|MGI:1330294 Hnrnpab "heterogeneous nuclear ribonucleoprotein A/B" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|69255 Hnrnpab "heterogeneous nuclear ribonucleoprotein A/B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E9PTS0 Hnrnpab "Protein Hnrnpab" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9QX80 Hnrnpab "Hnrpab protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9QX81 Hnrnpab "RCG34663, isoform CRA_a" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZC44 HNRNPAB "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NCW4 HNRNPD "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZIH1 HNRNPD "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A5D9H5 HNRPD "Heterogeneous nuclear ribonucleoprotein D" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query661
cd1232975 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 6e-30
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 6e-21
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 8e-18
cd1232975 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 1e-16
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 1e-16
cd1257675 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA- 6e-16
cd1257574 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 1e-15
cd1275775 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in 2e-15
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 4e-15
smart0036073 smart00360, RRM, RNA recognition motif 7e-15
smart0036073 smart00360, RRM, RNA recognition motif 1e-14
cd1275674 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in h 1e-14
cd1258575 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in h 2e-14
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 3e-14
cd1257574 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 8e-14
smart0036073 smart00360, RRM, RNA recognition motif 1e-13
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 1e-13
cd1275775 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in 2e-13
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 2e-13
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 2e-13
pfam0007670 pfam00076, RRM_1, RNA recognition motif 6e-13
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 7e-13
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 8e-13
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 8e-13
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 1e-12
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 2e-12
cd1275876 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in h 2e-12
cd1258375 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in h 2e-12
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 3e-12
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 3e-12
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 4e-12
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 5e-12
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 6e-12
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 6e-12
cd1275674 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in h 7e-12
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 7e-12
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 8e-12
cd1232975 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 9e-12
pfam0007670 pfam00076, RRM_1, RNA recognition motif 9e-12
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 9e-12
cd1258480 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in 9e-12
pfam0007670 pfam00076, RRM_1, RNA recognition motif 1e-11
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 1e-11
cd1245179 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nu 2e-11
cd1257675 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA- 3e-11
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 3e-11
cd1257379 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA 3e-11
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 3e-11
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 3e-11
cd1257274 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA 4e-11
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 5e-11
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 5e-11
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 9e-11
cd1275876 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in h 1e-10
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 1e-10
cd1245179 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nu 1e-10
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 1e-10
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 2e-10
cd1257776 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in ye 2e-10
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 3e-10
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 4e-10
cd1275977 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA 4e-10
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 4e-10
cd1258280 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in 5e-10
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 6e-10
cd1276076 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA 6e-10
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 7e-10
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 7e-10
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 7e-10
cd1257482 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in D 8e-10
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 8e-10
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 1e-09
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 1e-09
cd1257482 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in D 1e-09
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 1e-09
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 2e-09
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 2e-09
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 2e-09
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 2e-09
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 2e-09
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 3e-09
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 3e-09
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 3e-09
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 4e-09
cd1258280 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in 4e-09
cd1258077 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in 4e-09
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 4e-09
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 4e-09
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 5e-09
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 5e-09
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 5e-09
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 5e-09
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 5e-09
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 6e-09
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 6e-09
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 8e-09
cd1257379 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA 9e-09
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 1e-08
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 1e-08
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 1e-08
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 1e-08
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 1e-08
cd1258180 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 i 1e-08
cd1257776 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in ye 2e-08
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 3e-08
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 4e-08
cd1272492 cd12724, RRM1_CPEB2_like, RNA recognition motif 1 4e-08
cd1257675 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA- 5e-08
cd1258480 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in 5e-08
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 5e-08
COG0724 306 COG0724, COG0724, RNA-binding proteins (RRM domain 6e-08
cd1257776 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in ye 7e-08
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 7e-08
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 7e-08
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 9e-08
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 9e-08
TIGR01645612 TIGR01645, half-pint, poly-U binding splicing fact 9e-08
cd1232975 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 1e-07
cd1275775 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in 1e-07
cd1258575 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in h 1e-07
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 1e-07
cd1257274 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA 1e-07
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 1e-07
cd1276076 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA 1e-07
cd1257482 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in D 1e-07
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 1e-07
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 1e-07
cd1276181 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in 1e-07
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 1e-07
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 1e-07
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 1e-07
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 1e-07
cd1258575 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in h 2e-07
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 2e-07
cd1276076 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA 2e-07
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 2e-07
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 2e-07
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 2e-07
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 2e-07
cd1227172 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Ar 2e-07
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 3e-07
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 3e-07
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 3e-07
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 3e-07
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 3e-07
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 3e-07
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 3e-07
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 3e-07
cd1258077 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in 4e-07
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 4e-07
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 4e-07
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 4e-07
cd1276381 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in 4e-07
cd1275674 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in h 5e-07
cd1258480 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in 5e-07
cd1258180 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 i 5e-07
cd1276181 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in 5e-07
cd1258077 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in 6e-07
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 7e-07
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 7e-07
cd1275977 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA 8e-07
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 8e-07
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 8e-07
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 8e-07
cd1258280 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in 9e-07
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 9e-07
cd1275977 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA 1e-06
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 1e-06
cd1276181 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in 1e-06
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 1e-06
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 2e-06
cd1257574 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 2e-06
cd1227172 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Ar 2e-06
cd1232271 cd12322, RRM2_TDP43, RNA recognition motif 2 in TA 2e-06
cd1232271 cd12322, RRM2_TDP43, RNA recognition motif 2 in TA 2e-06
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 2e-06
cd1267079 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 2e-06
cd1267079 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 2e-06
cd1231577 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 2e-06
cd1231577 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 2e-06
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 3e-06
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 3e-06
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 3e-06
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 3e-06
cd1276281 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 i 3e-06
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 3e-06
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 3e-06
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 3e-06
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 4e-06
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 4e-06
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 4e-06
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 4e-06
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 4e-06
cd1276381 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in 5e-06
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 5e-06
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 5e-06
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 5e-06
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 5e-06
cd1258375 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in h 6e-06
cd1258375 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in h 6e-06
cd1257379 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA 6e-06
cd1258180 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 i 6e-06
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 6e-06
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 6e-06
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 6e-06
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 7e-06
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 8e-06
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 8e-06
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 8e-06
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 9e-06
cd1256476 cd12564, RRM1_RBM19, RNA recognition motif 1 in RN 9e-06
cd1256476 cd12564, RRM1_RBM19, RNA recognition motif 1 in RN 9e-06
pfam0717291 pfam07172, GRP, Glycine rich protein family 9e-06
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 1e-05
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 1e-05
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 1e-05
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 1e-05
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 1e-05
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 1e-05
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 1e-05
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 1e-05
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 1e-05
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 1e-05
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 2e-05
cd1257274 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA 2e-05
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 2e-05
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 2e-05
cd1232271 cd12322, RRM2_TDP43, RNA recognition motif 2 in TA 2e-05
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 2e-05
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 2e-05
cd1255076 cd12550, RRM_II_PABPN1, RNA recognition motif in t 2e-05
cd1255076 cd12550, RRM_II_PABPN1, RNA recognition motif in t 2e-05
cd1264279 cd12642, RRM_TRA2A, RNA recognition motif in trans 2e-05
cd1264279 cd12642, RRM_TRA2A, RNA recognition motif in trans 2e-05
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 2e-05
cd1245870 cd12458, RRM_AtC3H46_like, RNA recognition motif i 2e-05
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 2e-05
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 2e-05
cd1236774 cd12367, RRM2_RBM45, RNA recognition motif 2 in RN 2e-05
cd1236774 cd12367, RRM2_RBM45, RNA recognition motif 2 in RN 2e-05
cd1260667 cd12606, RRM1_RBM4, RNA recognition motif 1 in ver 2e-05
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 3e-05
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 3e-05
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 3e-05
pfam0717291 pfam07172, GRP, Glycine rich protein family 3e-05
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 3e-05
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 3e-05
cd1225772 cd12257, RRM1_RBM26_like, RNA recognition motif 1 3e-05
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 3e-05
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 3e-05
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 4e-05
cd1275876 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in h 4e-05
pfam0717291 pfam07172, GRP, Glycine rich protein family 4e-05
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 4e-05
cd1227272 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Ar 4e-05
cd1227272 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Ar 4e-05
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 5e-05
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 5e-05
cd1225772 cd12257, RRM1_RBM26_like, RNA recognition motif 1 5e-05
cd12676107 cd12676, RRM3_Nop4p, RNA recognition motif 3 in ye 5e-05
cd12676107 cd12676, RRM3_Nop4p, RNA recognition motif 3 in ye 5e-05
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 5e-05
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 5e-05
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 5e-05
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 6e-05
cd1276381 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in 6e-05
cd1276281 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 i 6e-05
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 6e-05
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 6e-05
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 6e-05
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 6e-05
pfam1389356 pfam13893, RRM_5, RNA recognition motif 6e-05
cd1222474 cd12224, RRM_RBM22, RNA recognition motif (RRM) fo 6e-05
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 7e-05
TIGR01648578 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu 7e-05
cd1259275 cd12592, RRM_RBM7, RNA recognition motif in verteb 8e-05
PTZ00146293 PTZ00146, PTZ00146, fibrillarin; Provisional 8e-05
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 8e-05
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 8e-05
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 9e-05
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 9e-05
PLN03120 260 PLN03120, PLN03120, nucleic acid binding protein; 9e-05
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 1e-04
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 1e-04
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 1e-04
pfam1389356 pfam13893, RRM_5, RNA recognition motif 1e-04
PTZ00146293 PTZ00146, PTZ00146, fibrillarin; Provisional 1e-04
cd1255177 cd12551, RRM_II_PABPN1L, RNA recognition motif in 1e-04
cd1255177 cd12551, RRM_II_PABPN1L, RNA recognition motif in 1e-04
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 2e-04
pfam0717291 pfam07172, GRP, Glycine rich protein family 2e-04
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 2e-04
PTZ00146 293 PTZ00146, PTZ00146, fibrillarin; Provisional 2e-04
PLN03120260 PLN03120, PLN03120, nucleic acid binding protein; 2e-04
cd1239491 cd12394, RRM1_RBM34, RNA recognition motif 1 in RN 2e-04
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 2e-04
cd1245386 cd12453, RRM1_RIM4_like, RNA recognition motif 1 i 2e-04
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 2e-04
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 2e-04
cd1230386 cd12303, RRM_spSet1p_like, RNA recognition motif i 2e-04
cd1230386 cd12303, RRM_spSet1p_like, RNA recognition motif i 2e-04
cd1263380 cd12633, RRM1_FCA, RNA recognition motif 1 in plan 2e-04
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 2e-04
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 2e-04
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 3e-04
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 3e-04
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 3e-04
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 3e-04
cd1222474 cd12224, RRM_RBM22, RNA recognition motif (RRM) fo 3e-04
PTZ00146293 PTZ00146, PTZ00146, fibrillarin; Provisional 3e-04
PTZ00146293 PTZ00146, PTZ00146, fibrillarin; Provisional 3e-04
cd1227974 cd12279, RRM_TUT1, RNA recognition motif in speckl 3e-04
cd1222884 cd12228, RRM_ENOX, RNA recognition motif (RRM) in 3e-04
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 3e-04
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 3e-04
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 4e-04
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 4e-04
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 4e-04
PTZ00146293 PTZ00146, PTZ00146, fibrillarin; Provisional 4e-04
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 4e-04
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 4e-04
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 4e-04
PRK06958182 PRK06958, PRK06958, single-stranded DNA-binding pr 4e-04
cd12302110 cd12302, RRM_scSet1p_like, RNA recognition motif i 4e-04
cd12302110 cd12302, RRM_scSet1p_like, RNA recognition motif i 4e-04
cd1255984 cd12559, RRM_SRSF10, RNA recognition motif in seri 4e-04
cd1253685 cd12536, RRM1_RBM39, RNA recognition motif 1 in ve 4e-04
cd1253685 cd12536, RRM1_RBM39, RNA recognition motif 1 in ve 4e-04
cd1223370 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m 4e-04
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 4e-04
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 4e-04
TIGR01645612 TIGR01645, half-pint, poly-U binding splicing fact 5e-04
PTZ00146293 PTZ00146, PTZ00146, fibrillarin; Provisional 5e-04
cd1255984 cd12559, RRM_SRSF10, RNA recognition motif in seri 5e-04
cd1267381 cd12673, RRM_BOULE, RNA recognition motif in prote 5e-04
cd1258575 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in h 6e-04
cd1267583 cd12675, RRM2_Nop4p, RNA recognition motif 2 in ye 6e-04
cd1267583 cd12675, RRM2_Nop4p, RNA recognition motif 2 in ye 6e-04
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 6e-04
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 6e-04
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 6e-04
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 7e-04
cd1229778 cd12297, RRM2_Prp24, RNA recognition motif 2 in fu 7e-04
cd1235177 cd12351, RRM4_SHARP, RNA recognition motif 4 in SM 7e-04
cd1256084 cd12560, RRM_SRSF12, RNA recognition motif in seri 7e-04
cd1256084 cd12560, RRM_SRSF12, RNA recognition motif in seri 7e-04
cd1263979 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 7e-04
cd1257179 cd12571, RRM6_RBM19, RNA recognition motif 6 in RN 7e-04
cd1257179 cd12571, RRM6_RBM19, RNA recognition motif 6 in RN 7e-04
cd1223289 cd12232, RRM3_U2AF65, RNA recognition motif 3 foun 8e-04
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 8e-04
cd12294102 cd12294, RRM_Rrp7A, RNA recognition motif in ribos 8e-04
cd12294102 cd12294, RRM_Rrp7A, RNA recognition motif in ribos 8e-04
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 9e-04
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 9e-04
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 0.001
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 0.001
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 0.001
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 0.001
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 0.001
cd1256476 cd12564, RRM1_RBM19, RNA recognition motif 1 in RN 0.001
PTZ00146 293 PTZ00146, PTZ00146, fibrillarin; Provisional 0.001
PTZ00146 293 PTZ00146, PTZ00146, fibrillarin; Provisional 0.001
PTZ00146 293 PTZ00146, PTZ00146, fibrillarin; Provisional 0.001
PTZ00146 293 PTZ00146, PTZ00146, fibrillarin; Provisional 0.001
cd1239491 cd12394, RRM1_RBM34, RNA recognition motif 1 in RN 0.001
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 0.001
cd1223289 cd12232, RRM3_U2AF65, RNA recognition motif 3 foun 0.001
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 0.001
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 0.001
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 0.001
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 0.001
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 0.001
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 0.001
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 0.001
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 0.001
cd1230493 cd12304, RRM_Set1, RNA recognition motif in the Se 0.001
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 0.002
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 0.002
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 0.002
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 0.002
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 0.002
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 0.002
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 0.002
cd1222474 cd12224, RRM_RBM22, RNA recognition motif (RRM) fo 0.002
PTZ00146293 PTZ00146, PTZ00146, fibrillarin; Provisional 0.002
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 0.002
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 0.002
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 0.002
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 0.002
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 0.002
cd1248379 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in v 0.002
cd1265279 cd12652, RRM2_Hu, RNA recognition motif 2 in the H 0.002
cd1248279 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in v 0.002
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 0.002
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 0.002
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 0.002
cd1276281 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 i 0.003
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 0.003
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 0.003
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 0.003
cd1248379 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in v 0.003
cd1265279 cd12652, RRM2_Hu, RNA recognition motif 2 in the H 0.003
cd1248279 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in v 0.003
cd1236875 cd12368, RRM3_RBM45, RNA recognition motif 3 in RN 0.003
cd1230575 cd12305, RRM_NELFE, RNA recognition motif in negat 0.003
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 0.003
cd1255685 cd12556, RRM2_RBM15B, RNA recognition motif 2 in p 0.003
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 0.003
TIGR01661 352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 0.004
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 0.004
cd12676107 cd12676, RRM3_Nop4p, RNA recognition motif 3 in ye 0.004
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 0.004
cd1235177 cd12351, RRM4_SHARP, RNA recognition motif 4 in SM 0.004
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 0.004
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 0.004
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 0.004
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 0.004
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 0.004
>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
 Score =  112 bits (282), Expect = 6e-30
 Identities = 39/75 (52%), Positives = 54/75 (72%)

Query: 186 KIFVGGLSPEMKDEEIKAHFAQFGNIIETEMPYDKSKSQRKNFCFITFEHESVVIDLLKN 245
           KIFVGGLSPE  +E+I+ +F +FGNI+E E+P DK  ++R+ FCFITF+ E  V  +L+ 
Sbjct: 1   KIFVGGLSPETTEEKIREYFGKFGNIVEIELPMDKKTNKRRGFCFITFDSEEPVKKILET 60

Query: 246 PKQKINDKEVDVKKA 260
               I  K+V+VKKA
Sbjct: 61  QFHVIGGKKVEVKKA 75


This subfamily corresponds to the RRM2 of hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins. hnRNP D0, a UUAG-specific nuclear RNA binding protein that may be involved in pre-mRNA splicing and telomere elongation. hnRNP A/B is an RNA unwinding protein with a high affinity for G- followed by U-rich regions. It has also been identified as an APOBEC1-binding protein that interacts with apolipoprotein B (apoB) mRNA transcripts around the editing site and thus plays an important role in apoB mRNA editing. hnRNP DL (or hnRNP D-like) is a dual functional protein that possesses DNA- and RNA-binding properties. It has been implicated in mRNA biogenesis at the transcriptional and post-transcriptional levels. All memembers in this family contain two putative RNA recognition motifs (RRMs), also termed RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains), and a glycine- and tyrosine-rich C-terminus. . Length = 75

>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein Musashi homolog Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|241200 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|241029 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|241202 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP D-like or hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|241027 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|241200 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|241028 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240897 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein Musashi homolog Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|241017 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA-binding protein Musashi homolog 2 (Musashi-2) and similar proteins Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|241016 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241202 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP D-like or hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240897 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|241203 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|241026 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|241204 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA-binding protein Musashi homolog 2 (Musashi-2 ) and similar proteins Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|241026 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|241024 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|241017 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA-binding protein Musashi homolog 2 (Musashi-2) and similar proteins Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|241025 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|241168 cd12724, RRM1_CPEB2_like, RNA recognition motif 1 in cytoplasmic polyadenylation element-binding protein CPEB-2, CPEB-3, CPEB-4 and similar protiens Back     alignment and domain information
>gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein Musashi homolog Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241028 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|241029 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|241016 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|241204 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA-binding protein Musashi homolog 2 (Musashi-2 ) and similar proteins Back     alignment and domain information
>gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|241205 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|241029 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|241204 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA-binding protein Musashi homolog 2 (Musashi-2 ) and similar proteins Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240717 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|241024 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|241207 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|241200 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|241028 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|241025 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|241205 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|241024 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|241203 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|241026 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|241203 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|241205 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240717 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240768 cd12322, RRM2_TDP43, RNA recognition motif 2 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|240768 cd12322, RRM2_TDP43, RNA recognition motif 2 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|241114 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 in yeast nucleolar protein 12 (Nop12p) and similar proteins Back     alignment and domain information
>gnl|CDD|241114 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 in yeast nucleolar protein 12 (Nop12p) and similar proteins Back     alignment and domain information
>gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding protein 19 (RBM19), yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding protein 19 (RBM19), yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|241206 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241207 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|241027 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|241027 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|241017 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA-binding protein Musashi homolog 2 (Musashi-2) and similar proteins Back     alignment and domain information
>gnl|CDD|241025 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|219320 pfam07172, GRP, Glycine rich protein family Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|241016 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240768 cd12322, RRM2_TDP43, RNA recognition motif 2 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240994 cd12550, RRM_II_PABPN1, RNA recognition motif in type II polyadenylate-binding protein 2 (PABP-2) and similar proteins Back     alignment and domain information
>gnl|CDD|240994 cd12550, RRM_II_PABPN1, RNA recognition motif in type II polyadenylate-binding protein 2 (PABP-2) and similar proteins Back     alignment and domain information
>gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins Back     alignment and domain information
>gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240904 cd12458, RRM_AtC3H46_like, RNA recognition motif in Arabidopsis thaliana zinc finger CCCH domain-containing protein 46 (AtC3H46) and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240813 cd12367, RRM2_RBM45, RNA recognition motif 2 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240813 cd12367, RRM2_RBM45, RNA recognition motif 2 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|219320 pfam07172, GRP, Glycine rich protein family Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240703 cd12257, RRM1_RBM26_like, RNA recognition motif 1 in vertebrate RNA-binding protein 26 (RBM26) and similar proteins Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|241202 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP D-like or hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|219320 pfam07172, GRP, Glycine rich protein family Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240718 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240718 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240703 cd12257, RRM1_RBM26_like, RNA recognition motif 1 in vertebrate RNA-binding protein 26 (RBM26) and similar proteins Back     alignment and domain information
>gnl|CDD|241120 cd12676, RRM3_Nop4p, RNA recognition motif 3 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241120 cd12676, RRM3_Nop4p, RNA recognition motif 3 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|241207 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|241206 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>gnl|CDD|241036 cd12592, RRM_RBM7, RNA recognition motif in vertebrate RNA-binding protein 7 (RBM7) Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|215588 PLN03120, PLN03120, nucleic acid binding protein; Provisional Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|240995 cd12551, RRM_II_PABPN1L, RNA recognition motif in vertebrate type II embryonic polyadenylate-binding protein 2 (ePABP-2) Back     alignment and domain information
>gnl|CDD|240995 cd12551, RRM_II_PABPN1L, RNA recognition motif in vertebrate type II embryonic polyadenylate-binding protein 2 (ePABP-2) Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|219320 pfam07172, GRP, Glycine rich protein family Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|215588 PLN03120, PLN03120, nucleic acid binding protein; Provisional Back     alignment and domain information
>gnl|CDD|240840 cd12394, RRM1_RBM34, RNA recognition motif 1 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240899 cd12453, RRM1_RIM4_like, RNA recognition motif 1 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240749 cd12303, RRM_spSet1p_like, RNA recognition motif in fission yeast Schizosaccharomyces pombe SET domain-containing protein 1 (spSet1p) and similar proteins Back     alignment and domain information
>gnl|CDD|240749 cd12303, RRM_spSet1p_like, RNA recognition motif in fission yeast Schizosaccharomyces pombe SET domain-containing protein 1 (spSet1p) and similar proteins Back     alignment and domain information
>gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|240725 cd12279, RRM_TUT1, RNA recognition motif in speckle targeted PIP5K1A-regulated poly(A) polymerase (Star-PAP) and similar proteins Back     alignment and domain information
>gnl|CDD|240674 cd12228, RRM_ENOX, RNA recognition motif (RRM) in the cell surface Ecto-NOX disulfide-thiol exchanger (ECTO-NOX or ENOX) proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|180777 PRK06958, PRK06958, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|240748 cd12302, RRM_scSet1p_like, RNA recognition motif in budding yeast Saccharomyces cerevisiae SET domain-containing protein 1 (scSet1p) and similar proteins Back     alignment and domain information
>gnl|CDD|240748 cd12302, RRM_scSet1p_like, RNA recognition motif in budding yeast Saccharomyces cerevisiae SET domain-containing protein 1 (scSet1p) and similar proteins Back     alignment and domain information
>gnl|CDD|241003 cd12559, RRM_SRSF10, RNA recognition motif in serine/arginine-rich splicing factor 10 (SRSF10) and similar proteins Back     alignment and domain information
>gnl|CDD|240980 cd12536, RRM1_RBM39, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) Back     alignment and domain information
>gnl|CDD|240980 cd12536, RRM1_RBM39, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) Back     alignment and domain information
>gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|241003 cd12559, RRM_SRSF10, RNA recognition motif in serine/arginine-rich splicing factor 10 (SRSF10) and similar proteins Back     alignment and domain information
>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE Back     alignment and domain information
>gnl|CDD|241029 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240797 cd12351, RRM4_SHARP, RNA recognition motif 4 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|241004 cd12560, RRM_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor 12 (SRSF12) and similar proteins Back     alignment and domain information
>gnl|CDD|241004 cd12560, RRM_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor 12 (SRSF12) and similar proteins Back     alignment and domain information
>gnl|CDD|241083 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|241015 cd12571, RRM6_RBM19, RNA recognition motif 6 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241015 cd12571, RRM6_RBM19, RNA recognition motif 6 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240678 cd12232, RRM3_U2AF65, RNA recognition motif 3 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240740 cd12294, RRM_Rrp7A, RNA recognition motif in ribosomal RNA-processing protein 7 homolog A (Rrp7A) and similar proteins Back     alignment and domain information
>gnl|CDD|240740 cd12294, RRM_Rrp7A, RNA recognition motif in ribosomal RNA-processing protein 7 homolog A (Rrp7A) and similar proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|240840 cd12394, RRM1_RBM34, RNA recognition motif 1 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240678 cd12232, RRM3_U2AF65, RNA recognition motif 3 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240750 cd12304, RRM_Set1, RNA recognition motif in the Set1-like family of histone-lysine N-methyltransferases Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240927 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240926 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|241206 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240927 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240926 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|240814 cd12368, RRM3_RBM45, RNA recognition motif 3 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240751 cd12305, RRM_NELFE, RNA recognition motif in negative elongation factor E (NELF-E) and similar proteins Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|241000 cd12556, RRM2_RBM15B, RNA recognition motif 2 in putative RNA binding motif protein 15B (RBM15B) from vertebrate Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|241120 cd12676, RRM3_Nop4p, RNA recognition motif 3 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|240797 cd12351, RRM4_SHARP, RNA recognition motif 4 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 661
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 100.0
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 100.0
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 100.0
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 100.0
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 100.0
KOG0145|consensus360 100.0
KOG0123|consensus369 100.0
KOG0127|consensus678 100.0
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 100.0
KOG0148|consensus321 100.0
KOG0117|consensus506 100.0
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 100.0
KOG0144|consensus510 100.0
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 100.0
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.98
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.97
KOG0127|consensus678 99.97
TIGR01645612 half-pint poly-U binding splicing factor, half-pin 99.97
KOG0117|consensus506 99.96
KOG0123|consensus369 99.96
KOG0148|consensus321 99.96
KOG0110|consensus725 99.96
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.95
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.95
KOG0145|consensus360 99.95
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.94
KOG4211|consensus510 99.94
KOG0144|consensus510 99.93
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.93
KOG4212|consensus608 99.91
KOG0131|consensus203 99.9
KOG0124|consensus544 99.89
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.89
KOG0110|consensus725 99.88
KOG4205|consensus311 99.86
KOG4211|consensus 510 99.85
KOG0147|consensus549 99.83
KOG0109|consensus346 99.82
KOG0146|consensus371 99.82
KOG1190|consensus492 99.82
KOG4205|consensus311 99.81
KOG1456|consensus494 99.8
KOG4212|consensus608 99.78
KOG0146|consensus371 99.78
KOG0147|consensus549 99.77
KOG0124|consensus544 99.75
KOG0131|consensus203 99.74
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.73
KOG0109|consensus346 99.7
KOG1190|consensus492 99.65
KOG0105|consensus241 99.62
KOG0105|consensus241 99.58
KOG1365|consensus 508 99.5
KOG0149|consensus 247 99.5
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.49
KOG4206|consensus221 99.45
KOG4307|consensus944 99.42
KOG0149|consensus247 99.41
KOG1548|consensus382 99.38
KOG0122|consensus270 99.38
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.38
KOG0120|consensus500 99.37
KOG0121|consensus153 99.36
KOG0120|consensus500 99.33
KOG0122|consensus270 99.33
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.31
KOG0107|consensus195 99.31
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.29
KOG0106|consensus216 99.29
KOG4207|consensus256 99.27
PLN03120260 nucleic acid binding protein; Provisional 99.27
KOG4206|consensus221 99.26
KOG0125|consensus376 99.24
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.21
KOG0114|consensus124 99.2
KOG0113|consensus335 99.2
KOG0121|consensus153 99.2
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.18
KOG0125|consensus376 99.16
KOG0113|consensus335 99.16
KOG0126|consensus219 99.14
KOG0126|consensus219 99.14
PLN03121243 nucleic acid binding protein; Provisional 99.13
KOG0130|consensus170 99.13
KOG1457|consensus284 99.13
KOG0114|consensus124 99.12
KOG4207|consensus256 99.12
KOG4307|consensus 944 99.12
KOG1457|consensus284 99.11
KOG1456|consensus494 99.11
smart0036272 RRM_2 RNA recognition motif. 99.09
PLN03120260 nucleic acid binding protein; Provisional 99.09
PLN03213 759 repressor of silencing 3; Provisional 99.09
smart0036071 RRM RNA recognition motif. 99.08
KOG0128|consensus881 99.07
KOG1365|consensus508 99.06
smart0036071 RRM RNA recognition motif. 99.04
KOG0130|consensus170 99.04
KOG0107|consensus195 99.03
KOG0116|consensus419 99.02
KOG0111|consensus298 99.01
KOG0129|consensus520 99.0
smart0036170 RRM_1 RNA recognition motif. 99.0
KOG0106|consensus216 99.0
PLN03121243 nucleic acid binding protein; Provisional 98.99
smart0036272 RRM_2 RNA recognition motif. 98.99
PLN03213 759 repressor of silencing 3; Provisional 98.96
KOG0111|consensus298 98.95
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 98.94
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 98.93
COG0724306 RNA-binding proteins (RRM domain) [General functio 98.9
KOG0108|consensus435 98.9
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 98.89
KOG0415|consensus479 98.84
KOG0108|consensus435 98.83
smart0036170 RRM_1 RNA recognition motif. 98.83
KOG0128|consensus881 98.8
KOG4210|consensus285 98.79
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 98.78
KOG4208|consensus214 98.69
KOG0415|consensus479 98.68
KOG4208|consensus214 98.67
KOG4660|consensus549 98.66
KOG4454|consensus267 98.66
KOG0153|consensus377 98.57
KOG1548|consensus382 98.54
KOG0226|consensus290 98.53
KOG0132|consensus894 98.51
KOG0112|consensus975 98.44
KOG0226|consensus290 98.38
KOG0132|consensus894 98.25
KOG0153|consensus377 98.23
KOG4661|consensus940 98.22
KOG0533|consensus243 98.19
KOG4660|consensus549 98.16
KOG0116|consensus419 98.16
KOG4210|consensus285 98.09
KOG0533|consensus243 98.08
KOG4454|consensus267 98.05
KOG4209|consensus231 98.03
KOG0129|consensus520 98.01
KOG4661|consensus940 98.01
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 97.95
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 97.92
KOG4676|consensus479 97.91
KOG0151|consensus 877 97.68
KOG1995|consensus351 97.67
KOG4209|consensus231 97.64
KOG0151|consensus 877 97.61
KOG4849|consensus498 97.6
KOG4676|consensus479 97.54
KOG2193|consensus584 97.53
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.37
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.36
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.33
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.24
COG5175480 MOT2 Transcriptional repressor [Transcription] 96.95
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 96.86
KOG1995|consensus351 96.79
KOG0115|consensus275 96.78
KOG0112|consensus975 96.77
KOG2314|consensus698 96.73
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 96.5
KOG2193|consensus 584 96.48
KOG2314|consensus 698 96.46
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 96.1
KOG0115|consensus 275 96.09
KOG1855|consensus 484 96.08
COG5175480 MOT2 Transcriptional repressor [Transcription] 96.06
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 95.32
KOG1855|consensus484 95.25
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 95.19
KOG4849|consensus498 95.05
KOG3152|consensus278 95.02
KOG2202|consensus260 94.87
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 94.81
KOG3973|consensus465 94.64
KOG3152|consensus278 94.28
KOG2591|consensus684 94.24
KOG2135|consensus526 94.22
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 93.75
KOG2202|consensus260 93.68
KOG1996|consensus378 93.3
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 93.14
KOG1996|consensus378 93.13
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 93.08
PF15023166 DUF4523: Protein of unknown function (DUF4523) 92.08
KOG0921|consensus1282 91.72
KOG0921|consensus1282 90.71
KOG2135|consensus526 89.98
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 89.41
KOG4285|consensus350 88.79
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 88.33
KOG2068|consensus327 88.07
KOG2591|consensus684 87.19
PF15023166 DUF4523: Protein of unknown function (DUF4523) 85.78
PF0729288 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 84.76
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 84.07
PF0729288 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 82.7
KOG2416|consensus718 81.46
KOG2068|consensus327 80.73
KOG2416|consensus718 80.32
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
Probab=100.00  E-value=1e-45  Score=417.52  Aligned_cols=333  Identities=23%  Similarity=0.335  Sum_probs=270.0

Q ss_pred             EEEcCC-CcCCHHHHHHHhhcCCCeeEEEEeeCCCCCCcccEEEEEEeehhhHHHhhHHHHHHhCCeeecceeehhhhhh
Q psy15852        103 VSHPGI-VHKITEELKEHFSKYGEIENVTLKSDPNTGRSRGFAFIVFKDTESLEKASVEDVIAEGNHVINNKKIEAKKAK  181 (661)
Q Consensus       103 ~~~~~~-~~~te~~L~~~F~~~G~I~~v~l~~~~~tg~srG~afV~F~~~e~A~~A~~~~~~~~~~~~i~g~~i~v~~~~  181 (661)
                      |||+++ +++||++|+++|++||+|.+|+|++|+.|++++|||||+|.+.++|++|    +..+++..|.|++|.|.|+.
T Consensus         3 l~VgnLp~~vte~~L~~~F~~~G~v~~v~v~~d~~t~~s~G~afV~F~~~~~A~~A----l~~ln~~~i~gk~i~i~~s~   78 (562)
T TIGR01628         3 LYVGDLDPDVTEAKLYDLFKPFGPVLSVRVCRDSVTRRSLGYGYVNFQNPADAERA----LETMNFKRLGGKPIRIMWSQ   78 (562)
T ss_pred             EEEeCCCCCCCHHHHHHHHHhcCCEEEEEEEecCCCCCcceEEEEEECCHHHHHHH----HHHhCCCEECCeeEEeeccc
Confidence            455555 5999999999999999999999999999999999999999999999999    88999999999999998875


Q ss_pred             cc-------CCeeEecCCCccCCHHHHHHHHhcCCCeEEEEeccCCCCCCcCcEEEEEeCCHHHHHHHHHhC-CCccCCe
Q psy15852        182 AK-------SGKIFVGGLSPEMKDEEIKAHFAQFGNIIETEMPYDKSKSQRKNFCFITFEHESVVIDLLKNP-KQKINDK  253 (661)
Q Consensus       182 ~~-------~~~lfV~nLp~~~te~~L~~~F~~~G~i~~v~i~~~~~~g~~~g~afV~f~~~~~A~~Al~~~-~~~~~g~  253 (661)
                      ..       ..+|||+|||.++++++|+++|++||.|.+|+++.+. +++++|||||+|.+.++|.+|++.+ +..+.++
T Consensus        79 ~~~~~~~~~~~~vfV~nLp~~~~~~~L~~~F~~~G~i~~~~i~~~~-~g~skg~afV~F~~~e~A~~Ai~~lng~~~~~~  157 (562)
T TIGR01628        79 RDPSLRRSGVGNIFVKNLDKSVDNKALFDTFSKFGNILSCKVATDE-NGKSRGYGFVHFEKEESAKAAIQKVNGMLLNDK  157 (562)
T ss_pred             ccccccccCCCceEEcCCCccCCHHHHHHHHHhcCCcceeEeeecC-CCCcccEEEEEECCHHHHHHHHHHhcccEecCc
Confidence            32       3579999999999999999999999999999999875 5889999999999999999999887 6789999


Q ss_pred             EEEEEeccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccccccccCCCCCCCCCCCCCCCCCC
Q psy15852        254 EVDVKKATPKPEPFGVRGGRGGRGGRGGRGGRMAGGYGGYGGYGGGYGGILYKPLLFYELNELGISGRSLVCRTGPMVQA  333 (661)
Q Consensus       254 ~i~V~~a~~k~~~~~~~~~~~~~g~~~g~~~~~~~~~g~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  333 (661)
                      .|.|.....+.++..                                                                 
T Consensus       158 ~i~v~~~~~~~~~~~-----------------------------------------------------------------  172 (562)
T TIGR01628       158 EVYVGRFIKKHEREA-----------------------------------------------------------------  172 (562)
T ss_pred             eEEEecccccccccc-----------------------------------------------------------------
Confidence            999977655432100                                                                 


Q ss_pred             CCCCcccCCCccEEEEecCCCCCCCCCCCCCCCCChhHHHhhhccccccccccccccccccCCCCCcCccchhhhhhccC
Q psy15852        334 TPPLAEVDVTGVIMILLGAKNHNSDENPTSRSHPSQNAIKLYLTRSSYREWGHVADNLLLCDNFPSIRELEIPEAFLTKT  413 (661)
Q Consensus       334 ~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~p~~~~~~l~~~f~~~~  413 (661)
                       ..                                                .....++++.++.+++++++|+++|..| 
T Consensus       173 -~~------------------------------------------------~~~~~~l~V~nl~~~~tee~L~~~F~~f-  202 (562)
T TIGR01628       173 -AP------------------------------------------------LKKFTNLYVKNLDPSVNEDKLRELFAKF-  202 (562)
T ss_pred             -cc------------------------------------------------ccCCCeEEEeCCCCcCCHHHHHHHHHhc-
Confidence             00                                                0001234555555669999999999888 


Q ss_pred             cccccCCcccchhhcccccccchhhccCCceeEEeeecccccCCcccceEEEEeCChHHHHHHHh-CCCCcCC----CcE
Q psy15852        414 TTVPMTTTEHMVLVTGTDMMHMEVTEAVPMEIIETEMPYDKSKSQRKNFCFITFEHESVVIDLLK-NPKQKIN----DKE  488 (661)
Q Consensus       414 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~i~~~~~~~d~~~~~~~g~aFV~F~~~e~A~~Ai~-~~~~~l~----g~~  488 (661)
                                                   |+|.++.+..+. +++++|||||.|.+.++|.+|++ .++..+.    |+.
T Consensus       203 -----------------------------G~i~~~~i~~~~-~g~~~G~afV~F~~~e~A~~Av~~l~g~~i~~~~~g~~  252 (562)
T TIGR01628       203 -----------------------------GEITSAAVMKDG-SGRSRGFAFVNFEKHEDAAKAVEEMNGKKIGLAKEGKK  252 (562)
T ss_pred             -----------------------------CCEEEEEEEECC-CCCcccEEEEEECCHHHHHHHHHHhCCcEeccccccee
Confidence                                         789999998874 67889999999999999999994 5567777    888


Q ss_pred             EEEecCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccccccccccCCCccccccccccCCCCCc
Q psy15852        489 VDVKKATPKPEPFGVRGGRGGRGGRGGRGGRMAGGYGGYGGYGGGYGELDYLQLWQFFDWISSSFSENCLLEDSIGKPLT  568 (661)
Q Consensus       489 i~v~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~gg~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~  568 (661)
                      |.|.++..+.++...                                                       ..    ..  
T Consensus       253 l~v~~a~~k~er~~~-------------------------------------------------------~~----~~--  271 (562)
T TIGR01628       253 LYVGRAQKRAEREAE-------------------------------------------------------LR----RK--  271 (562)
T ss_pred             eEeecccChhhhHHH-------------------------------------------------------HH----hh--
Confidence            888777655332100                                                       00    00  


Q ss_pred             ccCCCccccccCCCCccccccccCCCeEEEcCCCCCCCHHHHHHHhhcCCCeeEEEEeecCCCCCcccEEEEEEcCHHHH
Q psy15852        569 VSCSHYHYLFDQNLRTHYFYIVEAKNKMVSHPGIVDKITEELKEHFSKYGEIENVTLKSDPNTGRSRGFAFIVFKDTESL  648 (661)
Q Consensus       569 ~~~~~~~~~~~~~~~~~~~~~~~~~~~l~v~nlp~~~te~dL~~~F~~~G~I~~v~i~~d~~tg~s~G~aFV~F~~~e~A  648 (661)
                              . .  ............++|||+|||+++|+++|+++|++||.|.+|+|++| .+|+++|||||+|.+.++|
T Consensus       272 --------~-~--~~~~~~~~~~~~~~l~V~nl~~~~~~~~L~~~F~~~G~i~~~~i~~d-~~g~~~g~gfV~f~~~~~A  339 (562)
T TIGR01628       272 --------F-E--ELQQERKMKAQGVNLYVKNLDDTVTDEKLRELFSECGEITSAKVMLD-EKGVSRGFGFVCFSNPEEA  339 (562)
T ss_pred             --------H-H--hhhhhhhcccCCCEEEEeCCCCccCHHHHHHHHHhcCCeEEEEEEEC-CCCCcCCeEEEEeCCHHHH
Confidence                    0 0  00000000123568999999999999999999999999999999999 5699999999999999999


Q ss_pred             HHHHHhCCcc
Q psy15852        649 EKASVEDVYF  658 (661)
Q Consensus       649 ~~A~~~~~~~  658 (661)
                      .+|+.++|..
T Consensus       340 ~~A~~~~~g~  349 (562)
T TIGR01628       340 NRAVTEMHGR  349 (562)
T ss_pred             HHHHHHhcCC
Confidence            9999987754



There are four paralogs in Homo sapiens which are expressed in testis, platelets, broadly expressed, or of unknown tissue range.

>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG3973|consensus Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>KOG2591|consensus Back     alignment and domain information
>KOG2135|consensus Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>KOG2135|consensus Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>KOG2591|consensus Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi) Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi) Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query661
2cjk_A167 Structure Of The Rna Binding Domain Of Hrp1 In Comp 8e-20
2cjk_A167 Structure Of The Rna Binding Domain Of Hrp1 In Comp 1e-05
2up1_A183 Structure Of Up1-Telomeric Dna Complex Length = 183 3e-15
2up1_A183 Structure Of Up1-Telomeric Dna Complex Length = 183 3e-05
1l3k_A196 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 4e-15
1l3k_A196 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 4e-05
2lyv_A197 Solution Structure Of The Two Rrm Domains Of Hnrnp 5e-15
2lyv_A197 Solution Structure Of The Two Rrm Domains Of Hnrnp 4e-05
1pgz_A195 Crystal Structure Of Up1 Complexed With D(Ttagggtta 5e-15
1pgz_A195 Crystal Structure Of Up1 Complexed With D(Ttagggtta 4e-05
1ha1_A184 Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 1e-14
1ha1_A184 Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 3e-05
1up1_A182 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 1e-14
1up1_A182 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 4e-05
3s7r_A87 Crystal Structure Of A Heterogeneous Nuclear Ribonu 1e-10
1hd0_A75 Heterogeneous Nuclear Ribonucleoprotein D0 (Hnrnp D 2e-09
1iqt_A75 Solution Structure Of The C-Terminal Rna-Binding Do 2e-09
1iqt_A75 Solution Structure Of The C-Terminal Rna-Binding Do 2e-04
1wtb_A79 Complex Structure Of The C-Terminal Rna-Binding Dom 2e-09
1wtb_A79 Complex Structure Of The C-Terminal Rna-Binding Dom 2e-04
2mss_A75 Musashi1 Rbd2, Nmr Length = 75 2e-08
2dgs_A99 Solution Structure Of The Second Rna Binding Domain 2e-07
2dh8_A105 Solution Structure Of The N-Terminal Rna Binding Do 1e-06
2dh8_A105 Solution Structure Of The N-Terminal Rna Binding Do 3e-04
1fxl_A167 Crystal Structure Of Hud And Au-Rich Element Of The 2e-06
1fnx_H174 Solution Structure Of The Huc Rbd1-Rbd2 Complexed W 2e-06
2rs2_A109 1h, 13c, And 15n Chemical Shift Assignments For Mus 3e-06
2rs2_A109 1h, 13c, And 15n Chemical Shift Assignments For Mus 5e-06
2rs2_A109 1h, 13c, And 15n Chemical Shift Assignments For Mus 6e-05
1uaw_A77 Solution Structure Of The N-Terminal Rna-Binding Do 4e-06
1uaw_A77 Solution Structure Of The N-Terminal Rna-Binding Do 4e-05
1uaw_A77 Solution Structure Of The N-Terminal Rna-Binding Do 6e-05
4egl_A177 Crystal Structure Of Two Tandem Rna Recognition Mot 1e-05
4ed5_A177 Crystal Structure Of The Two N-Terminal Rrm Domains 1e-05
2dnz_A95 Solution Structure Of The Second Rna Binding Domain 2e-05
2dnz_A95 Solution Structure Of The Second Rna Binding Domain 2e-05
2jrs_A108 Solution Nmr Structure Of Caper Rrm2 Domain. Northe 5e-05
2jrs_A108 Solution Nmr Structure Of Caper Rrm2 Domain. Northe 6e-05
2dh7_A105 Solution Structure Of The Second Rna Binding Domain 8e-05
2dgo_A115 Solution Structure Of The Rna Binding Domain In Cyt 9e-05
2cqc_A95 Solution Structure Of The Rna Recognition Motif In 1e-04
2cqc_A95 Solution Structure Of The Rna Recognition Motif In 1e-04
2kxn_B129 Nmr Structure Of Human Tra2beta1 Rrm In Complex Wit 1e-04
2kxn_B129 Nmr Structure Of Human Tra2beta1 Rrm In Complex Wit 1e-04
2cqg_A103 Solution Structure Of The Rna Binding Domain Of Tar 1e-04
2cqg_A103 Solution Structure Of The Rna Binding Domain Of Tar 3e-04
2rrb_A96 Refinement Of Rna Binding Domain In Human Tra2 Beta 2e-04
2rrb_A96 Refinement Of Rna Binding Domain In Human Tra2 Beta 2e-04
2rra_A99 Solution Structure Of Rna Binding Domain In Human T 2e-04
2rra_A99 Solution Structure Of Rna Binding Domain In Human T 2e-04
2qfj_A216 Crystal Structure Of First Two Rrm Domains Of Fir B 2e-04
1u6f_A139 Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit 2e-04
1x5s_A102 Solution Structure Of Rrm Domain In A18 Hnrnp Lengt 2e-04
1x5s_A102 Solution Structure Of Rrm Domain In A18 Hnrnp Lengt 6e-04
2ki2_A90 Solution Structure Of Ss-Dna Binding Protein 12rnp2 2e-04
2x1a_A97 Structure Of Rna15 Rrm With Rna Bound (G) Length = 3e-04
2kxf_A199 Solution Structure Of The First Two Rrm Domains Of 3e-04
2x1f_A96 Structure Of Rna15 Rrm With Bound Rna (Gu) Length = 3e-04
2km8_B84 Interdomain Rrm Packing Contributes To Rna Recognit 4e-04
2cqb_A102 Solution Structure Of The Rna Recognition Motif In 4e-04
3mdf_A85 Crystal Structure Of The Rrm Domain Of Cyclophilin 4e-04
2kyx_A83 Solution Structure Of The Rrm Domain Of Cyp33 Lengt 4e-04
3lpy_A79 Crystal Structure Of The Rrm Domain Of Cyp33 Length 5e-04
2ku7_A140 Solution Structure Of Mll1 Phd3-Cyp33 Rrm Chimeric 5e-04
3uwt_A200 Crystal Structure Of A Rna Binding Domain Of Poly-U 5e-04
2cqd_A116 Solution Structure Of The Rna Recognition Motif In 6e-04
>pdb|2CJK|A Chain A, Structure Of The Rna Binding Domain Of Hrp1 In Complex With Rna Length = 167 Back     alignment and structure

Iteration: 1

Score = 95.5 bits (236), Expect = 8e-20, Method: Composition-based stats. Identities = 46/150 (30%), Positives = 84/150 (56%), Gaps = 1/150 (0%) Query: 114 EELKEHFSKYGEIENVTLKSDPNTGRSRGFAFIVFKDTESLEKASVEDVIAEGNHVINNX 173 + L+E+F KYG + ++ + DP TGRSRGF F+ F+ S+++ I +G VI+ Sbjct: 18 DNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQHILDGK-VIDPK 76 Query: 174 XXXXXXXXXXXXXIFVGGLSPEMKDEEIKAHFAQFGNIIETEMPYDKSKSQRKNFCFITF 233 IFVGG+ P+++ +E + F+Q+G II+ ++ DK Q + F F+T+ Sbjct: 77 RAIPRDEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTY 136 Query: 234 EHESVVIDLLKNPKQKINDKEVDVKKATPK 263 + V + +N D+++++K+A P+ Sbjct: 137 DSADAVDRVCQNKFIDFKDRKIEIKRAEPR 166
>pdb|2CJK|A Chain A, Structure Of The Rna Binding Domain Of Hrp1 In Complex With Rna Length = 167 Back     alignment and structure
>pdb|2UP1|A Chain A, Structure Of Up1-Telomeric Dna Complex Length = 183 Back     alignment and structure
>pdb|2UP1|A Chain A, Structure Of Up1-Telomeric Dna Complex Length = 183 Back     alignment and structure
>pdb|1L3K|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 196 Back     alignment and structure
>pdb|1L3K|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 196 Back     alignment and structure
>pdb|2LYV|A Chain A, Solution Structure Of The Two Rrm Domains Of Hnrnp A1 (up1) Using Segmental Isotope Labeling Length = 197 Back     alignment and structure
>pdb|2LYV|A Chain A, Solution Structure Of The Two Rrm Domains Of Hnrnp A1 (up1) Using Segmental Isotope Labeling Length = 197 Back     alignment and structure
>pdb|1PGZ|A Chain A, Crystal Structure Of Up1 Complexed With D(Ttagggttag(6-Mi) G); A Human Telomeric Repeat Containing 6-Methyl-8-(2- Deoxy-Beta-Ribofuranosyl)isoxanthopteridine (6-Mi) Length = 195 Back     alignment and structure
>pdb|1PGZ|A Chain A, Crystal Structure Of Up1 Complexed With D(Ttagggttag(6-Mi) G); A Human Telomeric Repeat Containing 6-Methyl-8-(2- Deoxy-Beta-Ribofuranosyl)isoxanthopteridine (6-Mi) Length = 195 Back     alignment and structure
>pdb|1HA1|A Chain A, Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 Back     alignment and structure
>pdb|1HA1|A Chain A, Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 Back     alignment and structure
>pdb|1UP1|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 182 Back     alignment and structure
>pdb|1UP1|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 182 Back     alignment and structure
>pdb|3S7R|A Chain A, Crystal Structure Of A Heterogeneous Nuclear Ribonucleoprotein AB (Hnrpab) From Homo Sapiens At 2.15 A Resolution Length = 87 Back     alignment and structure
>pdb|1HD0|A Chain A, Heterogeneous Nuclear Ribonucleoprotein D0 (Hnrnp D0 Rbd1), Nmr Length = 75 Back     alignment and structure
>pdb|1IQT|A Chain A, Solution Structure Of The C-Terminal Rna-Binding Domain Of Heterogeneous Nuclear Ribonucleoprotein D0 (Auf1) Length = 75 Back     alignment and structure
>pdb|1IQT|A Chain A, Solution Structure Of The C-Terminal Rna-Binding Domain Of Heterogeneous Nuclear Ribonucleoprotein D0 (Auf1) Length = 75 Back     alignment and structure
>pdb|1WTB|A Chain A, Complex Structure Of The C-Terminal Rna-Binding Domain Of Hnrnp D (Auf1) With Telomere Dna Length = 79 Back     alignment and structure
>pdb|1WTB|A Chain A, Complex Structure Of The C-Terminal Rna-Binding Domain Of Hnrnp D (Auf1) With Telomere Dna Length = 79 Back     alignment and structure
>pdb|2MSS|A Chain A, Musashi1 Rbd2, Nmr Length = 75 Back     alignment and structure
>pdb|2DGS|A Chain A, Solution Structure Of The Second Rna Binding Domain In Daz- Associated Protein 1 Length = 99 Back     alignment and structure
>pdb|2DH8|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Daz-Associated Protein 1 Length = 105 Back     alignment and structure
>pdb|2DH8|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Daz-Associated Protein 1 Length = 105 Back     alignment and structure
>pdb|1FXL|A Chain A, Crystal Structure Of Hud And Au-Rich Element Of The C-Fos Rna Length = 167 Back     alignment and structure
>pdb|1FNX|H Chain H, Solution Structure Of The Huc Rbd1-Rbd2 Complexed With The Au-Rich Element Length = 174 Back     alignment and structure
>pdb|2RS2|A Chain A, 1h, 13c, And 15n Chemical Shift Assignments For Musashi1 Rbd1:r(Guagu) Complex Length = 109 Back     alignment and structure
>pdb|2RS2|A Chain A, 1h, 13c, And 15n Chemical Shift Assignments For Musashi1 Rbd1:r(Guagu) Complex Length = 109 Back     alignment and structure
>pdb|2RS2|A Chain A, 1h, 13c, And 15n Chemical Shift Assignments For Musashi1 Rbd1:r(Guagu) Complex Length = 109 Back     alignment and structure
>pdb|1UAW|A Chain A, Solution Structure Of The N-Terminal Rna-Binding Domain Of Mouse Musashi1 Length = 77 Back     alignment and structure
>pdb|1UAW|A Chain A, Solution Structure Of The N-Terminal Rna-Binding Domain Of Mouse Musashi1 Length = 77 Back     alignment and structure
>pdb|1UAW|A Chain A, Solution Structure Of The N-Terminal Rna-Binding Domain Of Mouse Musashi1 Length = 77 Back     alignment and structure
>pdb|4EGL|A Chain A, Crystal Structure Of Two Tandem Rna Recognition Motifs Of Human Antigen R Length = 177 Back     alignment and structure
>pdb|4ED5|A Chain A, Crystal Structure Of The Two N-Terminal Rrm Domains Of Hur Complexed With Rna Length = 177 Back     alignment and structure
>pdb|2DNZ|A Chain A, Solution Structure Of The Second Rna Binding Domain Of Rna Binding Motif Protein 23 Length = 95 Back     alignment and structure
>pdb|2DNZ|A Chain A, Solution Structure Of The Second Rna Binding Domain Of Rna Binding Motif Protein 23 Length = 95 Back     alignment and structure
>pdb|2JRS|A Chain A, Solution Nmr Structure Of Caper Rrm2 Domain. Northeast Structural Genomics Target Hr4730a Length = 108 Back     alignment and structure
>pdb|2JRS|A Chain A, Solution Nmr Structure Of Caper Rrm2 Domain. Northeast Structural Genomics Target Hr4730a Length = 108 Back     alignment and structure
>pdb|2DH7|A Chain A, Solution Structure Of The Second Rna Binding Domain In Nucleolysin Tiar Length = 105 Back     alignment and structure
>pdb|2DGO|A Chain A, Solution Structure Of The Rna Binding Domain In Cytotoxic Granule-Associated Rna Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|2CQC|A Chain A, Solution Structure Of The Rna Recognition Motif In ArginineSERINE-Rich Splicing Factor 10 Length = 95 Back     alignment and structure
>pdb|2CQC|A Chain A, Solution Structure Of The Rna Recognition Motif In ArginineSERINE-Rich Splicing Factor 10 Length = 95 Back     alignment and structure
>pdb|2KXN|B Chain B, Nmr Structure Of Human Tra2beta1 Rrm In Complex With Aagaac Rna Length = 129 Back     alignment and structure
>pdb|2KXN|B Chain B, Nmr Structure Of Human Tra2beta1 Rrm In Complex With Aagaac Rna Length = 129 Back     alignment and structure
>pdb|2CQG|A Chain A, Solution Structure Of The Rna Binding Domain Of Tar Dna- Binding Protein-43 Length = 103 Back     alignment and structure
>pdb|2CQG|A Chain A, Solution Structure Of The Rna Binding Domain Of Tar Dna- Binding Protein-43 Length = 103 Back     alignment and structure
>pdb|2RRB|A Chain A, Refinement Of Rna Binding Domain In Human Tra2 Beta Protein Length = 96 Back     alignment and structure
>pdb|2RRB|A Chain A, Refinement Of Rna Binding Domain In Human Tra2 Beta Protein Length = 96 Back     alignment and structure
>pdb|2RRA|A Chain A, Solution Structure Of Rna Binding Domain In Human Tra2 Beta Protein In Complex With Rna (Gaagaa) Length = 99 Back     alignment and structure
>pdb|2RRA|A Chain A, Solution Structure Of Rna Binding Domain In Human Tra2 Beta Protein In Complex With Rna (Gaagaa) Length = 99 Back     alignment and structure
>pdb|2QFJ|A Chain A, Crystal Structure Of First Two Rrm Domains Of Fir Bound To Ssdna From A Portion Of Fuse Length = 216 Back     alignment and structure
>pdb|1U6F|A Chain A, Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit From Trypanosoma Cruzi Length = 139 Back     alignment and structure
>pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 Back     alignment and structure
>pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 Back     alignment and structure
>pdb|2KI2|A Chain A, Solution Structure Of Ss-Dna Binding Protein 12rnp2 Precursor, Hp0827(O25501_helpy) Form Helicobacter Pylori Length = 90 Back     alignment and structure
>pdb|2X1A|A Chain A, Structure Of Rna15 Rrm With Rna Bound (G) Length = 97 Back     alignment and structure
>pdb|2KXF|A Chain A, Solution Structure Of The First Two Rrm Domains Of Fbp-Interacting Repressor (Fir) Length = 199 Back     alignment and structure
>pdb|2X1F|A Chain A, Structure Of Rna15 Rrm With Bound Rna (Gu) Length = 96 Back     alignment and structure
>pdb|2KM8|B Chain B, Interdomain Rrm Packing Contributes To Rna Recognition In The Rna15, Hrp1, Anchor Rna 3' Processing Ternary Complex Length = 84 Back     alignment and structure
>pdb|2CQB|A Chain A, Solution Structure Of The Rna Recognition Motif In Peptidyl- Prolyl Cis-Trans Isomerase E Length = 102 Back     alignment and structure
>pdb|3MDF|A Chain A, Crystal Structure Of The Rrm Domain Of Cyclophilin 33 Length = 85 Back     alignment and structure
>pdb|2KYX|A Chain A, Solution Structure Of The Rrm Domain Of Cyp33 Length = 83 Back     alignment and structure
>pdb|3LPY|A Chain A, Crystal Structure Of The Rrm Domain Of Cyp33 Length = 79 Back     alignment and structure
>pdb|2KU7|A Chain A, Solution Structure Of Mll1 Phd3-Cyp33 Rrm Chimeric Protein Length = 140 Back     alignment and structure
>pdb|3UWT|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 2.50 A Resolution Length = 200 Back     alignment and structure
>pdb|2CQD|A Chain A, Solution Structure Of The Rna Recognition Motif In Rna- Binding Region Containing Protein 1 Length = 116 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query661
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 100.0
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 100.0
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 100.0
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 100.0
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.97
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.96
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.96
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.96
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.96
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.96
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.96
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.94
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.94
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.93
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.93
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.93
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.93
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.92
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.92
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.92
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.92
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.92
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.91
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.91
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.91
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.91
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.91
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.9
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.9
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.9
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.88
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.87
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.86
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.86
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.86
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.82
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.82
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.74
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.73
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.73
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.72
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.72
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.7
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.69
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.67
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.66
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.65
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.64
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.64
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.64
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.64
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.63
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.63
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.62
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.62
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.62
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.62
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.61
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.61
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.61
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.61
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.61
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.61
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.61
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.61
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.61
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.61
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.6
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.6
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.6
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.6
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.6
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.6
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.6
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.6
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.6
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.59
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.59
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.59
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.59
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.59
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.59
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.58
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.58
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.58
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.58
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.58
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.58
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.58
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.58
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.58
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.58
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.58
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.58
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.58
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.58
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.57
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.57
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.57
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.57
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.57
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.57
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.57
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.57
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.56
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.56
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.56
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.56
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.56
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.56
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.56
2div_A99 TRNA selenocysteine associated protein; structural 99.56
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.56
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.56
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.55
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.55
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.55
2div_A99 TRNA selenocysteine associated protein; structural 99.55
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.55
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.55
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.55
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.55
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.55
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.54
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.54
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.54
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.54
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.54
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.54
2dis_A109 Unnamed protein product; structural genomics, RRM 99.54
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.54
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.54
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.53
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.53
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.53
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.53
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.53
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.53
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.53
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.53
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.53
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.53
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.53
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.53
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.53
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.53
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.53
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.53
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.53
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.53
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.52
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.52
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.52
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.52
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.52
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.52
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.52
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.52
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.52
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.52
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.52
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.51
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.51
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.51
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.51
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.51
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.51
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.51
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.51
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.51
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.51
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.51
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.26
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.51
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.51
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.51
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.5
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.5
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.5
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.5
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.5
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.5
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.5
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.5
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.5
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.5
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.5
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.49
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.49
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.49
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.49
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.49
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.49
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.49
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.49
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.49
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.49
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.49
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.49
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.49
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.49
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.49
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.49
2dis_A109 Unnamed protein product; structural genomics, RRM 99.48
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.48
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.48
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.48
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.48
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.48
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.48
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.48
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.48
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.48
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.48
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.48
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.48
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.48
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.48
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.47
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.47
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.47
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.47
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.47
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.47
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.47
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.47
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.46
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.46
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.46
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.46
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.46
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.46
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.46
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.46
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.46
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.46
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.46
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.46
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.46
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.46
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.46
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.46
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.45
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.45
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.45
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.45
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.45
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.45
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.45
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.45
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.45
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.45
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.45
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.45
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.45
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.45
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.44
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.44
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.44
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.44
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.44
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.44
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.44
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.44
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.44
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.44
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.44
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.44
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.44
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.44
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.44
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.44
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.44
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.44
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.43
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.43
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.43
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.43
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.43
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.43
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.42
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.42
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.42
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.41
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.41
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.41
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.41
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.41
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.41
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.4
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.4
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.4
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.4
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.4
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.4
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.4
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.39
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.39
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.39
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.39
1x5p_A97 Negative elongation factor E; structure genomics, 99.38
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.38
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.38
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.37
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.36
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.36
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.36
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.36
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.03
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.34
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.34
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.34
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.34
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.33
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.33
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.33
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.33
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.33
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.33
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.33
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.32
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.32
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.32
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.32
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.31
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.31
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.31
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.3
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.3
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.3
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.3
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.3
1x5p_A97 Negative elongation factor E; structure genomics, 99.29
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.29
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.29
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.29
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.27
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.27
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.27
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.27
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.26
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.26
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.25
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.25
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.25
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.24
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.24
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.24
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.24
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.23
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.23
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.23
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.22
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.22
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.2
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.19
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.17
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.14
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.14
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.13
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.13
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.12
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.12
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.12
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.11
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.09
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.06
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.05
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 99.03
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 98.87
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 98.87
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 98.76
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.72
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.66
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.6
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.47
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.38
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.32
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.21
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.21
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 97.65
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.52
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.46
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 97.43
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 96.4
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 96.27
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 96.21
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 96.08
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 95.86
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 95.78
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 95.73
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 95.56
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 95.27
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 95.13
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 94.25
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 93.97
3pq1_A464 Poly(A) RNA polymerase; nucleotidyl transferase, R 92.43
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 91.84
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 91.25
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 90.62
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
Probab=100.00  E-value=6.5e-35  Score=301.71  Aligned_cols=248  Identities=14%  Similarity=0.199  Sum_probs=202.9

Q ss_pred             CCcEEEEcCCCcCCHHHHHHHhhcCCCeeEEEEeeCCCCCCcccEEEEEEeehhhHHHhhHHHHHHhCCeeecceeehhh
Q psy15852         99 KNKMVSHPGIVHKITEELKEHFSKYGEIENVTLKSDPNTGRSRGFAFIVFKDTESLEKASVEDVIAEGNHVINNKKIEAK  178 (661)
Q Consensus        99 ~~~~~~~~~~~~~te~~L~~~F~~~G~I~~v~l~~~~~tg~srG~afV~F~~~e~A~~A~~~~~~~~~~~~i~g~~i~v~  178 (661)
                      ..++++.++++++++++|+++|+.||+|.+|+|++++.  .++|||||+|.+.++|.+|    + .+++..+.|+.|.|.
T Consensus        41 ~~~l~V~nLp~~~t~~~l~~~F~~~G~i~~v~i~~~~~--~~~g~afV~f~~~~~A~~A----~-~~~~~~~~g~~i~v~  113 (292)
T 2ghp_A           41 LTTVLVKNLPKSYNQNKVYKYFKHCGPIIHVDVADSLK--KNFRFARIEFARYDGALAA----I-TKTHKVVGQNEIIVS  113 (292)
T ss_dssp             -CEEEEEEECTTCCHHHHHHHHGGGSCEEEEEEEECTT--SSSEEEEEEESSHHHHHHH----H-TTTTCEETTEECEEE
T ss_pred             CCEEEEeCCCCCCCHHHHHHHHHhcCCeEEEEEEECCC--CCcEEEEEEECCHHHHHHH----H-HhCCcEeCCcEEEEE
Confidence            44555555556999999999999999999999999875  3689999999999999997    6 689999999999998


Q ss_pred             hhhccCCeeEecCCCccCCHHHHHHHHhcCC-CeEEEEeccCCCCCCcCcEEEEEeCCHHHHHHHHHhC-CCccCCeEEE
Q psy15852        179 KAKAKSGKIFVGGLSPEMKDEEIKAHFAQFG-NIIETEMPYDKSKSQRKNFCFITFEHESVVIDLLKNP-KQKINDKEVD  256 (661)
Q Consensus       179 ~~~~~~~~lfV~nLp~~~te~~L~~~F~~~G-~i~~v~i~~~~~~g~~~g~afV~f~~~~~A~~Al~~~-~~~~~g~~i~  256 (661)
                      ++  ..++|||+|||+.+++++|+++|++|| .|..|.++.+.. +.++|||||+|.+.++|.+|++.+ +..+.|+.|.
T Consensus       114 ~~--~~~~l~v~nlp~~~t~~~l~~~f~~~G~~i~~v~i~~~~~-~~~~g~afV~f~~~~~a~~A~~~l~g~~~~g~~l~  190 (292)
T 2ghp_A          114 HL--TECTLWMTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRF-NTSRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLV  190 (292)
T ss_dssp             EC--CSCEEEEECCCTTCCHHHHHHHHHHTTCCCCEEECC--------CCEEEEECSSHHHHHHHHHHHTTCEETTEECE
T ss_pred             EC--CCCEEEEECCCCCCCHHHHHHHHHHhCCCeEEEEEEeCCC-CCcceEEEEEECCHHHHHHHHHHhCCCEeCCcEEE
Confidence            76  468999999999999999999999999 999999998876 788999999999999999999965 7899999999


Q ss_pred             EEeccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccccccccCCCCCCCCCCCCCCCCCCCCC
Q psy15852        257 VKKATPKPEPFGVRGGRGGRGGRGGRGGRMAGGYGGYGGYGGGYGGILYKPLLFYELNELGISGRSLVCRTGPMVQATPP  336 (661)
Q Consensus       257 V~~a~~k~~~~~~~~~~~~~g~~~g~~~~~~~~~g~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  336 (661)
                      |.++.++......                                                                  .
T Consensus       191 v~~a~~~~~~~~~------------------------------------------------------------------~  204 (292)
T 2ghp_A          191 TKVSNPLEKSKRT------------------------------------------------------------------D  204 (292)
T ss_dssp             EEECCCC-------------------------------------------------------------------------
T ss_pred             EEECCCCcccccc------------------------------------------------------------------c
Confidence            9999865432000                                                                  0


Q ss_pred             CcccCCCccEEEEecCCCCCCCCCCCCCCCCChhHHHhhhccccccccccccccccccCCCCC-cCccchhhhhhccCcc
Q psy15852        337 LAEVDVTGVIMILLGAKNHNSDENPTSRSHPSQNAIKLYLTRSSYREWGHVADNLLLCDNFPS-IRELEIPEAFLTKTTT  415 (661)
Q Consensus       337 ~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~p~-~~~~~l~~~f~~~~~~  415 (661)
                      .                                              ......++++.++.+. +++++|+++|..|   
T Consensus       205 ~----------------------------------------------~~~~~~~l~v~nlp~~~~t~~~l~~~F~~~---  235 (292)
T 2ghp_A          205 S----------------------------------------------ATLEGREIMIRNLSTELLDENLLRESFEGF---  235 (292)
T ss_dssp             ------------------------------------------------CCTTTEEEEEEECTTTCCHHHHHHHHGGG---
T ss_pred             c----------------------------------------------cCCCCceEEEECCCcccCCHHHHHHHHhcc---
Confidence            0                                              0001234566666677 8999999999888   


Q ss_pred             cccCCcccchhhcccccccchhhccCCceeEEeeeccccc-CCcccceEEEEeCChHHHHHHHhCCCCcCCCcEEEEecC
Q psy15852        416 VPMTTTEHMVLVTGTDMMHMEVTEAVPMEIIETEMPYDKS-KSQRKNFCFITFEHESVVIDLLKNPKQKINDKEVDVKKA  494 (661)
Q Consensus       416 ~~~~~~~~~~~~~~~~~~~~~~~~~~~G~i~~~~~~~d~~-~~~~~g~aFV~F~~~e~A~~Ai~~~~~~l~g~~i~v~~a  494 (661)
                                                 |.|..+.++.+.. ++.++|||||+|.+.++|.+|+.+++..+.|+.|.|.++
T Consensus       236 ---------------------------G~v~~v~i~~~~~~tg~~~g~afV~F~~~~~A~~A~~l~g~~~~g~~i~V~~a  288 (292)
T 2ghp_A          236 ---------------------------GSIEKINIPAGQKEHSFNNCCAFMVFENKDSAERALQMNRSLLGNREISVSLA  288 (292)
T ss_dssp             ---------------------------SCEEEEECCSCCC---CCCEEEEEEESSHHHHHHHGGGTTEEETTEEEEEEEC
T ss_pred             ---------------------------CCeeEEEEEecCCcCCCCceEEEEEeCCHHHHHHHHHhcCCEECCcEEEEEEe
Confidence                                       7799999999877 689999999999999999999977778899999999999


Q ss_pred             CCCC
Q psy15852        495 TPKP  498 (661)
Q Consensus       495 ~~~~  498 (661)
                      .+++
T Consensus       289 ~~k~  292 (292)
T 2ghp_A          289 DKKP  292 (292)
T ss_dssp             CCCC
T ss_pred             cCCC
Confidence            8863



>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 661
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 3e-22
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 4e-10
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 1e-07
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 1e-05
d1u1qa_ 183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 2e-05
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 2e-04
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 6e-17
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 1e-10
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 5e-06
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 1e-05
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 9e-17
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 1e-11
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 2e-06
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 1e-04
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-15
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 4e-11
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-06
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-04
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 4e-15
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 2e-09
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 2e-04
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 2e-04
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 3e-14
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 5e-12
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 2e-07
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 5e-14
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 9e-10
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 2e-05
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 0.002
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 2e-13
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 1e-09
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 3e-05
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 8e-13
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 9e-07
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 9e-13
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 1e-06
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 1e-12
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 6e-10
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 7e-08
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 1e-12
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 1e-06
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 1e-12
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 2e-05
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 0.002
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 0.003
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 2e-12
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 1e-05
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 1e-04
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 8e-12
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 7e-05
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 6e-04
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 1e-11
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 3e-04
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-11
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-07
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-04
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 2e-11
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 6e-07
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 0.002
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 2e-11
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 6e-08
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 1e-04
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 3e-11
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 4e-04
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 4e-11
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 1e-06
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 0.004
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 5e-11
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 2e-08
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 1e-06
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 1e-10
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 5e-04
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 2e-10
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 4e-04
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 3e-10
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 5e-06
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 5e-04
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 3e-10
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 1e-06
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 1e-06
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 4e-10
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 7e-10
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 9e-04
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 8e-10
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 0.001
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 9e-10
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 2e-07
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 0.001
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 1e-09
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 0.001
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 1e-09
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 6e-05
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 7e-05
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-09
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 5e-07
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-04
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 2e-09
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 2e-09
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 4e-05
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 2e-09
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 2e-04
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 3e-09
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 3e-09
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 5e-04
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 5e-09
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 0.001
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 6e-09
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 4e-08
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 3e-04
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 9e-09
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 1e-08
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 5e-04
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 2e-08
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 2e-08
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 7e-04
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 3e-08
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 3e-08
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 0.002
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 3e-08
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 4e-08
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 8e-05
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 4e-08
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 0.002
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 4e-08
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 3e-07
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-04
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 4e-08
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 0.002
d1wela1112 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human 4e-08
d1wela1112 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human 0.002
d1wela1112 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human 0.002
d1wg5a_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 5e-08
d1wg5a_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 4e-04
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 7e-08
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 7e-08
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 3e-04
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 1e-07
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 1e-04
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 0.002
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 2e-07
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 0.001
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 2e-07
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 0.002
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 2e-07
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 5e-07
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 9e-04
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 2e-06
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 9e-04
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 4e-06
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 2e-05
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 2e-04
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 3e-05
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 3e-05
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 1e-04
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 4e-04
d3begb187 d.58.7.1 (B:121-207) Splicing factor, arginine/ser 0.001
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 0.002
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 0.002
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 0.003
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 0.002
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 0.002
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 0.002
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 0.003
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 0.004
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 92.4 bits (228), Expect = 3e-22
 Identities = 43/158 (27%), Positives = 78/158 (49%), Gaps = 6/158 (3%)

Query: 114 EELKEHFSKYGEIENVTLKSDPNTGRSRGFAFIVFKDTESLEKASVEDVIAEGNHVINNK 173
           E L+ HF ++G + +  +  DPNT RSRGF F+ +   E ++ A           V+  K
Sbjct: 21  ESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPK 80

Query: 174 KIEAKK------AKAKSGKIFVGGLSPEMKDEEIKAHFAQFGNIIETEMPYDKSKSQRKN 227
           +  +++      A     KIFVGG+  + ++  ++ +F Q+G I   E+  D+   +++ 
Sbjct: 81  RAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRG 140

Query: 228 FCFITFEHESVVIDLLKNPKQKINDKEVDVKKATPKPE 265
           F F+TF+    V  ++      +N    +V+KA  K E
Sbjct: 141 FAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQE 178


>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query661
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.95
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.9
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.73
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.73
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.73
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.71
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.71
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.71
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.71
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.71
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.7
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.7
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.69
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.69
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.68
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.68
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.68
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.68
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.68
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.68
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.67
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.67
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.67
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.67
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.67
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.67
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.67
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.67
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.66
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.66
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.66
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.66
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.65
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.65
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.65
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.65
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.65
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.65
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.65
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.64
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.64
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.64
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.64
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.64
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.64
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.63
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.63
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.63
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.63
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.63
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.62
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.62
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.61
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.61
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.61
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.61
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.61
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.6
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.6
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.6
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.6
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.59
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.59
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.58
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.58
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.57
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.57
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.57
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.57
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.57
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.57
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.57
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.56
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.56
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.56
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.56
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.56
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.56
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.56
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.56
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.55
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.55
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.54
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.54
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.54
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.53
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.53
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.53
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.53
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.51
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.51
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.51
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.51
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.51
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.51
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.5
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.5
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.5
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.5
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.49
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.49
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.49
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.49
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.49
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.49
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.49
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.48
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.48
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.48
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.48
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.48
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.48
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.48
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.48
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.46
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.46
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.46
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.45
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.45
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.44
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.44
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.43
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.43
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.43
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.42
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.42
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.42
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.42
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.41
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.41
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.4
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.4
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.4
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.39
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.39
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.39
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.39
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.39
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.38
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.38
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.37
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.37
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.36
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.36
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.36
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.36
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.36
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.34
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.34
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.33
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.3
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.27
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.26
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.26
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.26
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.25
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.23
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.22
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.21
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.2
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.19
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.17
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.16
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.15
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.14
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.11
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.08
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.03
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 98.95
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.93
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 98.86
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.82
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 96.28
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 95.86
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 95.8
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 95.54
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 95.47
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 95.33
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 94.73
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 90.68
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.95  E-value=2.3e-27  Score=225.20  Aligned_cols=161  Identities=28%  Similarity=0.557  Sum_probs=142.5

Q ss_pred             CcEEEEcCCCcCCHHHHHHHhhcCCCeeEEEEeeCCCCCCcccEEEEEEeehhhHHHhhHHHHHHhCCeeecceeehhhh
Q psy15852        100 NKMVSHPGIVHKITEELKEHFSKYGEIENVTLKSDPNTGRSRGFAFIVFKDTESLEKASVEDVIAEGNHVINNKKIEAKK  179 (661)
Q Consensus       100 ~~~~~~~~~~~~te~~L~~~F~~~G~I~~v~l~~~~~tg~srG~afV~F~~~e~A~~A~~~~~~~~~~~~i~g~~i~v~~  179 (661)
                      ++++|.++++++|+++|+++|++||+|.++.+++++.++.++|||||+|.++++|.+|     ....+..+..+.+.+.+
T Consensus         7 r~lfV~nLp~~~te~~L~~~F~~~G~v~~~~~~~~~~~~~~~g~afv~f~~~~~a~~a-----~~~~~~~~~~~~~~~~~   81 (183)
T d1u1qa_           7 RKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAA-----MNARPHKVDGRVVEPKR   81 (183)
T ss_dssp             HEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHH-----HHTCSCEETTEECEEEE
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHcCCEEEEEeeecccCCCccCceecccCCHHHHHHH-----HHhcCCcccccchhhhh
Confidence            4566666666999999999999999999999999999999999999999999999996     55666677777766544


Q ss_pred             hh-----------ccCCeeEecCCCccCCHHHHHHHHhcCCCeEEEEeccCCCCCCcCcEEEEEeCCHHHHHHHHHhCCC
Q psy15852        180 AK-----------AKSGKIFVGGLSPEMKDEEIKAHFAQFGNIIETEMPYDKSKSQRKNFCFITFEHESVVIDLLKNPKQ  248 (661)
Q Consensus       180 ~~-----------~~~~~lfV~nLp~~~te~~L~~~F~~~G~i~~v~i~~~~~~g~~~g~afV~f~~~~~A~~Al~~~~~  248 (661)
                      ..           ...++|||+|||+.+++++|+++|+.||.|..+.++.+..++.++|||||+|.++++|.+||+.+++
T Consensus        82 ~~~~~~~~~~~~~~~~~~i~V~~lp~~~te~~L~~~f~~~G~v~~~~i~~~~~~~~~~g~~fV~f~~~e~A~~Al~~~~~  161 (183)
T d1u1qa_          82 AVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYH  161 (183)
T ss_dssp             CCCTTGGGSTTTTCCCSEEEEECCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESCHHHHHHHHTSSCE
T ss_pred             hhhcccccccccccccceeEEccCCCcCCHHHHhhhhccCCceeeeeeecccccCccceeEEEEECCHHHHHHHHHhCCC
Confidence            32           2237999999999999999999999999999999999999999999999999999999999987788


Q ss_pred             ccCCeEEEEEeccCCCC
Q psy15852        249 KINDKEVDVKKATPKPE  265 (661)
Q Consensus       249 ~~~g~~i~V~~a~~k~~  265 (661)
                      .++|++|.|.+|.+|.+
T Consensus       162 ~~~G~~i~V~~A~~k~e  178 (183)
T d1u1qa_         162 TVNGHNCEVRKALSKQE  178 (183)
T ss_dssp             EETTEEEEEEECCCHHH
T ss_pred             eECCEEEEEEecCCccc
Confidence            89999999999987654



>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure